Psyllid ID: psy16860

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MNNTIYNSLNYTYNINYTSTNFSNTSLFPTNSTIHIHIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSFDVYFSQYRKHFNMYEVDFE
cccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHccEEEEccccHHHHHHHHHHHccHHHHHHHHHcccc
cccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcHHHHHHHHHHHHHHHHHHHHHHHEEEccc
mnntiynsLNYTYNINYtstnfsntslfptnstihihiFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSFDVYFSQYRKHFNMYEVDFE
MNNTIYNSLNYTYNINYTSTNFSNTSLFPTNSTIHIHIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSFDVYFSQYRKHFNMYEVDFE
MnntiynslnytyninytstnfsntslfptnstIHIHIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSFDVYFSQYRKHFNMYEVDFE
****IYNSLNYTYNINYTSTNFSNTSLFPTNSTIHIHIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSFDVYFSQYRKHFNMYEV***
****I*NSLNYTYNINYTSTNFSNTSLFPTNSTIHIHIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSFDVYFSQYRKHFNMYEVDFE
MNNTIYNSLNYTYNINYTSTNFSNTSLFPTNSTIHIHIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSFDVYFSQYRKHFNMYEVDFE
*********************************IHIHIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSFDVYFSQYRKHFNMYEVDFE
ooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooo
oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNTIYNSLNYTYNINYTSTNFSNTSLFPTNSTIHIHIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSFDVYFSQYRKHFNMYEVDFE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query139 2.2.26 [Sep-21-2011]
Q9VCZ3 508 Octopamine receptor beta- yes N/A 0.640 0.175 0.651 3e-28
Q4LBB6 1256 Octopamine receptor beta- no N/A 0.589 0.065 0.662 2e-25
Q4LBB9 536 Octopamine receptor beta- no N/A 0.611 0.158 0.611 5e-23
Q91175 470 Alpha-1A adrenergic recep N/A N/A 0.582 0.172 0.444 3e-17
P22270 601 Tyramine/octopamine recep no N/A 0.582 0.134 0.456 5e-17
P35368 520 Alpha-1B adrenergic recep yes N/A 0.748 0.2 0.409 5e-17
P18841 515 Alpha-1B adrenergic recep N/A N/A 0.733 0.198 0.407 8e-17
P15823 515 Alpha-1B adrenergic recep yes N/A 0.733 0.198 0.407 1e-16
P23944 561 Alpha-1D adrenergic recep no N/A 0.561 0.139 0.487 1e-16
O02666 576 Alpha-1D adrenergic recep no N/A 0.561 0.135 0.487 2e-16
>sp|Q9VCZ3|OCTB1_DROME Octopamine receptor beta-1R OS=Drosophila melanogaster GN=oa2 PE=2 SV=1 Back     alignment and function desciption
 Score =  123 bits (309), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 72/89 (80%)

Query: 37  HIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMP 96
           H+    +K  ++ FII+ AILGN+LVI+SV++HRKLRIITNYFVVSLA AD+LVALC M 
Sbjct: 103 HLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMT 162

Query: 97  FNAIVSLTDEWYFGYFMCDVWNSFDVYFS 125
           FNA V ++ +W FG  MCD+WNSFDVYFS
Sbjct: 163 FNASVMISGKWMFGSVMCDMWNSFDVYFS 191
Receptor for octopamine. Octopamine (OA) is a neurotransmitter, neurohormone, and neuromodulator in invertebrates. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Octopamine does not cause Ca(2+) release in oa2-expressing cells.
Drosophila melanogaster (taxid: 7227)
>sp|Q4LBB6|OCTB3_DROME Octopamine receptor beta-3R OS=Drosophila melanogaster GN=Octbeta3R PE=2 SV=4 Back     alignment and function description
>sp|Q4LBB9|OCTB2_DROME Octopamine receptor beta-2R OS=Drosophila melanogaster GN=Octbeta2R PE=2 SV=2 Back     alignment and function description
>sp|Q91175|ADA1A_ORYLA Alpha-1A adrenergic receptor OS=Oryzias latipes GN=adra1a PE=3 SV=1 Back     alignment and function description
>sp|P22270|OAR_DROME Tyramine/octopamine receptor OS=Drosophila melanogaster GN=Oct-TyrR PE=2 SV=2 Back     alignment and function description
>sp|P35368|ADA1B_HUMAN Alpha-1B adrenergic receptor OS=Homo sapiens GN=ADRA1B PE=1 SV=3 Back     alignment and function description
>sp|P18841|ADA1B_MESAU Alpha-1B adrenergic receptor OS=Mesocricetus auratus GN=ADRA1B PE=1 SV=1 Back     alignment and function description
>sp|P15823|ADA1B_RAT Alpha-1B adrenergic receptor OS=Rattus norvegicus GN=Adra1b PE=2 SV=2 Back     alignment and function description
>sp|P23944|ADA1D_RAT Alpha-1D adrenergic receptor OS=Rattus norvegicus GN=Adra1d PE=2 SV=2 Back     alignment and function description
>sp|O02666|ADA1D_RABIT Alpha-1D adrenergic receptor OS=Oryctolagus cuniculus GN=ADRA1D PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
242022774 350 class A rhodopsin-like G-protein coupled 0.647 0.257 0.703 3e-29
291278187 404 putative GPCR-type octopamine beta recep 0.597 0.205 0.734 3e-28
328705267 454 PREDICTED: octopamine receptor beta-3R-l 0.611 0.187 0.694 6e-28
340717342 335 PREDICTED: octopamine receptor beta-1R-l 0.899 0.373 0.511 8e-28
380021239 442 PREDICTED: octopamine receptor beta-2R-l 0.755 0.237 0.590 1e-27
242020588 432 class A rhodopsin-like G-protein coupled 0.604 0.194 0.726 1e-27
328776794 361 PREDICTED: octopamine receptor beta-2R i 0.604 0.232 0.702 2e-27
328776792 358 PREDICTED: octopamine receptor beta-2R i 0.604 0.234 0.702 2e-27
157816454 628 IP09484p [Drosophila melanogaster] 0.640 0.141 0.651 2e-27
383852938 358 PREDICTED: octopamine receptor beta-2R-l 0.604 0.234 0.702 2e-27
>gi|242022774|ref|XP_002431813.1| class A rhodopsin-like G-protein coupled receptor GPRoar4, putative [Pediculus humanus corporis] gi|212517145|gb|EEB19075.1| class A rhodopsin-like G-protein coupled receptor GPRoar4, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 76/91 (83%), Gaps = 1/91 (1%)

Query: 36  IHIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVM 95
           + + P I+KG +M  II+TA+LGN+LVIISVI+HRKLR+ITNY+VVSLA ADLLVALC M
Sbjct: 77  VPVVPAIVKGFIMGTIIVTAVLGNILVIISVIRHRKLRVITNYYVVSLAMADLLVALCAM 136

Query: 96  PFNAIVSLTDE-WYFGYFMCDVWNSFDVYFS 125
            FNA V LT+  W FGYFMCDV+NS DVYFS
Sbjct: 137 TFNASVELTNGMWLFGYFMCDVYNSLDVYFS 167

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|291278187|gb|ADD91575.1| putative GPCR-type octopamine beta receptor, partial [Schistocerca gregaria] Back     alignment and taxonomy information
>gi|328705267|ref|XP_001948521.2| PREDICTED: octopamine receptor beta-3R-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|340717342|ref|XP_003397143.1| PREDICTED: octopamine receptor beta-1R-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380021239|ref|XP_003694478.1| PREDICTED: octopamine receptor beta-2R-like [Apis florea] Back     alignment and taxonomy information
>gi|242020588|ref|XP_002430734.1| class A rhodopsin-like G-protein coupled receptor GPRoar1, putative [Pediculus humanus corporis] gi|212515931|gb|EEB17996.1| class A rhodopsin-like G-protein coupled receptor GPRoar1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328776794|ref|XP_003249220.1| PREDICTED: octopamine receptor beta-2R isoform 4 [Apis mellifera] Back     alignment and taxonomy information
>gi|328776792|ref|XP_003249219.1| PREDICTED: octopamine receptor beta-2R isoform 3 [Apis mellifera] Back     alignment and taxonomy information
>gi|157816454|gb|ABV82220.1| IP09484p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|383852938|ref|XP_003701982.1| PREDICTED: octopamine receptor beta-2R-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
FB|FBgn0038980 508 oa2 "octopamine receptor 2" [D 0.640 0.175 0.651 2.7e-27
FB|FBgn0250910 1256 Octbeta3R "Octbeta3R" [Drosoph 0.604 0.066 0.647 6.8e-23
FB|FBgn0038063 536 Octbeta2R "Octbeta2R" [Drosoph 0.611 0.158 0.611 7.1e-23
UNIPROTKB|F1LM98 379 Htr4 "5-hydroxytryptamine rece 0.604 0.221 0.522 4.2e-16
UNIPROTKB|F1LM90 398 Htr4 "5-hydroxytryptamine rece 0.604 0.211 0.522 5e-16
UNIPROTKB|O77621 295 ADRA1A "Alpha-1A adrenergic re 0.625 0.294 0.425 7.7e-16
UNIPROTKB|F1NJL4 371 HTR4 "Uncharacterized protein" 0.568 0.212 0.554 8.4e-16
UNIPROTKB|F1Q132 371 ADRA1D "Uncharacterized protei 0.561 0.210 0.487 8.4e-16
UNIPROTKB|F1P501 309 F1P501 "Uncharacterized protei 0.561 0.252 0.448 9.2e-16
UNIPROTKB|F1RLA8 366 HTR4 "5-hydroxytryptamine rece 0.604 0.229 0.511 1e-15
FB|FBgn0038980 oa2 "octopamine receptor 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 310 (114.2 bits), Expect = 2.7e-27, P = 2.7e-27
 Identities = 58/89 (65%), Positives = 72/89 (80%)

Query:    37 HIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMP 96
             H+    +K  ++ FII+ AILGN+LVI+SV++HRKLRIITNYFVVSLA AD+LVALC M 
Sbjct:   103 HLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMT 162

Query:    97 FNAIVSLTDEWYFGYFMCDVWNSFDVYFS 125
             FNA V ++ +W FG  MCD+WNSFDVYFS
Sbjct:   163 FNASVMISGKWMFGSVMCDMWNSFDVYFS 191
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA;ISS
GO:0008227 "G-protein coupled amine receptor activity" evidence=ISS
GO:0071875 "adrenergic receptor signaling pathway" evidence=IEA
GO:0004935 "adrenergic receptor activity" evidence=IEA
GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IDA
GO:0005887 "integral to plasma membrane" evidence=IC
GO:0004989 "octopamine receptor activity" evidence=IDA
GO:0051482 "elevation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway" evidence=IDA
GO:0045886 "negative regulation of synaptic growth at neuromuscular junction" evidence=IMP
FB|FBgn0250910 Octbeta3R "Octbeta3R" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038063 Octbeta2R "Octbeta2R" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1LM98 Htr4 "5-hydroxytryptamine receptor 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LM90 Htr4 "5-hydroxytryptamine receptor 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O77621 ADRA1A "Alpha-1A adrenergic receptor" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJL4 HTR4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q132 ADRA1D "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P501 F1P501 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RLA8 HTR4 "5-hydroxytryptamine receptor 4" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VCZ3OCTB1_DROMENo assigned EC number0.65160.64020.1751yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
pfam00001 251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 4e-12
PHA02638 417 PHA02638, PHA02638, CC chemokine receptor-like pro 4e-05
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information 
 Score = 61.2 bits (149), Expect = 4e-12
 Identities = 19/60 (31%), Positives = 32/60 (53%)

Query: 66  VIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSFDVYFS 125
           +++ +KLR  TN F+++LA ADLL  L + P+     +  +W FG  +C +     V   
Sbjct: 3   ILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGDWPFGDALCKLVGFLFVVNG 62

This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251
>gnl|CDD|165021 PHA02638, PHA02638, CC chemokine receptor-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 139
KOG4219|consensus 423 99.77
PHA03234 338 DNA packaging protein UL33; Provisional 99.75
PHA02834 323 chemokine receptor-like protein; Provisional 99.65
PHA02638 417 CC chemokine receptor-like protein; Provisional 99.57
PHA03235 409 DNA packaging protein UL33; Provisional 99.56
KOG4220|consensus 503 99.54
PHA03087 335 G protein-coupled chemokine receptor-like protein; 99.54
PF00001 257 7tm_1: 7 transmembrane receptor (rhodopsin family) 99.35
PF10320 257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 98.53
KOG2087|consensus 363 98.2
PF05296 303 TAS2R: Mammalian taste receptor protein (TAS2R); I 97.86
PF05462 303 Dicty_CAR: Slime mold cyclic AMP receptor 97.78
PF11710 201 Git3: G protein-coupled glucose receptor regulatin 97.71
PF10328 274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 96.79
PF10324 318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 96.37
PF10321 313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 96.07
PF03402 265 V1R: Vomeronasal organ pheromone receptor family, 96.0
PF10317 292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 94.64
PF00002 242 7tm_2: 7 transmembrane receptor (Secretin family); 87.94
PF10292 324 7TM_GPCR_Srab: Serpentine type 7TM GPCR receptor c 84.12
>KOG4219|consensus Back     alignment and domain information 
Probab=99.77  E-value=4.2e-19  Score=134.25  Aligned_cols=103  Identities=31%  Similarity=0.627  Sum_probs=96.3

Q ss_pred             cchHHHHHHHHHHHHHHHHHHHHHHHhHHHhhccCCCCchHHHHHHHHHHHHHHHHHhhhHHHHHHHhcCccccccccch
Q psy16860         36 IHIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCD  115 (139)
Q Consensus        36 ~~~~~~~~~~~~~~~i~~~g~~gN~lvi~v~~~~~~~~~~~~~~i~nLa~~Dl~~~l~~~p~~~~~~~~~~~~~g~~~C~  115 (139)
                      ...+.+.+...++.++.+++++||.+|+|++..+|++|+.+|+|++|||++|++.+++..|+.........|.+|...|+
T Consensus        30 lp~~~~~~wai~yg~l~~vAv~GN~iVlwIil~hrrMRtvtnyfL~NLAfADl~~s~Fn~~f~f~yal~~~W~~G~f~C~  109 (423)
T KOG4219|consen   30 LPAWQQALWAIAYGLLVFVAVVGNLIVLWIILAHRRMRTVTNYFLVNLAFADLSMSIFNTVFNFQYALHQEWYFGSFYCR  109 (423)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHhcCceEEEEEeehhehhhhHHHHHHHHHHHHHHHHHHhhHHHHHHHHHhccccccceee
Confidence            34555889999999999999999999999999999999999999999999999999999999988888899999999999


Q ss_pred             hchHHhHHhhHHHHHHHHHhhccC
Q psy16860        116 VWNSFDVYFSQYRKHFNMYEVDFE  139 (139)
Q Consensus       116 ~~~~~~~~~~~~Si~~~m~~~~~~  139 (139)
                      +..|+......+|+ ++|+|+++|
T Consensus       110 f~nf~~itav~vSV-fTlvAiA~D  132 (423)
T KOG4219|consen  110 FVNFFPITAVFVSV-FTLVAIAID  132 (423)
T ss_pred             eccccchhhhhHhH-HHHHHHHHH
Confidence            99999999999999 788888875

>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>PF03402 V1R: Vomeronasal organ pheromone receptor family, V1R; InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF00002 7tm_2: 7 transmembrane receptor (Secretin family); InterPro: IPR000832 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10292 7TM_GPCR_Srab: Serpentine type 7TM GPCR receptor class ab chemoreceptor; InterPro: IPR019408 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
3sn6_R 514 Crystal Structure Of The Beta2 Adrenergic Receptor- 2e-16
4gbr_A 309 N-terminal T4 Lysozyme Fusion Facilitates Crystalli 8e-16
3pds_A 458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 3e-15
3kj6_A 366 Crystal Structure Of A Methylated Beta2 Adrenergic 7e-15
2r4r_A 365 Crystal Structure Of The Human Beta2 Adrenoceptor L 7e-15
2r4s_A 342 Crystal Structure Of The Human Beta2 Adrenoceptor L 7e-15
2rh1_A 500 High Resolution Crystal Structure Of Human B2-Adren 7e-15
3p0g_A 501 Structure Of A Nanobody-Stabilized Active State Of 7e-15
3d4s_A 490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 8e-15
2y00_B 315 Turkey Beta1 Adrenergic Receptor With Stabilising M 1e-13
2vt4_A 313 Turkey Beta1 Adrenergic Receptor With Stabilising M 1e-13
3pbl_A 481 Structure Of The Human Dopamine D3 Receptor In Comp 1e-11
4daj_A 479 Structure Of The M3 Muscarinic Acetylcholine Recept 8e-10
3rze_A 452 Structure Of The Human Histamine H1 Receptor In Com 1e-08
4djh_A 480 Structure Of The Human Kappa Opioid Receptor In Com 6e-08
4ej4_A 461 Structure Of The Delta Opioid Receptor Bound To Nal 1e-07
3uon_A 467 Structure Of The Human M2 Muscarinic Acetylcholine 2e-07
4ea3_B 434 Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WI 2e-07
2ks9_A 364 Solution Conformation Of Substance P In Water Compl 7e-07
4dkl_A 464 Crystal Structure Of The Mu-Opioid Receptor Bound T 2e-06
3odu_A 502 The 2.5 A Structure Of The Cxcr4 Chemokine Receptor 3e-06
3oe0_A 499 Crystal Structure Of The Cxcr4 Chemokine Receptor I 3e-06
3oe6_A 508 Crystal Structure Of The Cxcr4 Chemokine Receptor I 3e-06
3eml_A 488 The 2.6 A Crystal Structure Of A Human A2a Adenosin 4e-06
3pwh_A 329 Thermostabilised Adenosine A2a Receptor Length = 32 5e-06
4eiy_A 447 Crystal Structure Of The Chimeric Protein Of A2aar- 5e-06
3vg9_A 326 Crystal Structure Of Human Adenosine A2a Receptor W 2e-05
2ydo_A 325 Thermostabilised Human A2a Receptor With Adenosine 2e-05
>pdb|3SN6|R Chain R, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 514 Back     alignment and structure 
Iteration: 1

 Score = 80.9 bits (198), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 52/78 (66%)
Query: 45  GMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLT 104
           G++M  I++  + GN+LVI ++ K  +L+ +TNYF+ SLA ADL++ L V+PF A   LT
Sbjct: 186 GIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILT 245
Query: 105 DEWYFGYFMCDVWNSFDV 122
             W FG F C+ W S DV
Sbjct: 246 KTWTFGNFWCEFWTSIDV 263
>pdb|4GBR|A Chain A, N-terminal T4 Lysozyme Fusion Facilitates Crystallization Of A G Protein Coupled Receptor Length = 309 Back     alignment and structure
>pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>pdb|3KJ6|A Chain A, Crystal Structure Of A Methylated Beta2 Adrenergic Receptor- Fab Complex Length = 366 Back     alignment and structure
>pdb|2R4R|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 365 Back     alignment and structure
>pdb|2R4S|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 342 Back     alignment and structure
>pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein- Coupled Receptor Length = 500 Back     alignment and structure
>pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>pdb|2Y00|B Chain B, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Partial Agonist Dobutamine (Crystal Dob92) Length = 315 Back     alignment and structure
>pdb|2VT4|A Chain A, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Cyanopindolol Length = 313 Back     alignment and structure
>pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>pdb|4DAJ|A Chain A, Structure Of The M3 Muscarinic Acetylcholine Receptor Length = 479 Back     alignment and structure
>pdb|3RZE|A Chain A, Structure Of The Human Histamine H1 Receptor In Complex With Doxepin Length = 452 Back     alignment and structure
>pdb|4DJH|A Chain A, Structure Of The Human Kappa Opioid Receptor In Complex With Jdtic Length = 480 Back     alignment and structure
>pdb|4EJ4|A Chain A, Structure Of The Delta Opioid Receptor Bound To Naltrindole Length = 461 Back     alignment and structure
>pdb|3UON|A Chain A, Structure Of The Human M2 Muscarinic Acetylcholine Receptor Bound To An Antagonist Length = 467 Back     alignment and structure
>pdb|4EA3|B Chain B, Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WITH A PEPTIDE Mimetic Length = 434 Back     alignment and structure
>pdb|2KS9|A Chain A, Solution Conformation Of Substance P In Water Complexed With Nk1r Length = 364 Back     alignment and structure
>pdb|4DKL|A Chain A, Crystal Structure Of The Mu-Opioid Receptor Bound To A Morphinan Antagonist Length = 464 Back     alignment and structure
>pdb|3ODU|A Chain A, The 2.5 A Structure Of The Cxcr4 Chemokine Receptor In Complex With Small Molecule Antagonist It1t Length = 502 Back     alignment and structure
>pdb|3OE0|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Cyclic Peptide Antagonist Cvx15 Length = 499 Back     alignment and structure
>pdb|3OE6|A Chain A, Crystal Structure Of The Cxcr4 Chemokine Receptor In Complex With A Small Molecule Antagonist It1t In I222 Spacegroup Length = 508 Back     alignment and structure
>pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 Back     alignment and structure
>pdb|3PWH|A Chain A, Thermostabilised Adenosine A2a Receptor Length = 329 Back     alignment and structure
>pdb|4EIY|A Chain A, Crystal Structure Of The Chimeric Protein Of A2aar-Bril In Complex With Zm241385 At 1.8a Resolution Length = 447 Back     alignment and structure
>pdb|3VG9|A Chain A, Crystal Structure Of Human Adenosine A2a Receptor With An Allosteric Inverse-Agonist Antibody At 2.7 A Resolution Length = 326 Back     alignment and structure
>pdb|2YDO|A Chain A, Thermostabilised Human A2a Receptor With Adenosine Bound Length = 325 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 2e-40
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 2e-37
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 3e-37
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 6e-37
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 4e-36
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 2e-33
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 3e-33
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 2e-32
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 2e-23
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 7e-23
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 2e-20
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 2e-20
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 3e-19
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 1e-16
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 3e-16
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
 Score =  139 bits (352), Expect = 2e-40
 Identities = 37/119 (31%), Positives = 61/119 (51%)

Query: 7   NSLNYTYNINYTSTNFSNTSLFPTNSTIHIHIFPFIIKGMLMCFIIITAILGNLLVIISV 66
           +++    N +      + +     + T        +  G++M  I++  + GN+LVI ++
Sbjct: 6   DAMGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAI 65

Query: 67  IKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSFDVYFS 125
            K  +L+ +TNYF+ SLA ADL++ L V+PF A   L   W FG F C+ W S DV   
Sbjct: 66  AKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCV 124
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.81
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 99.77
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 99.76
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.76
2lnl_A 296 C-X-C chemokine receptor type 1; G protein coupled 99.74
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 99.74
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.74
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 99.72
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.7
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 99.68
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 99.68
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.68
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.67
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.67
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 99.67
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.66
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.65
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.64
2lot_A64 Apelin receptor; membrane protein; NMR {Homo sapie 97.33
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.81  E-value=1e-19  Score=142.78  Aligned_cols=102  Identities=19%  Similarity=0.357  Sum_probs=85.5

Q ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHhHHHhhccCCCC---chHHHHHHHHHHHHHHHHHhhhHHHHHHHhc--Ccccccc
Q psy16860         37 HIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLR---IITNYFVVSLAFADLLVALCVMPFNAIVSLT--DEWYFGY  111 (139)
Q Consensus        37 ~~~~~~~~~~~~~~i~~~g~~gN~lvi~v~~~~~~~~---~~~~~~i~nLa~~Dl~~~l~~~p~~~~~~~~--~~~~~g~  111 (139)
                      ....+++..++|.+++++|++||+++++++.++|++|   +++|+|++|||++|++++++.+|+.+.....  +.|.+|+
T Consensus        28 ~~~~~v~~~~~~~~i~~~g~~gN~lvi~~i~~~~~~r~~~~~~n~~i~~La~aDll~~~~~~p~~~~~~~~~~~~w~~g~  107 (510)
T 4grv_A           28 DIYSKVLVTAIYLALFVVGTVGNSVTLFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAMPVELYNFIWVHHPWAFGD  107 (510)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCC----CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCCSSCSSHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhhhheeeecCCCCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCEEhhH
Confidence            3445778888999999999999999999999877554   7889999999999999999999998877654  5799999


Q ss_pred             ccchhchHHhHHhhHHHHHHHHHhhccC
Q psy16860        112 FMCDVWNSFDVYFSQYRKHFNMYEVDFE  139 (139)
Q Consensus       112 ~~C~~~~~~~~~~~~~Si~~~m~~~~~~  139 (139)
                      ..|++..++..++..+|+ +++.++++|
T Consensus       108 ~~C~~~~~~~~~~~~~S~-~~l~~is~d  134 (510)
T 4grv_A          108 AGCRGYYFLRDACTYATA-LNVASLSVA  134 (510)
T ss_dssp             HHHHHHHHHHHHHHHHHH-HHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH-HHHHHHHHH
Confidence            999999999999999999 556666654
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>2lot_A Apelin receptor; membrane protein; NMR {Homo sapiens} PDB: 2lou_A 2lov_A 2low_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 139
d1u19a_ 348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 7e-11
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 56.1 bits (134), Expect = 7e-11
 Identities = 24/122 (19%), Positives = 46/122 (37%)

Query: 13  YNINYTSTNFSNTSLFPTNSTIHIHIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKL 72
           + + +++      S F          + F +    M  +I+     N L +   ++H+KL
Sbjct: 9   FYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKL 68

Query: 73  RIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDVWNSFDVYFSQYRKHFN 132
           R   NY +++LA ADL +           SL   + FG   C++   F     +      
Sbjct: 69  RTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSL 128

Query: 133 MY 134
           + 
Sbjct: 129 VV 130

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
d1u19a_ 348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.71
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.71  E-value=6.4e-17  Score=118.22  Aligned_cols=96  Identities=23%  Similarity=0.323  Sum_probs=86.7

Q ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHhHHHhhccCCCCchHHHHHHHHHHHHHHHHHhhhHHHHHHHhcCccccccccchh
Q psy16860         37 HIFPFIIKGMLMCFIIITAILGNLLVIISVIKHRKLRIITNYFVVSLAFADLLVALCVMPFNAIVSLTDEWYFGYFMCDV  116 (139)
Q Consensus        37 ~~~~~~~~~~~~~~i~~~g~~gN~lvi~v~~~~~~~~~~~~~~i~nLa~~Dl~~~l~~~p~~~~~~~~~~~~~g~~~C~~  116 (139)
                      .++...+...++.+++++|++||+++++++.++|++|++.|+++.|||++|++.++...|..+.....+.|..+...|+.
T Consensus        33 ~~~~~~~~~~~~~ii~v~gi~gN~lvi~vi~~~k~lr~~~~~~l~nLaiaDll~~~~~~~~~~~~~~~~~~~~~~~~c~~  112 (348)
T d1u19a_          33 EPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNL  112 (348)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHTSCTTHHHHHHH
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHHeehhhhccCCCCCHhHHHHHHHHHHHHHHHHHHHHHhhhhhccCccccCchhhhh
Confidence            34446788888999999999999999999999999999999999999999999999999998888888889999999999


Q ss_pred             chHHhHHhhHHHHHHH
Q psy16860        117 WNSFDVYFSQYRKHFN  132 (139)
Q Consensus       117 ~~~~~~~~~~~Si~~~  132 (139)
                      ..+....+..+|++..
T Consensus       113 ~~~~~~~~~~~s~~~l  128 (348)
T d1u19a_         113 EGFFATLGGEIALWSL  128 (348)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             hhhccccceeeecchh
Confidence            9999999999888543