Psyllid ID: psy16863


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070-----
MGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPFNRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKIHWYRNDRKLEENKIYRTQHDGNFYFIDLSSVSLFDSGRWTCLAENAVGRSHCSCELSVLVPKAYKAPFFTKELEAILTEQGTVSLECKVMGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPFNSLMPPGPAPIFIKEVENVKAKIGTSAILECQVLVPPWPRSIYWYNKEGVVEASDKYHIMADGLGGYSIEINYLEAVDDGEWKCVATSSSGVKQFSAAYVHVLMPKNYRKPRFVESLKAVMTDDGLVSFECKVVGFPTPTLQWFKDNEELKPGDVYQLTGTSSLGSYCCVAKNVMGKAESSTQLTIEDIRNHLSEEDKLLLLTNNKAPKFIEGLKSCQATVNEEFKFTVQVSISPEPKVSWFRDDQQVVESDNVKILKETLGVCHLKIHALEVADQAEWKCIATNDFGQSITSCFLKLNVPKHYKKPKFLEELKAVLSEGGAVNLECKVIGVPQPTLKWFKDGRELKAGDIHKIISGEDGTCCLGIYTCEAHNCMGTTSSSAALLGFEDKSQIEKAEEGKKALIVKDPSLSTIQEEGTSEIYDTPMASIEEREISFSFDGKEVSVSLYETPDLTEEEAIKVVEMYADELSEHISDKNMIELPPLRFTKESSRSQNIQMEAVVIDVDHKGTTEDDDLRTDAGLDEISEDLMLHHQ
ccccccEEEEEEccEEEEcccEEEEEEccccccccEEEEEEEEEccEEEEEEEEEEEEEEEEEEcccccEEEEEEccEEcccccEEEEEEccEEEEEEccccccccEEEEEEEEcccEEEEEEEEEEEEEccccccEEEEEcccEEEEccccEEEEEEEEccccEEEEEEccccccEEEEEccccccccccEEEEEcccEEEEEEccccccccEEEEEEEEcccEEEEEEEEEEEEEccccccEEEEccccEEEEcccEEEEEEEEEccccEEEEEcccccEEEEEEEccEEEcccccEEEEEEccEEEEEEccccccccEEEEEEEEcccccEEEEEEEEEEEccccccEEEEEcccEEEEccccEEEEEEEEcccccEEEEEEccEEccccccEEEEEcccEEEEEEccccccccEEEEEEEEEccEEEEEEEEEEEEccccccccEEEcccEEEEEcccEEEEEEEEEcccccEEEEEEccEEcccccEEEEEEccccccccEEEEEEEEEccEEEEEEEEEEEEEEcccccccccccccccccccccEEEEEccEEEEEccccEEEEEEEEEcccccEEEEEEccEEEEccccEEEEEccccEEEEEEccccccccEEEEEEEEEccEEEEEEEEEEEEEcccccccccEEccccEEEEcccEEEEEEEEEEEcccEEEEEEccEEcccccEEEEccccccEEEEEEEEEccEEEEEEEEEEEEEccccccHHHHHHHHcccccccEEEccccEEEEEcccEEEEEEEEcccccEEEEEEccEEccccccEEEEEEEccEEEEEEccccccccEEEEEEEEcccEEEEEEEEEEEEcccccccccccccccEEEEcccEEEEEEEEEcccccEEEEEEccEEEccccEEEEEEccccEEEEEEEEEEEEEccEEEEEEEEEEEEEcccccHHcccccEEEEEEcccccEEEEcccEEEEEEEEccccccEEEEEEccEEEEEEEEEccccccccEEEEEEEEcccEEEEEEEEEEEEccccEEEEccccEEEEEEEEEEEcccccEEEcccEEcccccccEEccccEEEEc
ccccccEEEEEEccEEEccccEEEEEEEccccccccEEEEEEEEccccEEEEEEEEEEcccccccccccEEEEEEccEEcccccEEEEEcccEEEEEEEEccccccEEEEEEEEEccccccEEEEEEEEEccccccccccccccEEEEcccEEEEEEEEccccccEEEEccccccEEEEEEccEEcccccEEEEEEcccEEEEEEEEccccccEEEEEEEEEcccccccEEEEEEEccccccccccccccccEEccccEEEEEEEccccEEEEEEEEcccccEEEEEEccEEEcccccEEEEEEccEEEEEEEcccccccEEEEEEEEEcccccccEEEEEEEEccccccccccccccEEEEcccEEEEEEEEccccccEEEEEEccEEEccccEEEEEEcccEEEEEEEccccccccEEEEEEEEcccccEEEEEEEEEccccccccccccccccEEEcccEEEEEEEEEcccccEEEEEEccEEEccccEEEEEEEEccccccEEEEEEEEEccccccEEEEEEEEEccccccccccccccccccccccccccccccEEEEcccEEEEEEEEccccccEEEEEEEccEEEcccccEEEEEccccEEEEEEEcccccccEEEEEEEEEcccccccccEEEEEEccccccccccccccEEEEEcccEEEEEEEcccccccEEEEEEccEEcccccEEEEEEcccccEEEEEEEEcccccEEEEEEEEEccccccccccccEEEEcccccccccccccEEEEcccEEEEEEEEccccccEEEEEEccEEEcccccEEEEEccccEEEEEEEEccccccEEEEEEEEEcccccccEEEEEEEcccccccccccccccEEEEcccEEEEEEEEccccccEEEEEEccEEEcccccEEEEEEEccccccEEEEEEEEEcccccccEEEEEEEcccccccccccccccEEEccccccEEEEcccEEEEEEEEccccccEEEEEEccEEEEEcccccccEcccEEEEEEcccccccccccccEEEEccccEEEEEccccccccccEEEEEEEEcccccEEEEEEcccccEEEEEccccccc
mgiptpqliwykdnkkikagdifaltanpkdpsslgtytceavncmgaafstSRVIARGqqsfldnddvpfnraqgdhpifgnrfrainrdgrtelnirrvrrddggrysvtasnesgystaKFELsvesqvpdapaFIRRLHDIAVKVGTRARLLveirspteikcqfdlnntipfsfraqgdhpifgnrfrainrdgrtelnirrvrrddggrysvtasnesgystaKFELsvesqvpdapaFIRRLHDIAVKVGTRARLLveirspteikcqfdlnntipfsfraqgdhpifgnrfrainrdgrtelnirrvrrddggrysvtasnesgystaKFELsvesqvpdapaFIRRLHDIAVKVGTRARLLVEirspteikihWYRNDRKLEENKIYRTQHDGNFYFIDlssvslfdsgrwtclaenavgrshcscelsvlvpkaykapffTKELEAILTEQgtvsleckvmgiptpqliwykdnkkikagdifaltanpkdpsslgtytceavncmgaafstSRVIARGqqsfldnddvpfnslmppgpapifIKEVENVKAKigtsailecqvlvppwprsiywynkegvveasdkyhimadglggySIEINYleavddgewkcvatsssgvkqFSAAYVHVlmpknyrkprfVESLKavmtddglvsfeckvvgfptptlqwfkdneelkpgdvyqltgtsslgSYCCVAknvmgkaesstqLTIEDIRNHLSEEDKLLLLTNNKAPKFIEGLKSCQATVNEEFKFTVQvsispepkvswfrddqqvveSDNVKILKETLGVCHLKIHALEVADQAEWkciatndfgqsitscflklnvpkhykkpKFLEELKAVLSeggavnleckvigvpqptlkwfkdgrelkagdihkiisgedgtcclgiytceahncmgttsssaallgfedkSQIEKAEEGKKalivkdpslstiqeegtseiydtpmasieereisfsfdgkevsvslyetpdlteEEAIKVVEMYADELSEhisdknmielpplrftkessrsqnIQMEAVVIDvdhkgttedddlrtdaGLDEISEDLMLHHQ
mgiptpqliwykdnKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPfnraqgdhpifgnrfrainrdgrtelnirrvrrddggrysvtasnesgystakfELSVESQVPDAPAFIRRLHDIAVKVGTRARllveirspteikcqfDLNNTIPFsfraqgdhpifgnrfrainrdgrtelnirrvrrddggrysvtasnesgystakfELSVESQVPDAPAFIRRLHDIAVKVGTRARllveirspteikcqfDLNNTIPFsfraqgdhpifgnrfrainrdgrtelnirrvrrddggrysvtasnesgystakfELSVESQVPDAPAFIRRLHDIAVKvgtrarllveirspteikihwyrndrklEENKIYRTQHDGNFYFIDLSSVSLFDSGRWTCLAENAVGRSHCSCELSVLVPKAYKAPFFTKELEAILTEQGTVSLECKVMGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPFNSLMPPGPAPIFIKEVENVKAKIGTSAILECQVLVPPWPRSIYWYNKEGVVEASDKYHIMADGLGGYSIEINYLEAVDDGEWKCVATSSSGVKQFSAAYVHVLMPKNYRKPRFVESLKAVMTDDGLVSFECKVVGFPtptlqwfkdneelkPGDVYQLTGTSSLGSYCCVAKNVMGKAESSTQLTIEDIRNHLSEEDKLLLLTNNKAPKFIEGLKSCQATVNEEFKFTVQvsispepkvswfrddqQVVESDNVKILKETLGVCHLKIHALEVADQAEWKCIATNDFGQSITSCFLKLNVPKHYKKPKFLEELKAVLSEGGAVNLECKVIGVPQPTLKWFKDGRELKAGDIHKIISGEDGTCCLGIYTCEAHNCMGTTSSSAALLGFEDKSQIEKAEegkkalivkdpslstiqeegtseiydtpmASIEEREISFSFDGKEVSVSLyetpdlteeEAIKVVEMYADELSehisdknmielPPLRFTkessrsqnIQMEAVVidvdhkgttedddlrtdAGLDEISedlmlhhq
MGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPFNRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKIHWYRNDRKLEENKIYRTQHDGNFYFIDLSSVSLFDSGRWTCLAENAVGRSHCSCELSVLVPKAYKAPFFTKELEAILTEQGTVSLECKVMGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPFNSLMPPGPAPIFIKEVENVKAKIGTSAILECQVLVPPWPRSIYWYNKEGVVEASDKYHIMADGLGGYSIEINYLEAVDDGEWKCVATSSSGVKQFSAAYVHVLMPKNYRKPRFVESLKAVMTDDGLVSFECKVVGFPTPTLQWFKDNEELKPGDVYQLTGTSSLGSYCCVAKNVMGKAESSTQLTIEDIRNHLSEEDKLLLLTNNKAPKFIEGLKSCQATVNEEFKFTVQVSISPEPKVSWFRDDQQVVESDNVKILKETLGVCHLKIHALEVADQAEWKCIATNDFGQSITSCFLKLNVPKHYKKPKFLEELKAVLSEGGAVNLECKVIGVPQPTLKWFKDGRELKAGDIHKIISGEDGTCCLGIYTCEAHNCMGTTSSSAALLGFEDKSQIEKAEEGKKALIVKDPSLSTIQEEGTSEIYDTPMASIEEREISFSFDGKEVSVSLYETPDLTEEEAIKVVEMYADELSEHISDKNMIELPPLRFTKESSRSQNIQMEAVVIDVDHKGTTEDDDLRTDAGLDEISEDLMLHHQ
******QLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPFNRAQGDHPIFGNRFRAINRDGRTELNI*********************************VPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQGDHPIFGNRFRAINRDGRTELNIRR*******************************VPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQGDHPIFGNRFRAINRDGRTELNIRR*******************************VPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKIHWYRNDRKLEENKIYRTQHDGNFYFIDLSSVSLFDSGRWTCLAENAVGRSHCSCELSVLVPKAYKAPFFTKELEAILTEQGTVSLECKVMGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPFNSLMPPGPAPIFIKEVENVKAKIGTSAILECQVLVPPWPRSIYWYNKEGVVEASDKYHIMADGLGGYSIEINYLEAVDDGEWKCVATSSSGVKQFSAAYVHVLMPKNYRKPRFVESLKAVMTDDGLVSFECKVVGFPTPTLQWFKDNEELKPGDVYQLTGTSSLGSYCCVAKNVMGKAE**TQLTIEDIRNHLSEEDKLLLLTNNKAPKFIEGLKSCQATVNEEFKFTVQVSISPEPKVSWFRDDQQVVESDNVKILKETLGVCHLKIHALEVADQAEWKCIATNDFGQSITSCFLKLNVPKHYKKPKFLEELKAVLSEGGAVNLECKVIGVPQPTLKWFKDGRELKAGDIHKIISGEDGTCCLGIYTCEAHNCMGTTS***ALL**************************************************FSFDGKEVSVSLYETPDLTEEEAIKVVEMYADE********************************VVI*******************************
MGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPFNRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIR********VGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQG**********AINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQGD**********INRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHD*AVKVGTRARLLVEIRSPTEIKIHWYRNDRKLEENKIYRTQHDGNFYFIDLSSVSLFDSGRWTCLAENAVGRSHCSCELSVLVPKA**************TEQGTVSLECKVMGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSF************PPGPAPIFIKEVENVKAKIGTSAILECQVLVPPWPRSIYWYNKEGVVEASDKYHIMADGLGGYSIEINYLEAVDDGEWKCVATSSSGVKQFSAAYVHVLMPKNYR************TDDGLVSFECKVVGFPTPTLQWFKDNEELKPGDVY*LTGTSSLGSYCCVAKNVMGKAESSTQLTIEDIRNHLS**DK*LLLTNNKAPKFIEGLKSCQATVNEEFKFTVQVSISPEPKVSWFRDDQQVVESDNVKILKETLGVCHLKIHALEVADQAEWKCIATNDFGQSITSCFLKLNVPKHYKK**********LSEGGAVNLECKVIGVPQPTLKWFKDGRELKAGDIHKIISGEDGTCCLGIYTCEAHNCMGTTSSSAALLGFED*************************EEGTSEIYDTPMASIEEREISFSFDGKEVSVSLY****LTEEEAIKVVEMYADELSEHISDKNMIEL*******************VVIDVDHKGTT***********************
MGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPFNRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKIHWYRNDRKLEENKIYRTQHDGNFYFIDLSSVSLFDSGRWTCLAENAVGRSHCSCELSVLVPKAYKAPFFTKELEAILTEQGTVSLECKVMGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPFNSLMPPGPAPIFIKEVENVKAKIGTSAILECQVLVPPWPRSIYWYNKEGVVEASDKYHIMADGLGGYSIEINYLEAVDDGEWKCVATSSSGVKQFSAAYVHVLMPKNYRKPRFVESLKAVMTDDGLVSFECKVVGFPTPTLQWFKDNEELKPGDVYQLTGTSSLGSYCCVAKNVMGKAESSTQLTIEDIRNHLSEEDKLLLLTNNKAPKFIEGLKSCQATVNEEFKFTVQVSISPEPKVSWFRDDQQVVESDNVKILKETLGVCHLKIHALEVADQAEWKCIATNDFGQSITSCFLKLNVPKHYKKPKFLEELKAVLSEGGAVNLECKVIGVPQPTLKWFKDGRELKAGDIHKIISGEDGTCCLGIYTCEAHNCMGTTSSSAALLGFEDKSQIEKAEEGKKALIVKDPSLSTIQEEGTSEIYDTPMASIEEREISFSFDGKEVSVSLYETPDLTEEEAIKVVEMYADELSEHISDKNMIELPPLRFTKESSRSQNIQMEAVVIDVDHKGTTEDDDLRTDAGLDEISEDLMLHHQ
MGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPFNRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKIHWYRNDRKLEENKIYRTQHDGNFYFIDLSSVSLFDSGRWTCLAENAVGRSHCSCELSVLVPKAYKAPFFTKELEAILTEQGTVSLECKVMGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQS********FNSLMPPGPAPIFIKEVENVKAKIGTSAILECQVLVPPWPRSIYWYNKEGVVEASDKYHIMADGLGGYSIEINYLEAVDDGEWKCVATSSSGVKQFSAAYVHVLMPKNYRKPRFVESLKAVMTDDGLVSFECKVVGFPTPTLQWFKDNEELKPGDVYQLTGTSSLGSYCCVAKNVMGKAESSTQLTIEDIRNHLSEEDKLLLLTNNKAPKFIEGLKSCQATVNEEFKFTVQVSISPEPKVSWFRDDQQVVESDNVKILKETLGVCHLKIHALEVADQAEWKCIATNDFGQSITSCFLKLNVPKHYKKPKFLEELKAVLSEGGAVNLECKVIGVPQPTLKWFKDGRELKAGDIHKIISGEDGTCCLGIYTCEAHNCMGTTSSSAALLGFEDKSQIEKAEEGKKALIVKDPSLSTIQEEGTSEIYDTPMASIEEREISFSFDGKEVSVSLYETPDLTEEEAIKVVEMYADELSEHISDKNMIELPPLRFTKESSRSQNIQMEAVVIDVDHKGTTEDDDLRTDAGLDEISEDLM****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPFNRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKIHWYRNDRKLEENKIYRTQHDGNFYFIDLSSVSLFDSGRWTCLAENAVGRSHCSCELSVLVPKAYKAPFFTKELEAILTEQGTVSLECKVMGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPFNSLMPPGPAPIFIKEVENVKAKIGTSAILECQVLVPPWPRSIYWYNKEGVVEASDKYHIMADGLGGYSIEINYLEAVDDGEWKCVATSSSGVKQFSAAYVHVLMPKNYRKPRFVESLKAVMTDDGLVSFECKVVGFPTPTLQWFKDNEELKPGDVYQLTGTSSLGSYCCVAKNVMGKAESSTQLTIEDIRNHLSEEDKLLLLTNNKAPKFIEGLKSCQATVNEEFKFTVQVSISPEPKVSWFRDDQQVVESDNVKILKETLGVCHLKIHALEVADQAEWKCIATNDFGQSITSCFLKLNVPKHYKKPKFLEELKAVLSEGGAVNLECKVIGVPQPTLKWFKDGRELKAGDIHKIISGEDGTCCLGIYTCEAHNCMGTTSSSAALLGFEDKSQIEKAEEGKKALIVKDPSLSTIQEEGTSEIYDTPMASIEEREISFSFDGKEVSVSLYETPDLTEEEAIKVVEMYADELSEHISDKNMIELPPLRFTKESSRSQNIQMEAVVIDVDHKGTTEDDDLRTDAGLDEISEDLMLHHQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1075 2.2.26 [Sep-21-2011]
O01761 8081 Muscle M-line assembly pr no N/A 0.743 0.098 0.269 6e-67
A2ASS6 35213 Titin OS=Mus musculus GN= no N/A 0.714 0.021 0.249 3e-56
Q8WZ42 34350 Titin OS=Homo sapiens GN= no N/A 0.792 0.024 0.240 2e-54
Q96RW7 5635 Hemicentin-1 OS=Homo sapi no N/A 0.769 0.146 0.241 5e-50
Q8NDA2 5065 Hemicentin-2 OS=Homo sapi no N/A 0.705 0.149 0.235 1e-47
A2AJ76 5100 Hemicentin-2 OS=Mus muscu no N/A 0.774 0.163 0.233 4e-42
Q9I7U4 18141 Titin OS=Drosophila melan no N/A 0.482 0.028 0.234 3e-35
A2AAJ9 8891 Obscurin OS=Mus musculus no N/A 0.685 0.082 0.243 6e-34
Q96MS0 1386 Roundabout homolog 3 OS=H no N/A 0.399 0.309 0.257 6e-29
O89026 1612 Roundabout homolog 1 OS=M no N/A 0.435 0.290 0.247 5e-28
>sp|O01761|UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans GN=unc-89 PE=1 SV=3 Back     alignment and function desciption
 Score =  256 bits (655), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 250/928 (26%), Positives = 390/928 (42%), Gaps = 129/928 (13%)

Query: 91   DGRTELNIRRVRRDDGGRYSVTASNESGYSTAKFELSVESQ--VPDAPAFIRRLHDIAVK 148
            DG   L IR  ++ D G+Y VTA NE+G +T+  +++V  Q   P  P F+  L   A  
Sbjct: 5124 DGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQPSKPKFVIPLKTGAAL 5183

Query: 149  VGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRAQGDHPIFGNRFRAINRDGRTELNIRRV 208
             G +    V++R   +   Q+ LN  IP  F    D  I  +       DG   L IR V
Sbjct: 5184 PGDKKEFNVKVRGLPKPTLQWFLNG-IPIKF----DDRITLDDMA----DGNYCLTIRDV 5234

Query: 209  RRDDGGRYSVTASNESGYSTAKFELSVESQVPDA--------PAFIRRLHDIAVKVGTRA 260
            R +D G     A NE+G      E    +   D         P F   L D  + VG   
Sbjct: 5235 REEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDLRYPPRFNVPLWDRRIPVG--- 5291

Query: 261  RLLVEIRSPTEIKCQFDLNNTIPFSFRAQGDHPIFGNRFRAINR-DGRTELNIRRVRRDD 319
                    P  I+C  D N T    +   G            N  DG   + I      D
Sbjct: 5292 -------DPMFIECHVDANPTAEVEWFKDGKKIEHTAHTEIRNTVDGACRIKIIPFEESD 5344

Query: 320  GGRYSVTASNESGY--STAKFELSVESQVPD------APAFIRRLHDIAVKVGTRARLLV 371
             G Y   A NE G   + A +++ +   V +      AP     L D  V  G   RL  
Sbjct: 5345 IGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSC 5404

Query: 372  EIRSPTEIKIHWYRNDRKLEENKIYRTQH--DGNFYFIDLSSVSLFDSGRWTCLAENAVG 429
            ++ +     + WY++   L  +     Q+  DG      ++  +  D G + C+A NA G
Sbjct: 5405 KVDAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLA-INDSTEEDIGAYRCVATNAHG 5463

Query: 430  RSHCSCELSVLVPKAY-----KAPFFTKELEAILTEQG-TVSLECKVMGIPTPQLIWYKD 483
              + SC ++V VPK       + PFFTK L  +  ++G + +L+C V G P P++ WY++
Sbjct: 5464 TINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRN 5523

Query: 484  NKKIKAGDIFALTANPKDPSSL----------GTYTCEAVNCMGAAFSTSRVIARGQQSF 533
             + ++ G    +  +P    SL          G Y CEA N  G A   ++  A  Q + 
Sbjct: 5524 GQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKA--KTQATAHVQMAL 5581

Query: 534  LDNDDVPFNSLMPPGPAPIFIKEVENVKAKIGTSAILECQVLVPPWPRSIYWYNKEGVVE 593
               +       M  G  P FI E+ ++   +G    LEC+V   P P S+ W    G + 
Sbjct: 5582 GKTE----KPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGLPNP-SVKWSKDGGPLI 5636

Query: 594  ASDKYHIMADGLGG-YSIEINYLEAVDDGEWKCVATSSSG---VKQF-------SAAYVH 642
               ++    +   G Y + I      D+G ++CVAT+ +G    K F        +  V 
Sbjct: 5637 EDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVT 5696

Query: 643  VLMPKNYRKPRFVESLKAVMTDDGL-VSFECKVVGFPTPTLQWFKDNEELKPGDVYQLT- 700
               P     PRF   +  V T +G  +  ECKV   P P + W+KD   + P D  Q++ 
Sbjct: 5697 ASQP-----PRFTLKMGDVRTTEGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISL 5751

Query: 701  ---GTSSL----------GSYCCVAKNVMGKAESSTQLTIEDI-----RNHLSEEDKLLL 742
               G ++L          G Y  +A N  G A+     T++ +         ++ D   +
Sbjct: 5752 SPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRD---V 5808

Query: 743  LTNNKAPKFIEGLKSCQATVNEEFKFTVQVSISPEPKVSWFRDDQQVVESDNVKILKETL 802
               NKAPK +E L++ +    + F+   + S  P+P + WF+D ++V     +++++   
Sbjct: 5809 FDANKAPKLMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERVFPYGRLQLIESPD 5868

Query: 803  GVCHLKIHALEVADQAEWKCIATNDFGQSITSCFLKLNVPKHYKKPKFLE----ELKAV- 857
            GVC L + +    D   ++C+A N +G + TSC   +NV +  +KP+ ++    E KA  
Sbjct: 5869 GVCELVVDSATRQDAGGYRCVAENTYGSARTSC--DVNVIRGDRKPRDIDSSIREGKAPG 5926

Query: 858  ---------LSEGGAVNLECKVIGVPQPTLKWFKDGRELKAGDIHKIISGEDGTCCL--- 905
                        G +V  EC   G P P++KW KDG EL + +  K+ +  DGT  L   
Sbjct: 5927 FTTPLTIRRAKPGDSVTFECLPFGNPFPSIKWLKDGLELFSDEKIKMEAAADGTQRLILS 5986

Query: 906  -------GIYTCEAHNCMGTTSSSAALL 926
                   G + C A N  GT S+ A L+
Sbjct: 5987 DVTFLSEGYFRCVATNEHGTASTKAELV 6014




Structural component of the muscle M-line. Myofilament lattice assembly begins with positional cues laid down in the basement membrane and muscle cell membrane. UNC-89 responds to these signals, localizes, and then participates in assembling an M-line.
Caenorhabditis elegans (taxid: 6239)
>sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus GN=Ttn PE=1 SV=1 Back     alignment and function description
>sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens GN=TTN PE=1 SV=4 Back     alignment and function description
>sp|Q96RW7|HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens GN=HMCN1 PE=1 SV=2 Back     alignment and function description
>sp|Q8NDA2|HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens GN=HMCN2 PE=2 SV=2 Back     alignment and function description
>sp|A2AJ76|HMCN2_MOUSE Hemicentin-2 OS=Mus musculus GN=Hmcn2 PE=1 SV=1 Back     alignment and function description
>sp|Q9I7U4|TITIN_DROME Titin OS=Drosophila melanogaster GN=sls PE=1 SV=3 Back     alignment and function description
>sp|A2AAJ9|OBSCN_MOUSE Obscurin OS=Mus musculus GN=Obscn PE=2 SV=2 Back     alignment and function description
>sp|Q96MS0|ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens GN=ROBO3 PE=1 SV=2 Back     alignment and function description
>sp|O89026|ROBO1_MOUSE Roundabout homolog 1 OS=Mus musculus GN=Robo1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1075
350422387 10117 PREDICTED: hypothetical protein LOC10074 0.721 0.076 0.604 0.0
307204648 9315 Myosin light chain kinase, smooth muscle 0.718 0.082 0.594 0.0
242022544 6699 myosin light chain kinase, putative [Ped 0.707 0.113 0.612 0.0
307172721 7605 Myosin light chain kinase, smooth muscle 0.717 0.101 0.586 0.0
357622614 6042 Stretchin-Mlck, isoform A [Danaus plexip 0.717 0.127 0.591 0.0
195121632 4529 GI20420 [Drosophila mojavensis] gi|19391 0.723 0.171 0.566 0.0
195383866 4728 GJ20094 [Drosophila virilis] gi|19414544 0.724 0.164 0.564 0.0
270003693 11744 hypothetical protein TcasGA2_TC002962 [T 0.700 0.064 0.589 0.0
91078936 3424 PREDICTED: similar to Stretchin-Mlck CG1 0.700 0.219 0.589 0.0
195436340 5295 GK22102 [Drosophila willistoni] gi|19416 0.724 0.147 0.562 0.0
>gi|350422387|ref|XP_003493149.1| PREDICTED: hypothetical protein LOC100743398 [Bombus impatiens] Back     alignment and taxonomy information
 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/799 (60%), Positives = 624/799 (78%), Gaps = 23/799 (2%)

Query: 289  QGDHPIFGNRFRAINRDGRTELNIRRVRRDDGGRYSVTASN-ESGY---STAKFELSVE- 343
            +GD PI  +R+R   R    +L +++ ++DD G Y++ A+  + G+   S+ K  LS++ 
Sbjct: 1505 RGDVPIPSDRYRVQMRGNVVQLTLKQSQKDDTGHYALVATRVDQGFDKGSSKKIHLSIDE 1564

Query: 344  -SQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKIHWYRNDRKLEENKIYRTQHDG 402
             S+  D P F+RRL D+AVKVGTR R LVEIRS T  +I W+RN   +     +   H+G
Sbjct: 1565 ASEEGDPPVFLRRLTDLAVKVGTRTRFLVEIRSSTTPQITWHRNAEPVHAGSRFSFVHEG 1624

Query: 403  NFYFIDLSSVSLFDSGRWTCLAENAVGRSHCSCELSVLVPKAYKAPFFTKELEAILTEQG 462
            NFY +D++ V++ D G WTC+AEN  GRS C+  L+V+VPKAYK P F +EL A+LTE G
Sbjct: 1625 NFYCVDVAPVTVEDEGHWTCMAENRGGRSSCTSRLTVIVPKAYKRPEFVEELRALLTETG 1684

Query: 463  TVSLECKVMGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFST 522
            TVSLECKV+G+PTP L W+KD+K+IKAGD+FALTAN  DP+SLG YTCEAVNCMG A+S+
Sbjct: 1685 TVSLECKVVGVPTPVLRWFKDDKEIKAGDVFALTANLDDPTSLGIYTCEAVNCMGTAYSS 1744

Query: 523  SRVIARGQQSFLDNDDVPFNSLMPPGPAPIFIKEVENVKAKIGTSAILECQVLVPPWPRS 582
            S+V   G+ S  +    P +SL P GP P F K +++   +IG +  L CQV VPPWP++
Sbjct: 1745 SKVHVVGKGSR-EGSLKPADSLTPSGPLPTFTKILQDECCRIGDTLRLSCQVQVPPWPKA 1803

Query: 583  IYWYNKEGVVEASDKYHIMADGLGGYSIEINYLEAVDDGEWKCVATSSSGVKQFSAAYVH 642
            I WYNKEG +E S+KYH+M DGLGGY IE++ +EA+D+GEWKCVATS+  +KQF+  YV 
Sbjct: 1804 ITWYNKEGRIEPSEKYHVMEDGLGGYFIEVSPVEAMDEGEWKCVATSAEDMKQFTTCYVA 1863

Query: 643  VLMPKNYRKPRFVESLKAVMTDDGLVSFECKVVGFPTPTLQWFKDNEELKPGDVYQLTGT 702
            + +PKNYRKPRF+ESLKAV+T++GLVSFECKVVGFPTP L+WFKD +ELKPGDVYQLTGT
Sbjct: 1864 MSIPKNYRKPRFMESLKAVLTEEGLVSFECKVVGFPTPLLRWFKDGQELKPGDVYQLTGT 1923

Query: 703  SSLGSYCCVAKNVMGKAESSTQLTIEDIRNHLSEEDKLLLLTNNKAPKFIEGLKSCQATV 762
            +SLGSYCC+A+N MG+A+S+ +LTIEDI+N L+EE++L LL+ N+ P FI+GL+SC+A +
Sbjct: 1924 NSLGSYCCIARNCMGEAKSTAELTIEDIQNQLNEEERLQLLSTNQPPIFIKGLRSCEARI 1983

Query: 763  NEEFKFTVQVSISPEPKVSWFRDDQQVVESDNVKILKETLGVCHLKIHALEVADQAEWKC 822
            NE+F+FTVQVSISPEP ++W+RDDQ V E++  ++ KE LG CHL +  LE  DQAEWKC
Sbjct: 1984 NEDFRFTVQVSISPEPSLAWYRDDQPVEENEKYQVAKENLGTCHLDVQKLEFLDQAEWKC 2043

Query: 823  IATNDFGQSITSCFLKLNVPKHYKKPKFLEELKAVLSEGGAVNLECKVIGVPQPTLKWFK 882
            +A+ND GQS+TSCFLKL +PKHYKKPKFLE L+A+LSE GAVNLECKVIGVPQP LKW+K
Sbjct: 2044 VASNDHGQSVTSCFLKLIIPKHYKKPKFLESLRAILSEEGAVNLECKVIGVPQPILKWYK 2103

Query: 883  DGRELKAGDIHKIISGEDGTCCLGIYTCEAHNCMGTTSSSAALLGFEDKSQIEKAEEGKK 942
            DG ELK GDIH+IISG+DGTCCLG YTCEA NCMGT SSSA+LLGFEDK  ++K  E K+
Sbjct: 2104 DGVELKPGDIHRIISGQDGTCCLGTYTCEATNCMGTVSSSASLLGFEDKLPVQK--EAKE 2161

Query: 943  AL------IVKDPSLSTIQEEGTSEIYDTPM----ASIEER-EISFSFDGKEVSVSLYET 991
             L      + ++ SLSTI EE TS++YDTP      ++++R E+SFSFDGKEVSVSLYET
Sbjct: 2162 PLSPNGHELARNLSLSTIHEERTSQLYDTPQTDHSVTLDDRGEVSFSFDGKEVSVSLYET 2221

Query: 992  PDLTEEEAIKVVEMYADELSEHISDKNMIELPPLRFTKESSRSQNIQMEAVVIDV--DHK 1049
            PDLTEEEA+++VEMYAD+LSEH+++ N+IELPP+RF KESS S N+ MEAVVIDV  D+ 
Sbjct: 2222 PDLTEEEALQIVEMYADQLSEHVTEHNVIELPPMRFVKESSNSGNLLMEAVVIDVSPDYF 2281

Query: 1050 GTTED-DDLRTDAGLDEIS 1067
             + ED DDLRT+A  +++S
Sbjct: 2282 VSAEDGDDLRTEADFEDVS 2300




Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307204648|gb|EFN83270.1| Myosin light chain kinase, smooth muscle [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242022544|ref|XP_002431700.1| myosin light chain kinase, putative [Pediculus humanus corporis] gi|212517008|gb|EEB18962.1| myosin light chain kinase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307172721|gb|EFN64027.1| Myosin light chain kinase, smooth muscle [Camponotus floridanus] Back     alignment and taxonomy information
>gi|357622614|gb|EHJ74040.1| Stretchin-Mlck, isoform A [Danaus plexippus] Back     alignment and taxonomy information
>gi|195121632|ref|XP_002005324.1| GI20420 [Drosophila mojavensis] gi|193910392|gb|EDW09259.1| GI20420 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195383866|ref|XP_002050646.1| GJ20094 [Drosophila virilis] gi|194145443|gb|EDW61839.1| GJ20094 [Drosophila virilis] Back     alignment and taxonomy information
>gi|270003693|gb|EFA00141.1| hypothetical protein TcasGA2_TC002962 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91078936|ref|XP_973933.1| PREDICTED: similar to Stretchin-Mlck CG18255-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195436340|ref|XP_002066126.1| GK22102 [Drosophila willistoni] gi|194162211|gb|EDW77112.1| GK22102 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1075
FB|FBgn0265045 9270 Strn-Mlck "Stretchin-Mlck" [Dr 0.731 0.084 0.555 2.3e-236
UNIPROTKB|Q8WZ4234 TTN "Titin" [Homo sapiens (tax 0.712 22.52 0.240 1.4e-46
MGI|MGI:9886435 Ttn "titin" [Mus musculus (tax 0.712 21.88 0.237 6.1e-49
UNIPROTKB|F1PV4535 F1PV45 "Uncharacterized protei 0.624 19.17 0.243 1.5e-56
WB|WBGene00006820 8081 unc-89 [Caenorhabditis elegans 0.672 0.089 0.247 2.8e-52
ZFIN|ZDB-GENE-030113-232 ttna "titin a" [Danio rerio (t 0.767 25.78 0.229 7.3e-42
UNIPROTKB|F1N75734 F1N757 "Uncharacterized protei 0.691 21.85 0.232 1.1e-41
UNIPROTKB|F1PXF9 5637 HMCN1 "Uncharacterized protein 0.624 0.119 0.247 9.5e-42
WB|WBGene0000643618 ttn-1 [Caenorhabditis elegans 0.328 19.61 0.291 2.4e-41
UNIPROTKB|F1S0Y1 4061 F1S0Y1 "Uncharacterized protei 0.625 0.165 0.270 2.8e-47
FB|FBgn0265045 Strn-Mlck "Stretchin-Mlck" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 2308 (817.5 bits), Expect = 2.3e-236, Sum P(2) = 2.3e-236
 Identities = 444/799 (55%), Positives = 587/799 (73%)

Query:   287 RAQGDHPIFGN-RFRAINRDGRTELNIRRVRRDDGGRYSVTA-SNESGYSTAKFELSVE- 343
             R++G+ PI  + RFR        +L +  V+R+D G Y++ A +          EL VE 
Sbjct:    31 RSRGEIPIENSDRFRITATSNAVQLAVEHVQREDAGHYTLFARTKRQDVVRRHVELIVED 90

Query:   344 -SQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKIHWYRNDRKLEENKIYRTQHDG 402
              S   D P F+RRL D++VKVGTR RLL EIRS T++K+ WYRNDR++  N      ++G
Sbjct:    91 RSTGDDPPVFVRRLPDLSVKVGTRTRLLTEIRSSTDLKLTWYRNDRRVCANDRITEVNEG 150

Query:   403 NFYFIDLSSVSLFDSGRWTCLAENAVGRSHCSCELSVLVPKAYKAPFFTKELEAILTEQG 462
              F+++++S V+L D G+W  +AEN  GR+ C   L+VLVPKAYK P F +EL A+LTEQG
Sbjct:   151 TFHYLEISPVTLDDGGQWMLMAENFGGRNSCLGTLNVLVPKAYKTPEFVEELRAVLTEQG 210

Query:   463 TVSLECKVMGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLGTYTCEAVNCMGAAFST 522
             TVSLECKV+G+PTP L W+KD+K+IKAGDIFALTAN  DP+SLGTYTCEA NCMG  +S+
Sbjct:   211 TVSLECKVVGVPTPHLRWFKDSKEIKAGDIFALTANADDPTSLGTYTCEARNCMGVTYSS 270

Query:   523 SRVIARGQQSFLDNDDVPFNSLMPPGPAPIFIKEVENVKAKIGTSAILECQVLVPPWPRS 582
             S+V   G+ S  +    P +S+    P PIF  E+ ++   IG + IL CQV+VPPWP+S
Sbjct:   271 SKVHVVGRGS-REGSLKPADSVASNAPPPIFTNELRDMSLLIGETIILGCQVVVPPWPKS 329

Query:   583 IYWYNKEGVVEASDKYHIMADGLGGYSIEINYLEAVDDGEWKCVATSSSGVKQFSAAYVH 642
             + WYN  G VE +++Y ++ DGLG Y IE+   E+ D GEWKCV TS  G    S   V 
Sbjct:   330 VCWYNASGRVETAERYKLIEDGLGVYMIEVKPSESCDAGEWKCVVTSFDGSMGISTCSVA 389

Query:   643 VLMPKNYRKPRFVESLKAVMTDDGLVSFECKVVGFPTPTLQWFKDNEELKPGDVYQLTGT 702
             + +P+NYRKPRF+ESL+AV+T++GLVSFECKVVGFPTP L+WFKD  ELKPGDVYQLTGT
Sbjct:   390 MDIPRNYRKPRFMESLRAVLTEEGLVSFECKVVGFPTPVLKWFKDGHELKPGDVYQLTGT 449

Query:   703 SSLGSYCCVAKNVMGKAESSTQLTIEDIRNHLSEEDKLLL--LTNNKAPKFIEGLKSCQA 760
             +SLG+YCC+A+N MG+  S+  LT+EDI+N L++E++L+      N+APKF+ GLKS  A
Sbjct:   450 NSLGTYCCIARNCMGETSSTAVLTVEDIQNQLTDEERLVFNQQNQNQAPKFLIGLKSTDA 509

Query:   761 TVNEEFKFTVQVSISPEPKVSWFRDDQQVVESDNVKILKETLGVCHLKIHALEVADQAEW 820
              +NE F+F V V  +P P +SWFRD+  +  ++     +       L I ++E  DQAEW
Sbjct:   510 KINEPFQFKVVVKATPNPILSWFRDELPIDPNERYNHYRGENEDWLLDIKSVEFVDQAEW 569

Query:   821 KCIATNDFGQSITSCFLKLNVPKHYKKPKFLEELKAVLSEGGAVNLECKVIGVPQPTLKW 880
             KC+A NDFG SITSCFLKL +P+HYKKP+FLE L+AVL+E GAVNLECKVIGVPQP LKW
Sbjct:   570 KCVAVNDFGTSITSCFLKLQIPRHYKKPRFLECLRAVLTEEGAVNLECKVIGVPQPALKW 629

Query:   881 FKDGRELKAGDIHKIISGEDGTCCLGIYTCEAHNCMGTTSSSAALLGFED--KSQIEKAE 938
             +KDG ELK GDIH+IISG+DGTCCLG YTCEA NCMG  +SSA+LLGFED  +SQ +K+E
Sbjct:   630 YKDGVELKPGDIHRIISGQDGTCCLGTYTCEAKNCMGIVASSASLLGFEDAQRSQQQKSE 689

Query:   939 EGKKALIVKDPSLSTIQEEGTSEIYDTPMASI---EEREISFSFDGKEVSVSLYETPDLT 995
             +  +  + ++ SLSTIQEE TS++Y+TP+  I   E+ ++SFSFDGKEVSVSLYETPDLT
Sbjct:   690 QLHENELQRNYSLSTIQEERTSQLYETPVGDITIDEKGDVSFSFDGKEVSVSLYETPDLT 749

Query:   996 EEEAIKVVEMYADELSEHISDKNMIELPPLRFTKESSRSQNIQMEAVVIDVDHKGTTEDD 1055
             EEEA+K+VEMYAD++SEH+++ N++ELPPLRF KE+S+S  + MEAVVID+  +  T +D
Sbjct:   750 EEEALKIVEMYADQISEHVTEHNIVELPPLRFVKETSQSGKLLMEAVVIDISPEYFTVED 809

Query:  1056 DLRTDAGLDEIS-EDLMLH 1073
             D+RT+A +D+IS  ++ +H
Sbjct:   810 DMRTEADMDDISINEITVH 828


GO:0006468 "protein phosphorylation" evidence=IEA;ISS;NAS
GO:0004687 "myosin light chain kinase activity" evidence=ISS;IDA
GO:0004683 "calmodulin-dependent protein kinase activity" evidence=IDA
GO:0005200 "structural constituent of cytoskeleton" evidence=ISS
GO:0004674 "protein serine/threonine kinase activity" evidence=NAS
GO:0005524 "ATP binding" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
UNIPROTKB|Q8WZ42 TTN "Titin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:98864 Ttn "titin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PV45 F1PV45 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00006820 unc-89 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030113-2 ttna "titin a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N757 F1N757 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXF9 HMCN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00006436 ttn-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1S0Y1 F1S0Y1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1075
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 2e-16
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 2e-16
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 7e-16
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 8e-16
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 4e-12
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 4e-12
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 1e-11
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 3e-09
smart0041085 smart00410, IG_like, Immunoglobulin like 1e-08
smart0040985 smart00409, IG, Immunoglobulin 1e-08
cd0572371 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)- 1e-08
cd07693100 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like 1e-08
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 2e-08
pfam1389580 pfam13895, Ig_2, Immunoglobulin domain 2e-08
cd0572486 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like 3e-08
smart0041085 smart00410, IG_like, Immunoglobulin like 4e-08
smart0040985 smart00409, IG, Immunoglobulin 4e-08
smart0041085 smart00410, IG_like, Immunoglobulin like 6e-08
smart0040985 smart00409, IG, Immunoglobulin 6e-08
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 6e-08
cd0009674 cd00096, Ig, Immunoglobulin domain 8e-08
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 1e-07
cd0009674 cd00096, Ig, Immunoglobulin domain 1e-07
smart0041085 smart00410, IG_like, Immunoglobulin like 2e-07
smart0040985 smart00409, IG, Immunoglobulin 2e-07
cd0572569 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like 2e-07
cd07693100 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like 3e-07
smart0041085 smart00410, IG_like, Immunoglobulin like 6e-07
smart0041085 smart00410, IG_like, Immunoglobulin like 6e-07
smart0040985 smart00409, IG, Immunoglobulin 6e-07
smart0040985 smart00409, IG, Immunoglobulin 6e-07
cd0572569 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like 6e-07
cd0009674 cd00096, Ig, Immunoglobulin domain 7e-07
cd0496973 cd04969, Ig5_Contactin_like, Fifth Ig domain of co 7e-07
smart0041085 smart00410, IG_like, Immunoglobulin like 1e-06
smart0040985 smart00409, IG, Immunoglobulin 1e-06
cd0574669 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (I 1e-06
cd0496973 cd04969, Ig5_Contactin_like, Fifth Ig domain of co 2e-06
pfam1389580 pfam13895, Ig_2, Immunoglobulin domain 3e-06
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 3e-06
cd0009674 cd00096, Ig, Immunoglobulin domain 3e-06
cd0576077 cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like 5e-06
cd0573969 cd05739, Ig3_RPTP_IIa_LAR_like, Third immunoglobul 6e-06
cd0572885 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of 7e-06
cd0572985 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) 7e-06
cd0573676 cd05736, Ig2_Follistatin_like, Second immunoglobul 7e-06
cd0574475 cd05744, Ig_Myotilin_C_like, Immunoglobulin (Ig)-l 9e-06
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 1e-05
cd0572371 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)- 1e-05
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 1e-05
cd0009674 cd00096, Ig, Immunoglobulin domain 1e-05
smart0041085 smart00410, IG_like, Immunoglobulin like 2e-05
smart0040985 smart00409, IG, Immunoglobulin 2e-05
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 2e-05
cd0572371 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)- 3e-05
smart0041085 smart00410, IG_like, Immunoglobulin like 4e-05
smart0040985 smart00409, IG, Immunoglobulin 4e-05
pfam1389580 pfam13895, Ig_2, Immunoglobulin domain 4e-05
cd0572985 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) 4e-05
cd0574574 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig 9e-05
cd0572486 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like 1e-04
cd0585682 cd05856, Ig2_FGFRL1-like, Second immunoglobulin (I 1e-04
cd0573969 cd05739, Ig3_RPTP_IIa_LAR_like, Third immunoglobul 2e-04
cd0587671 cd05876, Ig3_L1-CAM, Third immunoglobulin (Ig)-lik 2e-04
cd0573874 cd05738, Ig2_RPTP_IIa_LAR_like, Second immunoglobu 3e-04
cd0572885 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of 4e-04
cd0572985 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) 4e-04
cd0573171 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig 4e-04
cd0572486 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like 5e-04
cd0576474 cd05764, Ig_2, Subgroup of the immunoglobulin (Ig) 5e-04
cd0574874 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d 5e-04
cd0574874 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d 5e-04
cd0574874 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d 5e-04
cd0496973 cd04969, Ig5_Contactin_like, Fifth Ig domain of co 6e-04
cd0574378 cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)- 6e-04
cd0573095 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig 6e-04
cd0496791 cd04967, Ig1_Contactin, First Ig domain of contact 7e-04
cd0572486 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like 8e-04
cd0573377 cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig 8e-04
cd0496791 cd04967, Ig1_Contactin, First Ig domain of contact 0.001
cd0589375 cd05893, Ig_Palladin_C, C-terminal immunoglobulin 0.001
cd0585785 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like 0.001
cd0589275 cd05892, Ig_Myotilin_C, C-terminal immunoglobulin 0.001
cd0584993 cd05849, Ig1_Contactin-1, First Ig domain of conta 0.001
cd07693100 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like 0.002
cd0009674 cd00096, Ig, Immunoglobulin domain 0.002
cd0009674 cd00096, Ig, Immunoglobulin domain 0.002
cd0009674 cd00096, Ig, Immunoglobulin domain 0.003
cd0572569 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like 0.003
cd0585785 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like 0.003
cd0584894 cd05848, Ig1_Contactin-5, First Ig domain of conta 0.003
pfam1389580 pfam13895, Ig_2, Immunoglobulin domain 0.004
cd0009674 cd00096, Ig, Immunoglobulin domain 0.004
cd0576077 cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like 0.004
cd0573676 cd05736, Ig2_Follistatin_like, Second immunoglobul 0.004
cd0585890 cd05858, Ig3_FGFR-2, Third immunoglobulin (Ig)-lik 0.004
pfam1392774 pfam13927, Ig_3, Immunoglobulin domain 0.004
cd0496888 cd04968, Ig3_Contactin_like, Third Ig domain of co 0.004
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
 Score = 75.4 bits (186), Expect = 2e-16
 Identities = 24/90 (26%), Positives = 49/90 (54%)

Query: 350 PAFIRRLHDIAVKVGTRARLLVEIRSPTEIKIHWYRNDRKLEENKIYRTQHDGNFYFIDL 409
           P F ++  D+ V+ G  AR    +    +  + W+++ + L  +  ++  ++G  Y + +
Sbjct: 1   PKFTQKPKDVEVQEGESARFTCTVTGDPDPTVSWFKDGQPLRSSDRFKVTYEGGTYTLTI 60

Query: 410 SSVSLFDSGRWTCLAENAVGRSHCSCELSV 439
           S+V   D G++TC+A N+ G +  S EL+V
Sbjct: 61  SNVQPDDEGKYTCVATNSAGEAEASAELTV 90


Length = 90

>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|212460 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>gnl|CDD|143317 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143317 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143170 cd04969, Ig5_Contactin_like, Fifth Ig domain of contactin Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|143223 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>gnl|CDD|143170 cd04969, Ig5_Contactin_like, Fifth Ig domain of contactin Back     alignment and domain information
>gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143237 cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>gnl|CDD|143216 cd05739, Ig3_RPTP_IIa_LAR_like, Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>gnl|CDD|143205 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>gnl|CDD|143213 cd05736, Ig2_Follistatin_like, Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>gnl|CDD|143221 cd05744, Ig_Myotilin_C_like, Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|212460 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|212460 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>gnl|CDD|143222 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143264 cd05856, Ig2_FGFRL1-like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>gnl|CDD|143216 cd05739, Ig3_RPTP_IIa_LAR_like, Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>gnl|CDD|143284 cd05876, Ig3_L1-CAM, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>gnl|CDD|143215 cd05738, Ig2_RPTP_IIa_LAR_like, Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>gnl|CDD|143205 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>gnl|CDD|143208 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143241 cd05764, Ig_2, Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>gnl|CDD|143170 cd04969, Ig5_Contactin_like, Fifth Ig domain of contactin Back     alignment and domain information
>gnl|CDD|143220 cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>gnl|CDD|143207 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>gnl|CDD|143168 cd04967, Ig1_Contactin, First Ig domain of contactin Back     alignment and domain information
>gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143210 cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>gnl|CDD|143168 cd04967, Ig1_Contactin, First Ig domain of contactin Back     alignment and domain information
>gnl|CDD|143301 cd05893, Ig_Palladin_C, C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>gnl|CDD|143265 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>gnl|CDD|143300 cd05892, Ig_Myotilin_C, C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>gnl|CDD|143257 cd05849, Ig1_Contactin-1, First Ig domain of contactin-1 Back     alignment and domain information
>gnl|CDD|143317 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143265 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>gnl|CDD|143256 cd05848, Ig1_Contactin-5, First Ig domain of contactin-5 Back     alignment and domain information
>gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143237 cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>gnl|CDD|143213 cd05736, Ig2_Follistatin_like, Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>gnl|CDD|143266 cd05858, Ig3_FGFR-2, Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>gnl|CDD|222457 pfam13927, Ig_3, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143169 cd04968, Ig3_Contactin_like, Third Ig domain of contactin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1075
KOG3513|consensus 1051 100.0
KOG3513|consensus1051 100.0
KOG4221|consensus 1381 100.0
KOG4221|consensus 1381 100.0
KOG4222|consensus 1281 100.0
KOG4222|consensus 1281 100.0
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 100.0
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 99.97
KOG4194|consensus873 99.96
KOG4194|consensus873 99.96
PHA02785326 IL-beta-binding protein; Provisional 99.95
PHA02785326 IL-beta-binding protein; Provisional 99.93
KOG3515|consensus741 99.93
KOG3515|consensus741 99.92
PHA02826227 IL-1 receptor-like protein; Provisional 99.79
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.71
PHA02826227 IL-1 receptor-like protein; Provisional 99.7
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.67
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.65
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.63
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.61
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.6
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.6
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.59
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.59
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.59
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.57
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.57
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.57
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.54
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.54
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.54
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.54
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.54
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.54
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.53
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.53
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.53
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.52
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.52
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.52
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.52
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.51
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.51
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.51
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.51
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.5
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.5
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.5
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.5
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.5
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.49
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.49
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.49
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.48
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.48
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.47
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.47
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.47
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.47
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.47
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.46
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.45
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.45
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.45
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.45
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.45
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.45
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.45
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.45
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.44
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.44
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.44
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.44
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.43
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.43
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.42
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.42
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.42
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.42
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.42
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.42
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.41
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.41
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 99.41
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 99.41
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.41
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.4
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.4
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 99.4
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.4
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.39
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.39
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.39
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.38
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.38
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.38
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.38
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.38
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.37
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.37
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.37
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.37
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.37
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.37
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.37
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.36
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.36
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.36
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.36
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.36
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 99.36
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 99.35
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.34
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 99.34
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.34
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.34
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.33
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 99.33
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 99.33
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.32
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.32
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.31
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.31
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.31
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.3
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.3
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.29
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.29
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 99.29
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 99.29
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 99.27
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.26
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 99.25
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 99.25
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 99.25
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.25
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.25
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 99.24
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 99.24
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.24
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.24
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 99.23
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.23
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 99.23
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 99.23
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 99.22
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.21
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 99.21
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.21
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.21
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.21
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 99.2
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.2
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.2
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 99.2
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.2
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 99.2
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.19
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 99.19
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 99.18
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 99.18
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 99.18
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 99.16
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 99.14
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 99.13
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.13
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 99.13
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 99.11
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 99.09
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 99.09
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 99.09
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 99.08
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 99.08
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 99.08
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 99.07
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 99.07
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 99.07
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 99.06
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 99.05
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 99.04
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 99.04
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 99.01
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 99.01
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 99.01
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 99.0
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 98.99
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 98.94
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 98.93
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 98.93
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 98.91
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 98.9
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 98.89
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 98.89
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 98.89
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 98.87
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 98.87
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 98.86
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 98.85
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 98.85
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 98.84
smart0041086 IG_like Immunoglobulin like. IG domains that canno 98.83
smart0040986 IG Immunoglobulin. 98.83
smart0040863 IGc2 Immunoglobulin C-2 Type. 98.83
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 98.83
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 98.8
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 98.8
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 98.78
smart0040986 IG Immunoglobulin. 98.76
smart0041086 IG_like Immunoglobulin like. IG domains that canno 98.76
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 98.75
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 98.74
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 98.73
PF0004764 ig: Immunoglobulin domain The Prosite family only 98.71
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 98.7
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 98.7
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 98.7
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 98.69
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 98.69
smart0040863 IGc2 Immunoglobulin C-2 Type. 98.68
PF0004764 ig: Immunoglobulin domain The Prosite family only 98.67
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 98.66
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 98.63
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 98.6
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 98.6
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 98.59
PHA03376221 BARF1; Provisional 98.59
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 98.57
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 98.57
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 98.56
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 98.49
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 98.41
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 98.4
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 98.39
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 98.38
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 98.38
PHA03376221 BARF1; Provisional 98.34
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 98.34
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 98.33
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 98.32
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 98.3
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 98.3
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 98.27
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 98.25
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 98.25
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 98.22
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 98.2
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 98.2
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 98.19
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 98.19
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 98.18
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 98.17
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 98.17
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 98.14
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 98.14
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 98.13
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 98.12
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 98.11
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 98.11
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 98.1
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 98.09
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 98.08
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 98.07
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 98.07
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 98.05
KOG0613|consensus 1205 98.04
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 98.03
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 98.02
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 98.01
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 98.01
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 98.0
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 98.0
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 98.0
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 97.99
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 97.99
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 97.98
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 97.96
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 97.96
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 97.96
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 97.94
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 97.94
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 97.93
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 97.92
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 97.91
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 97.91
KOG0613|consensus 1205 97.88
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 97.88
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 97.87
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 97.85
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 97.84
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 97.84
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 97.83
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 97.82
PHA02987189 Ig domain OX-2-like protein; Provisional 97.81
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 97.8
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 97.78
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 97.76
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 97.74
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 97.73
PHA03270466 envelope glycoprotein C; Provisional 97.71
PHA02987189 Ig domain OX-2-like protein; Provisional 97.71
PRK14081667 triple tyrosine motif-containing protein; Provisio 97.7
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 97.69
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 97.67
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 97.66
PHA03270466 envelope glycoprotein C; Provisional 97.65
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 97.63
PHA03269566 envelope glycoprotein C; Provisional 97.62
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 97.59
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 97.59
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 97.56
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 97.56
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 97.56
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 97.55
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 97.53
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 97.53
PHA03273486 envelope glycoprotein C; Provisional 97.52
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 97.51
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 97.5
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 97.49
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 97.43
cd0577093 IgC_beta2m Class I major histocompatibility comple 97.42
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 97.41
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 97.41
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 97.39
PHA03271490 envelope glycoprotein C; Provisional 97.39
PHA03273486 envelope glycoprotein C; Provisional 97.36
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 97.35
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 97.35
smart0040775 IGc1 Immunoglobulin C-Type. 97.34
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 97.32
PHA03271490 envelope glycoprotein C; Provisional 97.3
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 97.29
smart0040775 IGc1 Immunoglobulin C-Type. 97.27
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 97.27
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 97.24
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 97.24
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 97.22
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 97.22
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 97.21
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 97.21
PHA03269566 envelope glycoprotein C; Provisional 97.18
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 97.14
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 97.14
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 97.13
smart0040681 IGv Immunoglobulin V-Type. 97.11
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 97.11
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 97.1
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 97.09
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 97.09
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 97.05
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 97.01
KOG1480|consensus909 96.93
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 96.9
smart0040681 IGv Immunoglobulin V-Type. 96.87
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 96.85
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 96.85
cd0577093 IgC_beta2m Class I major histocompatibility comple 96.84
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 96.8
PHA02914500 Immunoglobulin-like domain protein; Provisional 96.8
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 96.77
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 96.76
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 96.73
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 96.7
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 96.63
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 96.61
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 96.61
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 96.6
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 96.58
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 96.52
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 96.34
PHA02982251 hypothetical protein; Provisional 96.22
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 96.22
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 96.15
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 96.1
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 96.1
PHA02914500 Immunoglobulin-like domain protein; Provisional 96.09
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 96.01
PRK14081667 triple tyrosine motif-containing protein; Provisio 96.0
PHA0263363 hypothetical protein; Provisional 95.88
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 95.86
KOG1480|consensus 909 95.65
PHA02982251 hypothetical protein; Provisional 95.64
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 95.63
PHA0263363 hypothetical protein; Provisional 95.51
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 95.18
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 95.15
KOG4597|consensus560 95.08
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 95.05
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 94.93
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 94.56
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 93.92
PHA03042286 CD47-like protein; Provisional 93.34
KOG4597|consensus560 92.81
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 92.77
PHA03286492 envelope glycoprotein E; Provisional 92.73
PHA03042286 CD47-like protein; Provisional 92.63
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 92.53
PF02124211 Marek_A: Marek's disease glycoprotein A; InterPro: 92.3
PHA03283542 envelope glycoprotein E; Provisional 91.27
PF0683289 BiPBP_C: Penicillin-Binding Protein C-terminus Fam 90.44
KOG1026|consensus 774 90.33
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 89.07
PHA03283542 envelope glycoprotein E; Provisional 89.05
PF0683289 BiPBP_C: Penicillin-Binding Protein C-terminus Fam 88.62
PHA02865338 MHC-like TNF binding protein; Provisional 88.56
PHA03282540 envelope glycoprotein E; Provisional 88.15
PHA03286492 envelope glycoprotein E; Provisional 88.08
PF0080169 PKD: PKD domain; InterPro: IPR000601 The PKD (Poly 87.72
PF02010440 REJ: REJ domain; InterPro: IPR002859 The REJ (Rece 87.19
PF0579080 C2-set: Immunoglobulin C2-set domain; InterPro: IP 87.07
PF02010440 REJ: REJ domain; InterPro: IPR002859 The REJ (Rece 86.85
PF02124211 Marek_A: Marek's disease glycoprotein A; InterPro: 86.43
smart0008979 PKD Repeats in polycystic kidney disease 1 (PKD1) 85.89
PF0579080 C2-set: Immunoglobulin C2-set domain; InterPro: IP 84.25
PHA03281642 envelope glycoprotein E; Provisional 83.64
PF0080169 PKD: PKD domain; InterPro: IPR000601 The PKD (Poly 82.75
PF02480439 Herpes_gE: Alphaherpesvirus glycoprotein E; InterP 82.64
KOG1026|consensus774 82.47
PHA03282540 envelope glycoprotein E; Provisional 82.35
PF0632889 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: 82.05
PF0632889 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: 81.86
smart0008979 PKD Repeats in polycystic kidney disease 1 (PKD1) 81.69
>KOG3513|consensus Back     alignment and domain information
Probab=100.00  E-value=2.4e-57  Score=517.28  Aligned_cols=530  Identities=24%  Similarity=0.418  Sum_probs=397.4

Q ss_pred             CeeeeecCceeec-cCC--eEEEEEEEecCCCcEEEEEECCEecCCCC--cEEEEEcCCEEEEEEcccC-CCCceeEEEE
Q psy16863        350 PAFIRRLHDIAVK-VGT--RARLLVEIRSPTEIKIHWYRNDRKLEENK--IYRTQHDGNFYFIDLSSVS-LFDSGRWTCL  423 (1075)
Q Consensus       350 p~~~~~~~~~~v~-~G~--~v~l~C~~~g~p~~~v~W~k~g~~l~~~~--~~~~~~~g~~~~L~I~~v~-~~d~G~Y~C~  423 (1075)
                      |.|...+.+..+. .-+  .+.|.|++.|+|.|+++|+|||..+....  ++.+. .|+   |.|.+.. ..|.|.|.|.
T Consensus        40 P~f~~q~~~~~~~~~~~~~~v~l~C~A~G~P~Psy~W~kng~~~d~~~~~~~~~~-~G~---lvI~~p~~~~d~G~YqC~  115 (1051)
T KOG3513|consen   40 PVFVEQPNDVIVPFPSDDSSVTLNCEANGNPEPSYRWTKNGTEFDPTEYPRVSVL-GGT---LVITNPDAALDQGIYQCF  115 (1051)
T ss_pred             ceeeecCCceEEecccCCccEEEEEEecCCCCceeEEEECCeecccccccceeee-cCc---eEecCCcchhhcceeEEE
Confidence            6666555443332 222  49999999999999999999999876543  33333 343   5666666 8899999999


Q ss_pred             EEeCCCceeeEEEEEeecCCCCCCCeeeeecceE-EecCCeEEEEEEEE-CCCCCeEEEEeCCEec-c--------CCCE
Q psy16863        424 AENAVGRSHCSCELSVLVPKAYKAPFFTKELEAI-LTEQGTVSLECKVM-GIPTPQLIWYKDNKKI-K--------AGDI  492 (1075)
Q Consensus       424 a~n~~g~~~~s~~l~V~~~~~~~~p~~~~~~~~~-~~~g~~v~l~C~~~-g~p~~~v~W~~~g~~l-~--------~~~~  492 (1075)
                      |+|..|... +-.+.++.  .+.+++-......+ +.+|+.+.|.|... +.|.++|.|..+..+- .        .+..
T Consensus       116 AsN~~Gta~-S~~~~l~~--~~i~~F~~e~~~~v~v~eG~~~~L~C~pP~~~P~l~~~W~~~~~~~~~~~~~~r~~~~~~  192 (1051)
T KOG3513|consen  116 ASNKLGTAV-SREARLQF--GFIPKFKKEERSPVEVEEGDGVVLPCNPPAHFPPLRYYWMLNEFPHFVQIDNRRVFSQEN  192 (1051)
T ss_pred             eecccceee-ccceeecc--cccccCccccCCcEEEEeCCceEEeCCCCCCCCCccEEehhccCCcccccCcceeEeccc
Confidence            999999874 22333332  12222222333333 78999999999964 6788899999876542 1        1222


Q ss_pred             EEEEeCCCCCCCcEEEEEEEEecceeeE---EEEEEEEeccccccCCCCCCcCCCCCCCCCCeeeeeccceEeecCCeEE
Q psy16863        493 FALTANPKDPSSLGTYTCEAVNCMGAAF---STSRVIARGQQSFLDNDDVPFNSLMPPGPAPIFIKEVENVKAKIGTSAI  569 (1075)
Q Consensus       493 ~~l~i~~~~~~d~G~Y~C~a~n~~g~~~---~~~~v~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~G~~~~  569 (1075)
                      ..|-+..+..+|.+.|.|.|.+..-...   ..+.|.+...            ......+|......+.+.....|+.+.
T Consensus       193 G~Lyfs~V~~~D~~~Y~C~a~~~~~~~~v~~~~~~L~~~~~------------~~~~~~~P~i~~~~p~~~~a~~G~~v~  260 (1051)
T KOG3513|consen  193 GNLYFSNVETSDFGNYICSATFPSTQTIVQGPPFPLIVRSN------------NVMREYAPKILVPFPETETALKGQSVK  260 (1051)
T ss_pred             ceEEEeecchhhcCceEEEEEchhhcccccCCceeEEEccc------------ccccccCCccccCCCCcccccCCCeEE
Confidence            3677888999999999999998432221   1233333211            111222233333344467788899999


Q ss_pred             EEEEEecCCCCceEEEEeCCeEEecCCcEEEEEcCCceEEEEEeeeeecCCceEEEEEECCCCceeeeeEEEEEeCCCCc
Q psy16863        570 LECQVLVPPWPRSIYWYNKEGVVEASDKYHIMADGLGGYSIEINYLEAVDDGEWKCVATSSSGVKQFSAAYVHVLMPKNY  649 (1075)
Q Consensus       570 L~C~~~~~p~p~~v~W~~~~~~i~~~~~~~~~~~~~~~~~L~i~~~~~~d~G~Y~C~a~n~~g~~~~~~~~l~v~~p~~~  649 (1075)
                      |+|.+-|.|.| .|.|+|.++... ..+.+....   ...|.|.+++.+|+|.|+|.|+|..|... ....+.|..+   
T Consensus       261 LECfA~G~P~P-~i~W~k~~g~~~-~~r~~~~~~---~~vL~I~nv~~~D~G~Y~C~AeN~~G~~~-~~~~v~v~a~---  331 (1051)
T KOG3513|consen  261 LECFALGNPTP-QIKWRKVDGKPP-PRRATYSNY---GKVLKIPNVQYEDAGEYECIAENSRGSAT-HSGHVTVYAP---  331 (1051)
T ss_pred             EEEEecCCCCC-cEEEEeCCCCCC-Ccceeeecc---ccEEEecccCcCCCeEEEEEEecccccce-eeEEEEEecC---
Confidence            99999999999 899999998532 233333322   24899999999999999999999999654 4457777776   


Q ss_pred             CCCceeecccee-eecCCeEEEEEEEecCCCCeEEEEECCEEcCCCCe---EEEe---------ecCCCceEEEEEEecC
Q psy16863        650 RKPRFVESLKAV-MTDDGLVSFECKVVGFPTPTLQWFKDNEELKPGDV---YQLT---------GTSSLGSYCCVAKNVM  716 (1075)
Q Consensus       650 ~~p~~~~~~~~~-~~~g~~~~l~C~v~g~p~p~v~W~k~g~~l~~~~~---~~~~---------~~~d~G~Y~C~a~N~~  716 (1075)
                        |.++..+.+. +..|+.+.|.|.+.|.|.|+|+|+|||.++.+..+   +.+.         ..+|+|.|+|.|+|.+
T Consensus       332 --P~w~~~~~d~~~~~gs~v~~eC~a~g~P~p~v~WlkNg~pl~~~~r~~~~~i~~g~L~is~v~~~dsg~YQC~A~Nk~  409 (1051)
T KOG3513|consen  332 --PYWLQKPQDTEADTGSNVTLECKASGKPNPTVKWLKNGEPLEPAERDPRYKIDDGTLIISNVQESDSGVYQCIAENKY  409 (1051)
T ss_pred             --chhhcccceeEecCCCCeEEEEEecCCCCCceEEeeCCeecCccCCCcceEEeCCEEEEEecccccCeEEEeeeeccc
Confidence              5555555554 55788999999999999999999999999987655   4432         3479999999999999


Q ss_pred             ceEEEEEEEEEEeccccCchhhhhhhccCCCCCeEEeccce--eeeecCCeEEEEEEEecCCCCeEEEEECCEEeecCCc
Q psy16863        717 GKAESSTQLTIEDIRNHLSEEDKLLLLTNNKAPKFIEGLKS--CQATVNEEFKFTVQVSISPEPKVSWFRDDQQVVESDN  794 (1075)
Q Consensus       717 g~~~~~~~l~V~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~--~~~~~g~~~~l~C~v~g~p~p~v~W~k~g~~i~~~~~  794 (1075)
                      |...+++.|.|.+                 .+|.|...+..  ..+..|.++.|.|...+.|.|.++|.|+++.+..+.+
T Consensus       410 G~i~anA~L~V~a-----------------~~P~f~~~p~~~~~~a~~g~~v~i~C~~~asP~p~~~W~k~~~~~~~~~r  472 (1051)
T KOG3513|consen  410 GTIYANAELKVLA-----------------SAPVFPLNPVERKVMAVVGGTVTIDCKPFASPKPKVSWLKGGEKLLQSGR  472 (1051)
T ss_pred             ceEeeeeEEEEEc-----------------cCCCCCCCccceEEEEEeCCeEEEeeccCCCCcceEEEEcCCcccccCce
Confidence            9999999999997                 46777766544  4688999999999999999999999999998888899


Q ss_pred             EEEEEeeCcEEEEEEccccCCCCeEEEEEEEeCCceEEEEEEEEEEecCCCCCCeeeeecc-eeecCCCeEEEEEEEEcc
Q psy16863        795 VKILKETLGVCHLKIHALEVADQAEWKCIATNDFGQSITSCFLKLNVPKHYKKPKFLEELK-AVLSEGGAVNLECKVIGV  873 (1075)
Q Consensus       795 ~~~~~~~~~~~~L~I~~~~~~D~G~Y~C~A~N~~G~~~~s~~l~V~~~~~~~~p~~~~~~~-~~~~~g~~~~L~C~v~g~  873 (1075)
                      +.+..++    +|.|.+++.+|+|.|+|.|+|.+|.+...+.|.|..+.++     ...+. ..+..|++++|.|++...
T Consensus       473 ~~i~edG----tL~I~n~t~~DaG~YtC~A~N~~G~a~~~~~L~Vkd~tri-----~~~P~~~~v~~g~~v~l~Ce~shD  543 (1051)
T KOG3513|consen  473 IRILEDG----TLEISNVTRSDAGKYTCVAENKLGKAESTGNLIVKDATRI-----TLAPSNTDVKVGESVTLTCEASHD  543 (1051)
T ss_pred             EEECCCC----cEEecccCcccCcEEEEEEEcccCccceEEEEEEecCceE-----EeccchhhhccCceEEEEeecccC
Confidence            9886543    6999999999999999999999999999999999876543     33333 348899999999999877


Q ss_pred             CCC--eeEEEECCEEcCCC---Ce---------eEEEECCCCceeeEEEEEEEEeCCeeEEEEEEEEEecCChhhh
Q psy16863        874 PQP--TLKWFKDGRELKAG---DI---------HKIISGEDGTCCLGIYTCEAHNCMGTTSSSAALLGFEDKSQIE  935 (1075)
Q Consensus       874 p~p--~v~W~k~g~~l~~~---~~---------~~i~~~~~~~~d~G~Y~C~a~N~~G~~~~~~~l~v~~~~~~~~  935 (1075)
                      |..  .|.|.+||..+...   +.         .+|.+......|+|.|+|.|.-.+.++++.+.|+|..+|.+..
T Consensus       544 ~~ld~~f~W~~nG~~id~~~~~~~~~~~~~~~~g~L~i~nv~l~~~G~Y~C~aqT~~Ds~s~~A~l~V~gpPgpP~  619 (1051)
T KOG3513|consen  544 PSLDITFTWKKNGRPIDFNPDGDHFEINDGSDSGRLTIANVSLEDSGKYTCVAQTALDSASARADLLVRGPPGPPP  619 (1051)
T ss_pred             CCcceEEEEEECCEEhhccCCCCceEEeCCcCccceEEEeeccccCceEEEEEEEeecchhcccceEEecCCCCCC
Confidence            764  58999999987531   11         2344445556789999999999999999999999988876644



>KOG3513|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>PHA03270 envelope glycoprotein C; Provisional Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>PRK14081 triple tyrosine motif-containing protein; Provisional Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>PHA03270 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>PHA03269 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>PHA03273 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>PHA03271 envelope glycoprotein C; Provisional Back     alignment and domain information
>PHA03273 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PHA03271 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>PHA03269 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PHA02914 Immunoglobulin-like domain protein; Provisional Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>PHA02914 Immunoglobulin-like domain protein; Provisional Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PRK14081 triple tyrosine motif-containing protein; Provisional Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>PHA03286 envelope glycoprotein E; Provisional Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>PF02124 Marek_A: Marek's disease glycoprotein A; InterPro: IPR001038 Equid herpesvirus 1 (Equine herpesvirus 1, EHV-1) glycoprotein 13 (EHV-1 gp13) has the characteristic features of a membrane-spanning protein: an N-terminal signal sequence; a hydrophobic membrane anchor region; a charged C-terminal cytoplasmic tail; and an exterior domain with nine potential N-glycosylation sites [] Back     alignment and domain information
>PHA03283 envelope glycoprotein E; Provisional Back     alignment and domain information
>PF06832 BiPBP_C: Penicillin-Binding Protein C-terminus Family; InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs) Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>PHA03283 envelope glycoprotein E; Provisional Back     alignment and domain information
>PF06832 BiPBP_C: Penicillin-Binding Protein C-terminus Family; InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs) Back     alignment and domain information
>PHA02865 MHC-like TNF binding protein; Provisional Back     alignment and domain information
>PHA03282 envelope glycoprotein E; Provisional Back     alignment and domain information
>PHA03286 envelope glycoprotein E; Provisional Back     alignment and domain information
>PF00801 PKD: PKD domain; InterPro: IPR000601 The PKD (Polycystic Kidney Disease) domain was first identified in the Polycystic Kidney Disease protein, polycystin-1 (PDK1 gene), and contains an Ig-like fold consisting of a beta-sandwich of seven strands in two sheets with a Greek key topology, although some members have additional strands [] Back     alignment and domain information
>PF02010 REJ: REJ domain; InterPro: IPR002859 The REJ (Receptor for Egg Jelly) domain is found in PKD1 P98161 from SWISSPROT and the sperm receptor for egg jelly Q26627 from SWISSPROT Back     alignment and domain information
>PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PF02010 REJ: REJ domain; InterPro: IPR002859 The REJ (Receptor for Egg Jelly) domain is found in PKD1 P98161 from SWISSPROT and the sperm receptor for egg jelly Q26627 from SWISSPROT Back     alignment and domain information
>PF02124 Marek_A: Marek's disease glycoprotein A; InterPro: IPR001038 Equid herpesvirus 1 (Equine herpesvirus 1, EHV-1) glycoprotein 13 (EHV-1 gp13) has the characteristic features of a membrane-spanning protein: an N-terminal signal sequence; a hydrophobic membrane anchor region; a charged C-terminal cytoplasmic tail; and an exterior domain with nine potential N-glycosylation sites [] Back     alignment and domain information
>smart00089 PKD Repeats in polycystic kidney disease 1 (PKD1) and other proteins Back     alignment and domain information
>PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PHA03281 envelope glycoprotein E; Provisional Back     alignment and domain information
>PF00801 PKD: PKD domain; InterPro: IPR000601 The PKD (Polycystic Kidney Disease) domain was first identified in the Polycystic Kidney Disease protein, polycystin-1 (PDK1 gene), and contains an Ig-like fold consisting of a beta-sandwich of seven strands in two sheets with a Greek key topology, although some members have additional strands [] Back     alignment and domain information
>PF02480 Herpes_gE: Alphaherpesvirus glycoprotein E; InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>PHA03282 envelope glycoprotein E; Provisional Back     alignment and domain information
>PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] Back     alignment and domain information
>PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] Back     alignment and domain information
>smart00089 PKD Repeats in polycystic kidney disease 1 (PKD1) and other proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1075
3b43_A570 I-band Fragment I65-i70 From Titin Length = 570 5e-37
3b43_A 570 I-band Fragment I65-i70 From Titin Length = 570 4e-05
2rik_A284 I-Band Fragment I67-I69 From Titin Length = 284 4e-24
2rik_A284 I-Band Fragment I67-I69 From Titin Length = 284 2e-07
2rjm_A284 3ig Structure Of Titin Domains I67-I69 E-To-A Mutat 7e-24
2rjm_A284 3ig Structure Of Titin Domains I67-I69 E-To-A Mutat 1e-07
3laf_A403 Structure Of Dcc, A Netrin-1 Receptor Length = 403 5e-20
3laf_A403 Structure Of Dcc, A Netrin-1 Receptor Length = 403 2e-12
3dmk_A816 Crystal Structure Of Down Syndrome Cell Adhesion Mo 1e-18
1ya5_A201 Crystal Structure Of The Titin Domains Z1z2 In Comp 1e-17
2yd9_A304 Crystal Structure Of The N-Terminal Ig1-3 Module Of 2e-15
2yd9_A304 Crystal Structure Of The N-Terminal Ig1-3 Module Of 3e-13
2yd9_A304 Crystal Structure Of The N-Terminal Ig1-3 Module Of 6e-06
2a38_A194 Crystal Structure Of The N-Terminus Of Titin Length 4e-15
3kld_A384 Ptprg Cntn4 Complex Length = 384 4e-12
3kld_A384 Ptprg Cntn4 Complex Length = 384 7e-11
3jxa_A383 Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = 4e-12
3jxa_A383 Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = 7e-11
2wim_A291 Crystal Structure Of Ncam2 Ig1-3 Length = 291 1e-10
2wim_A291 Crystal Structure Of Ncam2 Ig1-3 Length = 291 5e-05
3v2a_R772 Vegfr-2VEGF-A Complex Structure Length = 772 2e-10
2om5_A381 N-Terminal Fragment Of Human Tax1 Length = 381 4e-10
2om5_A381 N-Terminal Fragment Of Human Tax1 Length = 381 3e-09
2iep_A192 Crystal Structure Of Immunoglobulin-Like Domains 1 8e-10
1cs6_A382 N-terminal Fragment Of Axonin-1 From Chicken Length 1e-09
1cs6_A382 N-terminal Fragment Of Axonin-1 From Chicken Length 5e-07
2xy1_A192 Crystal Structure Of Ncam2 Ig3-4 Length = 192 2e-09
3lcy_A197 Titin Ig Tandem Domains A164-A165 Length = 197 7e-09
3lcy_A197 Titin Ig Tandem Domains A164-A165 Length = 197 3e-08
3lcy_A197 Titin Ig Tandem Domains A164-A165 Length = 197 8e-06
3pxh_A201 Tandem Ig Domains Of Tyrosine Phosphatase Lar Lengt 8e-09
2vra_A208 Drosophila Robo Ig1-2 (Monoclinic Form) Length = 20 3e-08
2vra_A208 Drosophila Robo Ig1-2 (Monoclinic Form) Length = 20 5e-08
2vr9_A217 Drosophila Robo Ig1-2 (Tetragonal Form) Length = 21 3e-08
2vr9_A217 Drosophila Robo Ig1-2 (Tetragonal Form) Length = 21 5e-08
2yd1_A212 Crystal Structure Of The N-Terminal Ig1-2 Module Of 3e-08
2yd1_A212 Crystal Structure Of The N-Terminal Ig1-2 Module Of 8e-08
2yd1_A212 Crystal Structure Of The N-Terminal Ig1-2 Module Of 9e-07
2yd5_A214 Crystal Structure Of The N-Terminal Ig1-2 Module Of 3e-08
3pxj_A210 Tandem Ig Repeats Of Dlar Length = 210 3e-08
3pxj_A210 Tandem Ig Repeats Of Dlar Length = 210 2e-07
3pxj_A210 Tandem Ig Repeats Of Dlar Length = 210 1e-06
1evt_C225 Crystal Structure Of Fgf1 In Complex With The Extra 4e-08
1evt_C225 Crystal Structure Of Fgf1 In Complex With The Extra 8e-05
3ojv_C226 Crystal Structure Of Fgf1 Complexed With The Ectodo 5e-08
3ojv_C226 Crystal Structure Of Fgf1 Complexed With The Ectodo 5e-05
1cvs_C225 Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex L 5e-08
1cvs_C225 Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex L 5e-05
2yd6_A212 Crystal Structure Of The N-Terminal Ig1-2 Module Of 2e-07
2yd6_A212 Crystal Structure Of The N-Terminal Ig1-2 Module Of 2e-06
1fhg_A154 High Resolution Refinement Of Telokin Length = 154 3e-07
3v6b_R424 Vegfr-2VEGF-E Complex Structure Length = 424 3e-07
3v6b_R424 Vegfr-2VEGF-E Complex Structure Length = 424 1e-04
2nzi_A305 Crystal Structure Of Domains A168-A170 From Titin L 3e-07
2nzi_A305 Crystal Structure Of Domains A168-A170 From Titin L 5e-04
1tlk_A154 X-Ray Structure Determination Of Telokin, The C-Ter 3e-07
2yd2_A214 Crystal Structure Of The N-Terminal Ig1-2 Module Of 4e-07
2yd2_A214 Crystal Structure Of The N-Terminal Ig1-2 Module Of 3e-06
2yd3_A202 Crystal Structure Of The N-Terminal Ig1-2 Module Of 5e-07
2yd3_A202 Crystal Structure Of The N-Terminal Ig1-2 Module Of 3e-06
2v9q_A212 First And Second Ig Domains From Human Robo1 Length 5e-07
2j8h_A197 Structure Of The Immunoglobulin Tandem Repeat A168- 5e-07
2j8h_A197 Structure Of The Immunoglobulin Tandem Repeat A168- 8e-04
2ill_A195 Anomalous Substructure Of Titin-A168169 Length = 19 6e-07
2ill_A195 Anomalous Substructure Of Titin-A168169 Length = 19 7e-04
2v5s_A394 Structural Basis For Dscam Isoform Specificity Leng 6e-07
2v5m_A388 Structural Basis For Dscam Isoform Specificity Leng 7e-07
2lqr_A108 Nmr Structure Of Ig3 Domain Of Palladin Length = 10 2e-06
3p3y_A404 Crystal Structure Of Neurofascin Homophilic Adhesio 3e-06
3p3y_A404 Crystal Structure Of Neurofascin Homophilic Adhesio 2e-05
2v5t_A189 Crystal Structure Of Ncam2 Ig2-3 Length = 189 3e-06
2v5t_A189 Crystal Structure Of Ncam2 Ig2-3 Length = 189 3e-05
2v5r_A391 Structural Basis For Dscam Isoform Specificity Leng 6e-06
2dm3_A110 Solution Structure Of The Second Ig Domain Of Human 6e-06
2yd4_A210 Crystal Structure Of The N-Terminal Ig1-2 Module Of 8e-06
2yd4_A210 Crystal Structure Of The N-Terminal Ig1-2 Module Of 9e-06
2yd4_A210 Crystal Structure Of The N-Terminal Ig1-2 Module Of 4e-05
2jll_A389 Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 1e-05
2jll_A389 Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 6e-04
3puc_A99 Atomic Resolution Structure Of Titin Domain M7 Leng 1e-05
3puc_A99 Atomic Resolution Structure Of Titin Domain M7 Leng 1e-04
2xyc_A291 Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 1e-05
2xyc_A291 Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 6e-04
2dm2_A110 Solution Structure Of The First Ig Domain Of Human 2e-05
1bih_A395 Crystal Structure Of The Insect Immune Protein Hemo 2e-05
1bih_A395 Crystal Structure Of The Insect Immune Protein Hemo 6e-04
1qz1_A291 Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam 2e-05
2edl_A110 Solution Structure Of The Ig-Like Domain (3801-3897 4e-05
1ry7_B334 Crystal Structure Of The 3 Ig Form Of Fgfr3c In Com 4e-05
1iil_E220 Crystal Structure Of Pro253arg Apert Mutant Fgf Rec 5e-05
1iil_E220 Crystal Structure Of Pro253arg Apert Mutant Fgf Rec 9e-04
2fdb_P220 Crystal Structure Of Fibroblast Growth Factor (Fgf) 5e-05
2c5d_C195 Structure Of A Minimal Gas6-Axl Complex Length = 19 5e-05
1ev2_E220 Crystal Structure Of Fgf2 In Complex With The Extra 7e-05
2kdg_A100 Solution Structure Of The 1st Ig Domain Of Myotilin 8e-05
1e0o_B219 Crystal Structure Of A Ternary Fgf1-Fgfr2-Heparin C 8e-05
1ii4_E220 Crystal Structure Of Ser252trp Apert Mutant Fgf Rec 1e-04
3grw_A241 Fgfr3 In Complex With A Fab Length = 241 2e-04
1djs_A216 Ligand-binding Portion Of Fibroblast Growth Factor 3e-04
3ojm_B231 Crystal Structure Of Fgf1 Complexed With The Ectodo 3e-04
3s97_C201 Ptprz Cntn1 Complex Length = 201 4e-04
2y25_A317 Crystal Structure Of The Myomesin Domains My11-My13 4e-04
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 6e-04
3kvq_A108 Crystal Structure Of Vegfr2 Extracellular Domain D7 6e-04
3oj2_C231 Crystal Structure Of Fgf1 Complexed With The Ectodo 6e-04
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 7e-04
1rhf_A182 Crystal Structure Of Human Tyro3-D1d2 Length = 182 8e-04
>pdb|3B43|A Chain A, I-band Fragment I65-i70 From Titin Length = 570 Back     alignment and structure

Iteration: 1

Score = 153 bits (386), Expect = 5e-37, Method: Compositional matrix adjust. Identities = 158/619 (25%), Positives = 257/619 (41%), Gaps = 89/619 (14%) Query: 348 DAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKIHWYRNDRKLEENKIYRTQHDGNFYFI 407 + P FI L + +G L ++ EI+I WY+ KL Y+ Q N + Sbjct: 4 EPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIRIAWYKEHTKLRSAPAYKMQFKNNVASL 63 Query: 408 DLSSVSLFDSGRWTCLAENAVGRSHCSCELSVLVPKAYK-APFFTKELEAILTEQG-TVS 465 ++ V D G +TC AEN+VG S +VLV K K P F ++L+ + G V+ Sbjct: 64 VINKVDHSDVGEYTCKAENSVGAVASS---AVLVIKERKLPPSFARKLKDVHETLGFPVA 120 Query: 466 LECKVMGIPTPQLIWYKDNKKIK---------AGDIFALTANPKDPSSLGTYTCEAVNCM 516 EC++ G Q+ WYKD + +K ++ L D S +G Y C A N + Sbjct: 121 FECRINGSEPLQVSWYKDGELLKDDANLQTSFIHNVATLQILQTDQSHVGQYNCSASNPL 180 Query: 517 GAAFSTSRVIARGQQSFLDNDDVPFNSLMPPGPAPIFIKEVENVKAKIGTSAILECQVLV 576 G A S++++ L +VP P F + +V +G S +C V Sbjct: 181 GTASSSAKLT-------LSEHEVP----------PFFDLKPVSVDLALGESGTFKCHV-T 222 Query: 577 PPWPRSIYWYNKEGVVEASDKYHIMADGLGGYSIEINYLEAVDDGEWKCVATSSSGVKQF 636 P I W + Y M ++ + + D G++ C A++ +G K Sbjct: 223 GTAPIKITWAKDNREIRPGGNYK-MTLVENTATLTVLKVTKGDAGQYTCYASNVAG-KDS 280 Query: 637 SAAYVHVLMPKNYRKPRFVESLKA--VMTDDGLVSFECKVVGFPTPTLQWFKDNEELKPG 694 +A + V P PRF++ L+ ++ D +ECK+ G P + W+KD E++ Sbjct: 281 CSAQLGVQEP-----PRFIKKLEPSRIVKQDEHTRYECKIGGSPEIKVLWYKDETEIQES 335 Query: 695 DVYQLTGTSSL-------------GSYCCVAKNVMGKAESSTQLTIEDIRNHLSEEDKLL 741 ++++ S+ G Y C A N G A SST L +++ Sbjct: 336 SKFRMSFVESVAVLEMYNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPP---------- 385 Query: 742 LLTNNKAPKFIEGLKSCQATVNEEFKFTVQVSISPEPKVSWFRDDQQVVESDNVKILKET 801 K P +E LK + E + T P +VSW +D +++ KI+ E Sbjct: 386 --VFRKKPHPVETLKGADVHLECELQGT------PPFQVSWHKDKRELRSGKKYKIMSEN 437 Query: 802 LGVCHLKIHALEVADQAEWKCIATNDFGQSITSCFLKLNVPKHYKKPKFLEELKAVLS-E 860 + + I ++ AD E++C A+ND G + L P P+F+++L + + Sbjct: 438 F-LTSIHILNVDSADIGEYQCKASNDVGSDTCVGSITLKAP-----PRFVKKLSDISTVV 491 Query: 861 GGAVNLECKVIGVPQPTLKWFKDGRELKAGDIHKIISGEDGTCCL----------GIYTC 910 G V L+ + G ++ WFKD E+ + IS + L G YTC Sbjct: 492 GEEVQLQATIEGAEPISVAWFKDKGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTC 551 Query: 911 EAHNCMGTTSSSAALLGFE 929 + N GT A L E Sbjct: 552 QIKNEAGTQECFATLSVLE 570
>pdb|3B43|A Chain A, I-band Fragment I65-i70 From Titin Length = 570 Back     alignment and structure
>pdb|2RIK|A Chain A, I-Band Fragment I67-I69 From Titin Length = 284 Back     alignment and structure
>pdb|2RIK|A Chain A, I-Band Fragment I67-I69 From Titin Length = 284 Back     alignment and structure
>pdb|2RJM|A Chain A, 3ig Structure Of Titin Domains I67-I69 E-To-A Mutated Variant Length = 284 Back     alignment and structure
>pdb|2RJM|A Chain A, 3ig Structure Of Titin Domains I67-I69 E-To-A Mutated Variant Length = 284 Back     alignment and structure
>pdb|3LAF|A Chain A, Structure Of Dcc, A Netrin-1 Receptor Length = 403 Back     alignment and structure
>pdb|3LAF|A Chain A, Structure Of Dcc, A Netrin-1 Receptor Length = 403 Back     alignment and structure
>pdb|3DMK|A Chain A, Crystal Structure Of Down Syndrome Cell Adhesion Molecule (Dscam) Isoform 1.30.30, N-Terminal Eight Ig Domains Length = 816 Back     alignment and structure
>pdb|1YA5|A Chain A, Crystal Structure Of The Titin Domains Z1z2 In Complex With Telethonin Length = 201 Back     alignment and structure
>pdb|2YD9|A Chain A, Crystal Structure Of The N-Terminal Ig1-3 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 304 Back     alignment and structure
>pdb|2YD9|A Chain A, Crystal Structure Of The N-Terminal Ig1-3 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 304 Back     alignment and structure
>pdb|2YD9|A Chain A, Crystal Structure Of The N-Terminal Ig1-3 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 304 Back     alignment and structure
>pdb|2A38|A Chain A, Crystal Structure Of The N-Terminus Of Titin Length = 194 Back     alignment and structure
>pdb|3KLD|A Chain A, Ptprg Cntn4 Complex Length = 384 Back     alignment and structure
>pdb|3KLD|A Chain A, Ptprg Cntn4 Complex Length = 384 Back     alignment and structure
>pdb|3JXA|A Chain A, Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = 383 Back     alignment and structure
>pdb|3JXA|A Chain A, Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = 383 Back     alignment and structure
>pdb|2WIM|A Chain A, Crystal Structure Of Ncam2 Ig1-3 Length = 291 Back     alignment and structure
>pdb|2WIM|A Chain A, Crystal Structure Of Ncam2 Ig1-3 Length = 291 Back     alignment and structure
>pdb|3V2A|R Chain R, Vegfr-2VEGF-A Complex Structure Length = 772 Back     alignment and structure
>pdb|2OM5|A Chain A, N-Terminal Fragment Of Human Tax1 Length = 381 Back     alignment and structure
>pdb|2OM5|A Chain A, N-Terminal Fragment Of Human Tax1 Length = 381 Back     alignment and structure
>pdb|2IEP|A Chain A, Crystal Structure Of Immunoglobulin-Like Domains 1 And 2 Of The Receptor Tyrosine Kinase Musk Length = 192 Back     alignment and structure
>pdb|1CS6|A Chain A, N-terminal Fragment Of Axonin-1 From Chicken Length = 382 Back     alignment and structure
>pdb|1CS6|A Chain A, N-terminal Fragment Of Axonin-1 From Chicken Length = 382 Back     alignment and structure
>pdb|2XY1|A Chain A, Crystal Structure Of Ncam2 Ig3-4 Length = 192 Back     alignment and structure
>pdb|3LCY|A Chain A, Titin Ig Tandem Domains A164-A165 Length = 197 Back     alignment and structure
>pdb|3LCY|A Chain A, Titin Ig Tandem Domains A164-A165 Length = 197 Back     alignment and structure
>pdb|3LCY|A Chain A, Titin Ig Tandem Domains A164-A165 Length = 197 Back     alignment and structure
>pdb|3PXH|A Chain A, Tandem Ig Domains Of Tyrosine Phosphatase Lar Length = 201 Back     alignment and structure
>pdb|2VRA|A Chain A, Drosophila Robo Ig1-2 (Monoclinic Form) Length = 208 Back     alignment and structure
>pdb|2VRA|A Chain A, Drosophila Robo Ig1-2 (Monoclinic Form) Length = 208 Back     alignment and structure
>pdb|2VR9|A Chain A, Drosophila Robo Ig1-2 (Tetragonal Form) Length = 217 Back     alignment and structure
>pdb|2VR9|A Chain A, Drosophila Robo Ig1-2 (Tetragonal Form) Length = 217 Back     alignment and structure
>pdb|2YD1|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Drosophila Receptor Protein Tyrosine Phosphatase Dlar Length = 212 Back     alignment and structure
>pdb|2YD1|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Drosophila Receptor Protein Tyrosine Phosphatase Dlar Length = 212 Back     alignment and structure
>pdb|2YD1|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Drosophila Receptor Protein Tyrosine Phosphatase Dlar Length = 212 Back     alignment and structure
>pdb|2YD5|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Lar Length = 214 Back     alignment and structure
>pdb|3PXJ|A Chain A, Tandem Ig Repeats Of Dlar Length = 210 Back     alignment and structure
>pdb|3PXJ|A Chain A, Tandem Ig Repeats Of Dlar Length = 210 Back     alignment and structure
>pdb|3PXJ|A Chain A, Tandem Ig Repeats Of Dlar Length = 210 Back     alignment and structure
>pdb|1EVT|C Chain C, Crystal Structure Of Fgf1 In Complex With The Extracellular Ligand Binding Domain Of Fgf Receptor 1 (Fgfr1) Length = 225 Back     alignment and structure
>pdb|1EVT|C Chain C, Crystal Structure Of Fgf1 In Complex With The Extracellular Ligand Binding Domain Of Fgf Receptor 1 (Fgfr1) Length = 225 Back     alignment and structure
>pdb|3OJV|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr1c Exhibiting An Ordered Ligand Specificity-Determining Betac'-Betae Loop Length = 226 Back     alignment and structure
>pdb|3OJV|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr1c Exhibiting An Ordered Ligand Specificity-Determining Betac'-Betae Loop Length = 226 Back     alignment and structure
>pdb|1CVS|C Chain C, Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex Length = 225 Back     alignment and structure
>pdb|1CVS|C Chain C, Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex Length = 225 Back     alignment and structure
>pdb|2YD6|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Delta Length = 212 Back     alignment and structure
>pdb|2YD6|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Delta Length = 212 Back     alignment and structure
>pdb|1FHG|A Chain A, High Resolution Refinement Of Telokin Length = 154 Back     alignment and structure
>pdb|3V6B|R Chain R, Vegfr-2VEGF-E Complex Structure Length = 424 Back     alignment and structure
>pdb|3V6B|R Chain R, Vegfr-2VEGF-E Complex Structure Length = 424 Back     alignment and structure
>pdb|2NZI|A Chain A, Crystal Structure Of Domains A168-A170 From Titin Length = 305 Back     alignment and structure
>pdb|2NZI|A Chain A, Crystal Structure Of Domains A168-A170 From Titin Length = 305 Back     alignment and structure
>pdb|1TLK|A Chain A, X-Ray Structure Determination Of Telokin, The C-Terminal Domain Of Myosin Light Chain Kinase, At 2.8 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|2YD2|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 214 Back     alignment and structure
>pdb|2YD2|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 214 Back     alignment and structure
>pdb|2YD3|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 202 Back     alignment and structure
>pdb|2YD3|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 202 Back     alignment and structure
>pdb|2V9Q|A Chain A, First And Second Ig Domains From Human Robo1 Length = 212 Back     alignment and structure
>pdb|2J8H|A Chain A, Structure Of The Immunoglobulin Tandem Repeat A168-A169 Of Titin Length = 197 Back     alignment and structure
>pdb|2J8H|A Chain A, Structure Of The Immunoglobulin Tandem Repeat A168-A169 Of Titin Length = 197 Back     alignment and structure
>pdb|2ILL|A Chain A, Anomalous Substructure Of Titin-A168169 Length = 195 Back     alignment and structure
>pdb|2ILL|A Chain A, Anomalous Substructure Of Titin-A168169 Length = 195 Back     alignment and structure
>pdb|2V5S|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 394 Back     alignment and structure
>pdb|2V5M|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 388 Back     alignment and structure
>pdb|2LQR|A Chain A, Nmr Structure Of Ig3 Domain Of Palladin Length = 108 Back     alignment and structure
>pdb|3P3Y|A Chain A, Crystal Structure Of Neurofascin Homophilic Adhesion Complex In Space Group P6522 Length = 404 Back     alignment and structure
>pdb|3P3Y|A Chain A, Crystal Structure Of Neurofascin Homophilic Adhesion Complex In Space Group P6522 Length = 404 Back     alignment and structure
>pdb|2V5T|A Chain A, Crystal Structure Of Ncam2 Ig2-3 Length = 189 Back     alignment and structure
>pdb|2V5T|A Chain A, Crystal Structure Of Ncam2 Ig2-3 Length = 189 Back     alignment and structure
>pdb|2V5R|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 391 Back     alignment and structure
>pdb|2DM3|A Chain A, Solution Structure Of The Second Ig Domain Of Human Palladin Length = 110 Back     alignment and structure
>pdb|2YD4|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Chicken Receptor Protein Tyrosine Phosphatase Sigma Length = 210 Back     alignment and structure
>pdb|2YD4|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Chicken Receptor Protein Tyrosine Phosphatase Sigma Length = 210 Back     alignment and structure
>pdb|2YD4|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Chicken Receptor Protein Tyrosine Phosphatase Sigma Length = 210 Back     alignment and structure
>pdb|2JLL|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 Back     alignment and structure
>pdb|2JLL|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 Back     alignment and structure
>pdb|3PUC|A Chain A, Atomic Resolution Structure Of Titin Domain M7 Length = 99 Back     alignment and structure
>pdb|3PUC|A Chain A, Atomic Resolution Structure Of Titin Domain M7 Length = 99 Back     alignment and structure
>pdb|2XYC|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 Back     alignment and structure
>pdb|2XYC|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 Back     alignment and structure
>pdb|2DM2|A Chain A, Solution Structure Of The First Ig Domain Of Human Palladin Length = 110 Back     alignment and structure
>pdb|1BIH|A Chain A, Crystal Structure Of The Insect Immune Protein Hemolin: A New Domain Arrangement With Implications For Homophilic Adhesion Length = 395 Back     alignment and structure
>pdb|1BIH|A Chain A, Crystal Structure Of The Insect Immune Protein Hemolin: A New Domain Arrangement With Implications For Homophilic Adhesion Length = 395 Back     alignment and structure
>pdb|1QZ1|A Chain A, Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam Length = 291 Back     alignment and structure
>pdb|2EDL|A Chain A, Solution Structure Of The Ig-Like Domain (3801-3897) Of Human Obscurin Length = 110 Back     alignment and structure
>pdb|1RY7|B Chain B, Crystal Structure Of The 3 Ig Form Of Fgfr3c In Complex With Fgf1 Length = 334 Back     alignment and structure
>pdb|1IIL|E Chain E, Crystal Structure Of Pro253arg Apert Mutant Fgf Receptor 2 (Fgfr2) In Complex With Fgf2 Length = 220 Back     alignment and structure
>pdb|1IIL|E Chain E, Crystal Structure Of Pro253arg Apert Mutant Fgf Receptor 2 (Fgfr2) In Complex With Fgf2 Length = 220 Back     alignment and structure
>pdb|2FDB|P Chain P, Crystal Structure Of Fibroblast Growth Factor (Fgf)8b In Complex With Fgf Receptor (Fgfr) 2c Length = 220 Back     alignment and structure
>pdb|2C5D|C Chain C, Structure Of A Minimal Gas6-Axl Complex Length = 195 Back     alignment and structure
>pdb|1EV2|E Chain E, Crystal Structure Of Fgf2 In Complex With The Extracellular Ligand Binding Domain Of Fgf Receptor 2 (Fgfr2) Length = 220 Back     alignment and structure
>pdb|2KDG|A Chain A, Solution Structure Of The 1st Ig Domain Of Myotilin Length = 100 Back     alignment and structure
>pdb|1E0O|B Chain B, Crystal Structure Of A Ternary Fgf1-Fgfr2-Heparin Complex Length = 219 Back     alignment and structure
>pdb|1II4|E Chain E, Crystal Structure Of Ser252trp Apert Mutant Fgf Receptor 2 (Fgfr2) In Complex With Fgf2 Length = 220 Back     alignment and structure
>pdb|3GRW|A Chain A, Fgfr3 In Complex With A Fab Length = 241 Back     alignment and structure
>pdb|1DJS|A Chain A, Ligand-binding Portion Of Fibroblast Growth Factor Receptor 2 In Complex With Fgf1 Length = 216 Back     alignment and structure
>pdb|3OJM|B Chain B, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr2b Harboring P253r Apert Mutation Length = 231 Back     alignment and structure
>pdb|3S97|C Chain C, Ptprz Cntn1 Complex Length = 201 Back     alignment and structure
>pdb|2Y25|A Chain A, Crystal Structure Of The Myomesin Domains My11-My13 Length = 317 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3KVQ|A Chain A, Crystal Structure Of Vegfr2 Extracellular Domain D7 Length = 108 Back     alignment and structure
>pdb|3OJ2|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr2b Harboring The A172f Pfeiffer Syndrome Mutation Length = 231 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|1RHF|A Chain A, Crystal Structure Of Human Tyro3-D1d2 Length = 182 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1075
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-122
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 5e-99
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-93
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-85
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-84
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 5e-65
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-114
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-98
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 9e-88
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-80
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 2e-91
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 4e-89
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 8e-84
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 9e-72
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 2e-64
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 2e-31
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 6e-29
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-85
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-76
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-64
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-61
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-46
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 4e-65
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 4e-63
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 3e-58
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 1e-51
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 8e-42
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 3e-31
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 7e-30
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 1e-20
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 2e-62
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 3e-56
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 9e-53
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 1e-50
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 5e-50
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 7e-47
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 9e-38
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 8e-34
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 6e-60
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 5e-54
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 6e-52
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 1e-47
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 3e-33
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 4e-28
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 5e-26
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 6e-60
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 3e-50
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 5e-49
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 2e-46
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 2e-39
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 6e-35
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 4e-31
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 8e-28
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 8e-21
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 7e-13
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 2e-59
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 8e-56
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 1e-50
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 1e-49
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 2e-48
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 3e-38
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 1e-19
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 5e-13
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 8e-58
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 1e-53
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-52
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 9e-39
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 1e-32
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 3e-30
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 8e-19
3kld_A 384 Contactin 4, axcam, BIG-2; cell adhesion, protein 1e-12
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 1e-57
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 3e-48
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 6e-48
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 5e-42
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 6e-36
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 1e-32
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 3e-27
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 2e-25
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 3e-56
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 1e-52
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 3e-45
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 3e-37
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 5e-30
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 3e-29
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 2e-55
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 1e-52
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 2e-50
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 8e-41
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 2e-34
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 9e-31
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 2e-22
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 2e-55
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 9e-53
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 3e-43
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 1e-36
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 1e-34
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 1e-23
1bih_A 395 Hemolin; insect immunity, LPS-binding, homophilic 2e-13
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 2e-55
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 3e-50
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 1e-44
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 9e-40
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 5e-33
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 5e-32
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 4e-24
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 6e-22
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 5e-16
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-54
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 1e-49
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-47
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-37
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 1e-32
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 4e-30
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 3e-20
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 2e-52
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 9e-46
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 7e-35
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 3e-27
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 4e-22
2v5m_A 388 Dscam; neurobiology SPL immunoglobulin domain, cel 9e-11
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 7e-49
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 5e-41
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 6e-40
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 6e-38
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 7e-33
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 1e-31
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 5e-27
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 7e-23
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 5e-16
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 2e-47
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 1e-46
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 5e-42
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 2e-37
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 7e-36
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 1e-31
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 6e-27
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 1e-22
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 6e-46
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 3e-40
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 8e-38
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 1e-36
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 1e-35
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 6e-33
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 1e-30
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 3e-26
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 5e-19
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 3e-44
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 2e-36
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 2e-36
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 3e-35
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 3e-29
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 3e-24
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 5e-20
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 5e-17
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 1e-42
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 2e-39
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 6e-39
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 9e-35
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 1e-32
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 1e-27
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 1e-23
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 3e-12
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 1e-09
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 3e-40
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 3e-39
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-35
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 9e-35
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-28
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-23
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-20
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 6e-11
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 6e-07
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 5e-40
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 6e-35
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 4e-33
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 4e-31
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 8e-25
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 4e-24
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 6e-21
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 4e-17
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 2e-16
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 3e-13
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 1e-39
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 3e-31
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 2e-29
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 4e-27
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 8e-26
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 8e-25
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 4e-23
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 2e-20
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 2e-15
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 4e-39
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 1e-37
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 5e-33
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 6e-31
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 2e-26
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 9e-22
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 1e-18
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 1e-14
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 5e-05
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 1e-37
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 1e-33
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 3e-33
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 4e-27
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 7e-26
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 2e-20
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 2e-08
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 2e-37
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 3e-35
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 9e-33
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 1e-27
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 1e-26
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 3e-21
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 3e-21
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 6e-16
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 4e-13
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 4e-35
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 4e-31
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 6e-30
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 1e-29
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 3e-24
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 4e-19
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 8e-16
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 2e-13
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 2e-34
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 3e-31
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 6e-29
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 3e-28
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 1e-21
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 5e-20
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 1e-19
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 5e-19
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 5e-16
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 8e-34
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 3e-30
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 6e-29
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 2e-23
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 4e-17
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 4e-15
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 4e-14
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 1e-04
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 1e-33
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 2e-32
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 4e-31
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 4e-30
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 4e-25
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 4e-19
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 1e-15
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 1e-11
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 5e-33
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 1e-29
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 5e-29
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 1e-26
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 1e-25
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 3e-24
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 5e-19
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 8e-17
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 2e-14
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 3e-14
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 6e-06
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 6e-33
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 3e-32
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 1e-31
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 3e-30
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 1e-25
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 1e-24
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 2e-22
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 2e-20
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 1e-32
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 6e-29
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 6e-28
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 4e-26
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 1e-24
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 2e-18
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 4e-15
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 2e-32
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 6e-29
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 4e-28
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 5e-26
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 7e-25
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 2e-22
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 1e-19
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 5e-16
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 6e-32
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 8e-28
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 4e-27
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 7e-26
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 1e-24
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 7e-18
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 3e-12
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 9e-12
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 1e-10
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 2e-05
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 2e-31
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 3e-29
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 5e-26
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 1e-25
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 2e-20
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 4e-20
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 3e-14
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 8e-11
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 2e-09
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 4e-31
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 3e-30
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 1e-27
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 3e-27
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 6e-20
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 7e-14
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 1e-12
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 2e-11
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 5e-31
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 6e-31
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 3e-28
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 2e-27
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 6e-27
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 4e-24
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 4e-18
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 6e-11
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 4e-07
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 7e-31
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 9e-29
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 1e-27
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 3e-27
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 6e-26
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 6e-24
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 4e-22
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 2e-15
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 1e-06
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 5e-06
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 1e-30
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 7e-30
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 9e-30
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 2e-29
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 7e-27
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 8e-26
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 6e-19
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 2e-12
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 2e-07
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 4e-30
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 1e-25
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 2e-23
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 3e-23
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 1e-19
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 1e-16
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 3e-13
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 5e-09
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 9e-08
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 2e-29
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 8e-24
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 4e-21
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 3e-20
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 7e-19
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 3e-18
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 8e-18
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 1e-14
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 5e-29
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 6e-26
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 6e-25
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 9e-18
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 6e-15
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 9e-12
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 3e-11
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 2e-10
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 5e-29
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 8e-27
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 5e-26
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 7e-26
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 3e-22
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 2e-20
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 3e-04
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 7e-29
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 1e-28
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 3e-24
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 9e-22
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 2e-18
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 5e-15
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 5e-13
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 1e-07
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 1e-06
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 3e-28
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 9e-28
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-23
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-23
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-23
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 4e-23
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 5e-23
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-13
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 5e-11
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 7e-27
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 1e-26
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 4e-26
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 3e-18
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 3e-13
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 1e-12
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 2e-12
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 7e-27
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 1e-26
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 1e-26
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 3e-26
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 2e-20
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 3e-16
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 8e-10
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 1e-26
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 3e-24
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 3e-24
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 2e-23
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 9e-19
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 1e-16
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 4e-14
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 2e-12
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 9e-05
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 5e-26
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 2e-20
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 2e-19
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 4e-19
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 3e-15
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 7e-15
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 1e-12
3mjg_X289 Beta-type platelet-derived growth factor receptor; 4e-25
3mjg_X289 Beta-type platelet-derived growth factor receptor; 2e-23
3mjg_X289 Beta-type platelet-derived growth factor receptor; 1e-22
3mjg_X289 Beta-type platelet-derived growth factor receptor; 2e-22
3mjg_X289 Beta-type platelet-derived growth factor receptor; 5e-22
3mjg_X289 Beta-type platelet-derived growth factor receptor; 2e-16
3mjg_X289 Beta-type platelet-derived growth factor receptor; 3e-12
3mjg_X289 Beta-type platelet-derived growth factor receptor; 5e-12
3mjg_X289 Beta-type platelet-derived growth factor receptor; 7e-10
3mjg_X289 Beta-type platelet-derived growth factor receptor; 1e-07
3mjg_X289 Beta-type platelet-derived growth factor receptor; 6e-04
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 1e-24
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 7e-23
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 8e-23
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 5e-22
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 1e-21
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 2e-19
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 3e-13
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 9e-11
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 2e-05
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 1e-24
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 2e-24
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 1e-20
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 2e-19
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 1e-16
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 4e-07
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 3e-24
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 2e-23
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 4e-23
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 8e-21
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 1e-20
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 2e-16
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 8e-16
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 8e-16
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 1e-09
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 2e-06
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 5e-24
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 8e-24
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 1e-22
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 7e-22
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 8e-21
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 1e-20
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 2e-17
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 3e-16
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 2e-10
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 7e-24
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 7e-24
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 2e-19
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 3e-19
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 1e-18
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 5e-15
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 8e-11
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 8e-11
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 3e-10
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 8e-07
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 7e-24
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 2e-23
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 3e-22
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 2e-18
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 3e-18
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 1e-16
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 4e-09
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 1e-07
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 7e-24
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 3e-23
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 6e-21
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 6e-19
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 2e-16
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 9e-16
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 1e-05
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 2e-23
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 7e-22
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 1e-21
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 1e-20
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 3e-17
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 7e-14
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 7e-14
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 5e-13
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 4e-09
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 2e-08
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 2e-23
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 1e-21
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 4e-19
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 2e-17
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 5e-17
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 2e-15
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 1e-11
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 1e-11
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 2e-09
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 8e-07
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 2e-23
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 1e-21
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 1e-19
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 2e-18
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 7e-18
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 1e-15
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 5e-12
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 5e-12
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 3e-10
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 2e-07
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 4e-23
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 7e-23
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 2e-20
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 1e-18
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 3e-18
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 4e-13
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 1e-12
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 1e-12
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 3e-10
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 7e-08
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 6e-23
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 4e-22
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 2e-20
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 3e-20
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 1e-19
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 1e-19
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 1e-16
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 3e-15
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 2e-05
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 1e-22
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 5e-21
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 6e-21
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 3e-19
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 3e-16
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 2e-14
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 8e-14
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 8e-14
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 3e-08
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 3e-08
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 2e-22
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 1e-21
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 2e-19
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 6e-19
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 2e-16
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 3e-15
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 3e-12
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 3e-12
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 2e-08
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 1e-06
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 2e-22
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 1e-21
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 7e-19
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 2e-17
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 2e-17
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 9e-14
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 4e-11
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 4e-11
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 4e-09
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 7e-07
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 1e-21
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 2e-21
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 3e-21
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 6e-21
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 1e-20
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 3e-16
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 2e-12
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 2e-12
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 2e-21
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 1e-20
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 8e-16
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 1e-15
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 2e-15
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 4e-07
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 2e-21
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 5e-20
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 6e-19
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 1e-18
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 4e-17
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 4e-14
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 1e-13
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 1e-13
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 2e-08
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 3e-07
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 1e-20
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 2e-17
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 2e-17
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 1e-15
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 4e-12
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 5e-12
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 7e-12
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 3e-11
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 4e-20
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 2e-18
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 5e-17
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 7e-17
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 1e-14
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 1e-14
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 1e-14
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 2e-11
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 8e-10
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 6e-07
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 6e-20
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 7e-20
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 4e-19
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 1e-18
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 5e-17
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 2e-11
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 2e-11
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 1e-10
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 2e-08
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 1e-05
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 1e-19
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 5e-19
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 2e-18
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 2e-18
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 5e-16
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 1e-12
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 1e-12
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 1e-12
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 3e-08
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 6e-08
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 1e-19
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 2e-19
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 1e-18
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 3e-18
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 1e-16
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 2e-12
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 2e-12
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 5e-11
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 3e-08
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 2e-07
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 1e-19
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 4e-19
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 2e-17
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 3e-17
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 3e-15
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 3e-15
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 5e-14
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 1e-10
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 2e-10
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 7e-07
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2e-19
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 1e-17
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 4e-16
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2e-12
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 6e-05
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 7e-04
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 1e-18
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 2e-18
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 2e-15
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 5e-14
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 4e-13
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 8e-12
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 2e-07
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 2e-07
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 1e-04
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 1e-18
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 2e-17
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 4e-17
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 4e-16
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 5e-15
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 1e-14
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 2e-14
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 1e-13
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 2e-18
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 2e-18
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 5e-17
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 1e-16
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 7e-14
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 1e-13
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 1e-10
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 1e-10
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 2e-08
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 3e-07
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 3e-18
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 7e-16
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 1e-14
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 2e-14
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 4e-14
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 8e-09
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 8e-08
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 4e-07
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 4e-07
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 3e-05
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 3e-18
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 4e-16
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 6e-14
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 6e-10
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 6e-09
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 3e-04
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 4e-04
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-18
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-18
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-18
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-17
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-13
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 4e-18
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 4e-17
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 1e-14
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 1e-11
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 2e-11
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 5e-09
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 5e-09
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 5e-08
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 2e-04
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 5e-18
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 3e-16
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 2e-13
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 3e-12
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 1e-11
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 2e-09
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 2e-09
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 3e-08
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 7e-04
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 1e-17
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 5e-16
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 6e-16
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 2e-15
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 6e-14
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 6e-14
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 5e-13
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 6e-10
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 5e-09
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 2e-06
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 1e-17
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 2e-15
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 1e-13
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 6e-12
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 2e-11
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 5e-10
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 5e-10
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 7e-10
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 1e-17
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 1e-17
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 8e-13
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 5e-12
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 4e-11
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 1e-07
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 2e-07
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 3e-06
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 1e-17
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 6e-17
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 4e-16
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 3e-10
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 2e-05
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 2e-04
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 2e-04
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 8e-04
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 3e-17
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 2e-16
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 2e-12
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 2e-11
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 2e-10
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 1e-07
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 2e-07
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 2e-07
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 3e-17
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 8e-15
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 9e-14
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 7e-12
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 2e-11
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 2e-10
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 1e-09
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 1e-09
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 1e-04
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 9e-17
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 2e-14
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 4e-13
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 4e-11
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 9e-10
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 3e-08
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 1e-06
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 1e-06
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 1e-16
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 1e-16
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 2e-15
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 4e-12
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 7e-11
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 3e-10
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 1e-09
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 1e-09
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 8e-04
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 1e-16
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 2e-16
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 6e-16
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 2e-15
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 9e-15
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 3e-14
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 3e-14
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 6e-13
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 2e-10
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 2e-08
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 2e-16
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 2e-14
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 6e-13
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 1e-12
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 3e-11
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 5e-11
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 1e-07
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 1e-07
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 5e-05
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 8e-04
2fbo_J250 V1V2;, variable region-containing chitin-binding p 2e-16
2fbo_J250 V1V2;, variable region-containing chitin-binding p 1e-15
2fbo_J250 V1V2;, variable region-containing chitin-binding p 4e-15
2fbo_J250 V1V2;, variable region-containing chitin-binding p 2e-13
2fbo_J250 V1V2;, variable region-containing chitin-binding p 2e-12
2fbo_J250 V1V2;, variable region-containing chitin-binding p 6e-11
2fbo_J250 V1V2;, variable region-containing chitin-binding p 2e-10
2fbo_J250 V1V2;, variable region-containing chitin-binding p 2e-06
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 3e-16
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 6e-15
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 2e-14
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 2e-12
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 2e-11
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 3e-06
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 2e-05
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 5e-04
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 5e-04
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 5e-04
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 3e-16
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 8e-15
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 2e-14
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 5e-11
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 1e-10
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 2e-07
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 3e-07
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 3e-07
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 4e-16
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 3e-15
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 3e-14
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 2e-10
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 2e-10
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 3e-09
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 5e-08
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 3e-06
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 3e-06
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 3e-05
2ens_A96 Advanced glycosylation END product-specific recept 7e-16
2ens_A96 Advanced glycosylation END product-specific recept 4e-14
2ens_A96 Advanced glycosylation END product-specific recept 9e-14
2ens_A96 Advanced glycosylation END product-specific recept 3e-11
2ens_A96 Advanced glycosylation END product-specific recept 3e-11
2ens_A96 Advanced glycosylation END product-specific recept 2e-07
2ens_A96 Advanced glycosylation END product-specific recept 2e-07
2ens_A96 Advanced glycosylation END product-specific recept 2e-07
2ens_A96 Advanced glycosylation END product-specific recept 3e-06
2ens_A96 Advanced glycosylation END product-specific recept 5e-05
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 1e-15
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 7e-12
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 1e-09
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 6e-08
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 1e-15
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 1e-14
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 6e-14
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 2e-11
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 1e-10
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 4e-08
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 5e-08
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 5e-08
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 1e-15
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 4e-14
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 8e-14
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 7e-13
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 7e-13
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 4e-11
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 9e-07
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 9e-07
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 2e-04
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 1e-15
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 3e-12
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 5e-12
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 9e-12
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 9e-12
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 2e-10
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 1e-06
1waa_A93 Titin; metal binding protein, calmodulin-binding, 2e-15
1waa_A93 Titin; metal binding protein, calmodulin-binding, 3e-15
1waa_A93 Titin; metal binding protein, calmodulin-binding, 4e-14
1waa_A93 Titin; metal binding protein, calmodulin-binding, 2e-13
1waa_A93 Titin; metal binding protein, calmodulin-binding, 1e-10
1waa_A93 Titin; metal binding protein, calmodulin-binding, 2e-08
1waa_A93 Titin; metal binding protein, calmodulin-binding, 3e-07
1waa_A93 Titin; metal binding protein, calmodulin-binding, 3e-07
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 2e-15
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 3e-15
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 2e-14
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 1e-11
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 2e-09
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 5e-09
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 7e-08
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 7e-08
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 2e-15
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 2e-14
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 6e-11
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 1e-07
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 2e-06
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 8e-06
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 2e-15
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 3e-15
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 4e-15
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 2e-12
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 2e-11
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 3e-09
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 5e-09
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 5e-09
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 3e-04
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 4e-15
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 5e-14
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 2e-13
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 7e-13
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 2e-12
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 5e-11
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 7e-08
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 2e-04
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 7e-15
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 3e-14
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 9e-13
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 1e-11
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 1e-10
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 1e-08
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 3e-07
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 3e-07
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 8e-04
1wwb_X103 Protein (brain derived neurotrophic factor recepto 9e-15
1wwb_X103 Protein (brain derived neurotrophic factor recepto 9e-14
1wwb_X103 Protein (brain derived neurotrophic factor recepto 1e-11
1wwb_X103 Protein (brain derived neurotrophic factor recepto 4e-11
1wwb_X103 Protein (brain derived neurotrophic factor recepto 8e-11
1wwb_X103 Protein (brain derived neurotrophic factor recepto 8e-06
1wwb_X103 Protein (brain derived neurotrophic factor recepto 8e-06
1wwb_X103 Protein (brain derived neurotrophic factor recepto 8e-06
1wwb_X103 Protein (brain derived neurotrophic factor recepto 1e-05
1wwb_X103 Protein (brain derived neurotrophic factor recepto 2e-05
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 1e-14
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 1e-13
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 5e-12
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 4e-10
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 5e-10
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 2e-08
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 2e-08
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 6e-08
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 1e-14
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 5e-14
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 2e-12
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 3e-12
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 2e-10
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 1e-08
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 1e-08
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 3e-08
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 5e-04
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-14
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 3e-14
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 4e-13
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-10
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-08
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 4e-08
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 9e-08
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 9e-08
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-04
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 4e-04
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 2e-14
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 2e-12
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 3e-12
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 7e-12
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 5e-09
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 1e-06
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 8e-06
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 2e-14
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 5e-14
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 9e-13
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 9e-10
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 1e-08
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 6e-08
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 6e-08
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 2e-07
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 3e-14
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 3e-13
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 1e-11
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 2e-10
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 2e-09
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 3e-06
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 4e-05
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 4e-05
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 4e-14
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 1e-12
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 1e-12
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 4e-11
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 5e-11
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 9e-10
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 9e-10
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 9e-08
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 2e-07
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 6e-04
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 7e-14
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 2e-08
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 2e-08
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 1e-07
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 9e-14
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 3e-13
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 2e-11
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 5e-11
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 1e-07
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 1e-05
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 7e-05
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 7e-05
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 7e-04
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 9e-14
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 2e-12
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 2e-12
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 1e-09
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 2e-09
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 7e-07
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 3e-05
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 3e-05
2v9t_A117 Roundabout homolog 1; structural protein-receptor 1e-13
2v9t_A117 Roundabout homolog 1; structural protein-receptor 1e-12
2v9t_A117 Roundabout homolog 1; structural protein-receptor 4e-10
2v9t_A117 Roundabout homolog 1; structural protein-receptor 2e-09
2v9t_A117 Roundabout homolog 1; structural protein-receptor 1e-08
2v9t_A117 Roundabout homolog 1; structural protein-receptor 4e-06
2v9t_A117 Roundabout homolog 1; structural protein-receptor 1e-05
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 1e-13
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 6e-12
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 6e-12
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 2e-11
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 9e-11
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 6e-10
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 3e-09
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 5e-09
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 2e-04
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 2e-13
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 4e-10
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 4e-09
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 5e-05
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 2e-13
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 1e-12
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 1e-11
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 7e-11
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 7e-11
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 2e-09
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 4e-08
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 4e-08
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 1e-07
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 2e-04
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 2e-13
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 2e-12
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 2e-11
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 1e-10
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 4e-10
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 4e-07
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 1e-05
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 1e-05
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 1e-04
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 3e-13
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 1e-12
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 5e-11
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 9e-08
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 6e-07
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 6e-05
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 1e-04
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 2e-12
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 4e-11
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 5e-11
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 7e-10
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 4e-09
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 2e-08
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 1e-04
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 4e-12
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 5e-11
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 1e-10
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 7e-10
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 8e-10
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 2e-08
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 1e-05
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 1e-05
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 1e-05
3eow_R221 Poliovirus receptor; immunoglobulin super family, 5e-12
3eow_R221 Poliovirus receptor; immunoglobulin super family, 5e-08
3eow_R221 Poliovirus receptor; immunoglobulin super family, 7e-06
1he7_A126 High affinity nerve growth factor receptor; transf 6e-12
1he7_A126 High affinity nerve growth factor receptor; transf 1e-11
1he7_A126 High affinity nerve growth factor receptor; transf 9e-10
1he7_A126 High affinity nerve growth factor receptor; transf 6e-09
1he7_A126 High affinity nerve growth factor receptor; transf 5e-08
1he7_A126 High affinity nerve growth factor receptor; transf 1e-05
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 6e-12
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 6e-06
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 1e-05
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 4e-04
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 1e-11
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 1e-11
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 2e-09
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 1e-07
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 3e-06
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 4e-04
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 6e-04
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 2e-11
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 1e-10
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 7e-10
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 1e-09
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 2e-05
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 2e-04
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 2e-11
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 7e-11
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 2e-10
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 1e-09
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 1e-04
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 3e-11
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 4e-11
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 7e-11
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 7e-11
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 2e-10
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 1e-09
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 3e-08
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 6e-07
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 9e-07
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 5e-11
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 1e-10
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 2e-10
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 6e-10
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 6e-10
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 5e-08
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 3e-06
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 2e-05
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 1e-04
1gl4_B98 Basement membrane-specific heparan sulfate proteog 6e-11
1gl4_B98 Basement membrane-specific heparan sulfate proteog 5e-10
1gl4_B98 Basement membrane-specific heparan sulfate proteog 2e-08
1gl4_B98 Basement membrane-specific heparan sulfate proteog 1e-06
1gl4_B98 Basement membrane-specific heparan sulfate proteog 1e-06
1gl4_B98 Basement membrane-specific heparan sulfate proteog 4e-06
1gl4_B98 Basement membrane-specific heparan sulfate proteog 2e-05
1gl4_B98 Basement membrane-specific heparan sulfate proteog 3e-05
1gl4_B98 Basement membrane-specific heparan sulfate proteog 2e-04
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 9e-11
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 3e-06
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 7e-06
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 1e-09
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 1e-09
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 2e-09
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 5e-06
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 1e-05
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 5e-05
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 4e-04
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 2e-09
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 5e-05
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 6e-04
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 2e-09
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 4e-09
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 4e-09
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 4e-09
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 9e-09
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 2e-08
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 7e-08
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 3e-06
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 9e-06
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 6e-09
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 2e-06
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 1e-04
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
2wqr_A323 IG epsilon chain C region; immune system, immunogl 2e-08
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 3e-08
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 2e-07
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 3e-06
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 4e-08
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-07
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-07
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 3e-06
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-04
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 5e-08
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 2e-06
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 2e-05
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 4e-05
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 5e-05
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 1e-04
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 7e-08
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 3e-07
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 3e-07
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 8e-06
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 1e-07
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 2e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-04
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 4e-07
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 1e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 1e-06
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 2e-05
3s35_X122 Vascular endothelial growth factor receptor 2; ant 1e-06
3s35_X122 Vascular endothelial growth factor receptor 2; ant 3e-06
3s35_X122 Vascular endothelial growth factor receptor 2; ant 3e-06
3s35_X122 Vascular endothelial growth factor receptor 2; ant 3e-06
3s35_X122 Vascular endothelial growth factor receptor 2; ant 4e-05
3s35_X122 Vascular endothelial growth factor receptor 2; ant 6e-05
3s35_X122 Vascular endothelial growth factor receptor 2; ant 2e-04
3s35_X122 Vascular endothelial growth factor receptor 2; ant 5e-04
3s35_X122 Vascular endothelial growth factor receptor 2; ant 8e-04
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 3e-06
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 3e-06
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 3e-04
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 3e-06
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 3e-04
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 4e-06
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 6e-06
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 2e-05
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 3e-05
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 3e-05
3bn3_B196 ICAM-5, intercellular adhesion molecule 5, telence 5e-05
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 5e-05
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 6e-05
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 7e-04
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 7e-05
3q0h_A117 T cell immunoreceptor with IG and ITIM domains; im 7e-05
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 2e-04
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 3e-04
1zxq_A192 ICAM-2, intercellular adhesion molecule-2; immunog 4e-04
2oyp_A109 Hepatitis A virus cellular receptor 2; TIM-3, T-ce 6e-04
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 6e-04
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 7e-04
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
 Score =  386 bits (993), Expect = e-122
 Identities = 143/614 (23%), Positives = 240/614 (39%), Gaps = 87/614 (14%)

Query: 348 DAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKIHWYRNDRKLEENKIYRTQHDGNFYFI 407
           + P FI  L  +   +G    L  ++    EI+I WY+   KL     Y+ Q   N   +
Sbjct: 4   EPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIRIAWYKEHTKLRSAPAYKMQFKNNVASL 63

Query: 408 DLSSVSLFDSGRWTCLAENAVGRSHCSCELSVLVPKAYKAPFFTKELEAILTEQG-TVSL 466
            ++ V   D G +TC AEN+VG    S  L +   K    P F ++L+ +    G  V+ 
Sbjct: 64  VINKVDHSDVGEYTCKAENSVGAVASSAVLVIKERKL--PPSFARKLKDVHETLGFPVAF 121

Query: 467 ECKVMGIPTPQLIWYKDNKKIKAGDIFALTANPK---------DPSSLGTYTCEAVNCMG 517
           EC++ G    Q+ WYKD + +K       +             D S +G Y C A N +G
Sbjct: 122 ECRINGSEPLQVSWYKDGELLKDDANLQTSFIHNVATLQILQTDQSHVGQYNCSASNPLG 181

Query: 518 AAFSTSRVIARGQQSFLDNDDVPFNSLMPPGPAPIFIKEVENVKAKIGTSAILECQVLVP 577
            A S++++                  L      P F  +  +V   +G S   +C V   
Sbjct: 182 TASSSAKLT-----------------LSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGT 224

Query: 578 PWPRSIYWYNKEGVVEASDKYHIMADGLGGYSIEINYLEAVDDGEWKCVATSSSGVKQFS 637
                I W      +     Y +        ++ +  +   D G++ C A++ +G    S
Sbjct: 225 API-KITWAKDNREIRPGGNYKMTLVE-NTATLTVLKVTKGDAGQYTCYASNVAGKDSCS 282

Query: 638 AAYVHVLMPKNYRKPRFVESLKAVMT--DDGLVSFECKVVGFPTPTLQWFKDNEELKPGD 695
            A + V        PRF++ L+       D    +ECK+ G P   + W+KD  E++   
Sbjct: 283 -AQLGV-----QEPPRFIKKLEPSRIVKQDEHTRYECKIGGSPEIKVLWYKDETEIQESS 336

Query: 696 VYQLT---GTSSL----------GSYCCVAKNVMGKAESSTQLTIEDIRNHLSEEDKLLL 742
            ++++     + L          G Y C A N  G A SST L +++             
Sbjct: 337 KFRMSFVESVAVLEMYNLSVEDSGDYTCEAHNAAGSASSSTSLKVKE------------- 383

Query: 743 LTNNKAPKFIEGLKSCQATVNEEFKFTVQVSISPEPKVSWFRDDQQVVESDNVKILKETL 802
                 P F +     +     +     ++  +P  +VSW +D +++      KI+ E  
Sbjct: 384 -----PPVFRKKPHPVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSEN- 437

Query: 803 GVCHLKIHALEVADQAEWKCIATNDFGQSITSCFLKLNVPKHYKKPKFLEELKAV-LSEG 861
            +  + I  ++ AD  E++C A+ND G       + L  P     P+F+++L  +    G
Sbjct: 438 FLTSIHILNVDSADIGEYQCKASNDVGSDTCVGSITLKAP-----PRFVKKLSDISTVVG 492

Query: 862 GAVNLECKVIGVPQPTLKWFKDGRELKAGDIHKIISGEDGTCCL----------GIYTCE 911
             V L+  + G    ++ WFKD  E+     +  IS  +    L          G YTC+
Sbjct: 493 EEVQLQATIEGAEPISVAWFKDKGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTCQ 552

Query: 912 AHNCMGTTSSSAAL 925
             N  GT    A L
Sbjct: 553 IKNEAGTQECFATL 566


>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Length = 231 Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Length = 231 Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Length = 231 Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Length = 218 Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Length = 218 Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Length = 218 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Length = 323 Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Length = 214 Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Length = 214 Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Length = 214 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Length = 108 Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Length = 108 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Length = 186 Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Length = 186 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Length = 196 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Length = 327 Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Length = 327 Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Length = 316 Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Length = 316 Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 242 Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Length = 196 Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Length = 184 Back     alignment and structure
>3bn3_B ICAM-5, intercellular adhesion molecule 5, telencephalin; I domain, integrin, allosteric mobility, cell adhesi immune system; HET: NAG; 2.10A {Homo sapiens} Length = 196 Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Length = 210 Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A Length = 117 Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1zxq_A ICAM-2, intercellular adhesion molecule-2; immunoglobulin fold, cell adhesion, glycoprotein, transmembr; HET: NAG; 2.20A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 192 Back     alignment and structure
>2oyp_A Hepatitis A virus cellular receptor 2; TIM-3, T-cell immunoglobulin mucin, signaling protein; 1.95A {Mus musculus} PDB: 3kaa_A* Length = 109 Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3cjj_A 2l7u_A* 2e5e_A Length = 581 Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Length = 201 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1075
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 100.0
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 100.0
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 100.0
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 100.0
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 100.0
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 100.0
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 100.0
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 100.0
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 100.0
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 100.0
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 100.0
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 100.0
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 100.0
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 100.0
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 100.0
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 100.0
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 100.0
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 100.0
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 100.0
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 100.0
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 100.0
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 100.0
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 100.0
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 100.0
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 100.0
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 100.0
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 100.0
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 100.0
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 100.0
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 100.0
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 100.0
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 100.0
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 100.0
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 100.0
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 100.0
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 100.0
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 100.0
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 100.0
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 100.0
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 100.0
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 100.0
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 100.0
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 99.98
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 99.98
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.97
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 99.97
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 99.97
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.97
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.97
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.97
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.97
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.97
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.97
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.97
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.96
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.96
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.96
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.96
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.96
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.96
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.96
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.96
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.96
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.96
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.96
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.96
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.95
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.95
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.95
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.95
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.95
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.95
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.95
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.95
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.95
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.95
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.95
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.95
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.95
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.95
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.95
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.95
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.95
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.95
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.95
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.95
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.95
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.94
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.94
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.94
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.94
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.94
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.94
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.94
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.94
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.94
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.93
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.93
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.92
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.92
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.92
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.91
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.91
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.91
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.9
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.9
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.9
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.9
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.9
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.9
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.9
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.9
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.89
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.89
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.89
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.89
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.89
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.89
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.89
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.89
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.89
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.89
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.88
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.88
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.88
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.88
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.87
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.87
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.87
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.87
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.87
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.86
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.86
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.86
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.86
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.85
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.85
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.85
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.85
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.85
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.85
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.85
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 99.85
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.85
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.85
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.84
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.84
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.84
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.84
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 99.84
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.84
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.84
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.84
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.83
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.83
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.83
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.83
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.83
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.83
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.83
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.83
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.83
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.83
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.82
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.82
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.82
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.82
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.82
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.82
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.82
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.82
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.82
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.82
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.81
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 99.81
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.81
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 99.81
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.81
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.81
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.81
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 99.8
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.8
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.8
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.8
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.8
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.8
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.79
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 99.79
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 99.79
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 99.79
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.79
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.79
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.79
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.79
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.79
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 99.79
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.78
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.78
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 99.78
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.78
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.78
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.78
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.78
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.78
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 99.77
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 99.77
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 99.77
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.77
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.77
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 99.76
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 99.76
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 99.76
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 99.76
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 99.76
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.75
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 99.75
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 99.75
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 99.75
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.75
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.75
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 99.75
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.75
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 99.75
3sob_L237 Antibody light chain; beta propeller, protein bind 99.75
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 99.74
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 99.74
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.74
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.74
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.74
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.74
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 99.74
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 99.74
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 99.74
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 99.74
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 99.74
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 99.74
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 99.74
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 99.74
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 99.73
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 99.73
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.73
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 99.73
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 99.72
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 99.72
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.72
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 99.72
1nqb_A256 Single-chain antibody fragment; multivalent antibo 99.72
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 99.72
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.72
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 99.72
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 99.72
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 99.72
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.71
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.71
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 99.71
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.71
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 99.71
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 99.71
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 99.71
3sob_L237 Antibody light chain; beta propeller, protein bind 99.71
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 99.71
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.71
1mju_H227 Immunoglobulin MS6-12; catalytic antibody, ester h 99.7
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 99.7
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.7
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 99.7
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.7
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.7
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 99.7
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.7
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 99.7
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 99.7
1nqb_A256 Single-chain antibody fragment; multivalent antibo 99.7
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 99.7
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 99.7
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.7
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 99.7
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.7
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 99.69
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 99.69
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 99.69
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 99.69
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 99.69
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 99.69
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 99.69
3ux9_B256 SCFV antibody; five helices, long loop connecting 99.69
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 99.69
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 99.69
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 99.69
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.68
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 99.68
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 99.68
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 99.68
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 99.68
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 99.68
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 99.68
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 99.68
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 99.68
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 99.67
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 99.67
3ux9_B256 SCFV antibody; five helices, long loop connecting 99.67
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 99.67
4ei6_B245 Vbeta16 XV19 type II natural killer T cell recept 99.67
1dn0_B232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 99.67
3q5y_A240 TCR N15 beta; IG, T cell receptor, antigen peptide 99.67
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.67
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 99.67
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 99.66
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 99.66
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 99.66
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 99.66
3bae_H228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 99.66
3umt_A256 SCFV heavy chain and light chain; stability engine 99.66
1hxm_B242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 99.66
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 99.66
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 99.66
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 99.66
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 99.66
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 99.65
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 99.65
1mju_H227 Immunoglobulin MS6-12; catalytic antibody, ester h 99.65
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 99.65
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 99.65
3umt_A256 SCFV heavy chain and light chain; stability engine 99.65
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 99.65
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 99.64
4acp_A240 IG gamma-1 chain C region; immune system, antibody 99.64
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 99.64
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.64
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 99.64
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 99.64
1c5d_H215 Monoclonal antibody against the main immunogenic t 99.63
1l6x_A207 Immunoglobulin gamma-1 heavy chain constant regio; 99.63
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 99.63
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 99.63
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 99.63
2wbj_D279 OB TCR; transmembrane, immune response, T cell rec 99.63
3eow_R221 Poliovirus receptor; immunoglobulin super family, 99.63
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 99.63
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 99.63
3bae_H228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 99.62
2xqy_G261 A13-D6.3 monoclonal antibody, envelope glycoprotei 99.62
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 99.62
1dn0_B232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 99.62
1i1c_A239 IGG2A, IG gamma-2A chain C region; FC, immune syst 99.62
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 99.62
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 99.62
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 99.62
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 99.62
2w59_A231 IGY FCU3-4; immunoglobulin, avian, immune system; 99.61
3eow_R221 Poliovirus receptor; immunoglobulin super family, 99.61
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 99.61
3bn9_D257 E2 FAB heavy chain; antibody-protease complex, pro 99.61
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 99.6
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 99.59
1c5d_H215 Monoclonal antibody against the main immunogenic t 99.58
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 99.58
3q5y_A240 TCR N15 beta; IG, T cell receptor, antigen peptide 99.58
2xqy_G261 A13-D6.3 monoclonal antibody, envelope glycoprotei 99.58
4ei6_B245 Vbeta16 XV19 type II natural killer T cell recept 99.58
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 99.58
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 99.58
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 99.58
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 99.58
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 99.57
3liz_H253 4C3 monoclonal antibody heavy chain; hydrolase-imm 99.57
1waa_A93 Titin; metal binding protein, calmodulin-binding, 99.57
1hxm_B242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 99.57
4acp_A240 IG gamma-1 chain C region; immune system, antibody 99.57
2wbj_D279 OB TCR; transmembrane, immune response, T cell rec 99.57
3bn9_D257 E2 FAB heavy chain; antibody-protease complex, pro 99.56
1bec_A238 14.3.D T cell antigen receptor; T cell receptor; 1 99.56
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.56
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 99.56
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 99.56
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.56
2w59_A231 IGY FCU3-4; immunoglobulin, avian, immune system; 99.55
1l6x_A207 Immunoglobulin gamma-1 heavy chain constant regio; 99.55
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 99.54
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 99.54
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 99.54
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 99.54
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.54
3liz_H253 4C3 monoclonal antibody heavy chain; hydrolase-imm 99.54
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 99.53
1waa_A93 Titin; metal binding protein, calmodulin-binding, 99.53
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 99.53
3to4_D253 NKT vbeta2 (mouse variable domain, human constant; 99.53
1oga_E252 TRBC1, T-cell receptor beta chain C region; immune 99.53
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 99.53
1i1c_A239 IGG2A, IG gamma-2A chain C region; FC, immune syst 99.53
1ypz_F230 T-cell receptor gamma chain, beta-2-microglobulin; 99.52
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.52
1he7_A126 High affinity nerve growth factor receptor; transf 99.52
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 99.51
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 99.51
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 99.51
1wwb_X103 Protein (brain derived neurotrophic factor recepto 99.5
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 99.49
1ow0_A214 IG alpha-1 chain C region; IGA1, fcari, CD89, anti 99.48
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 99.48
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 99.48
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 99.48
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 99.48
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 99.48
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 99.48
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 99.47
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 99.47
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 99.47
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 99.47
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 99.47
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 99.46
3qhz_H232 Human monoclonal antibody DEL2D1, FAB heavy chain; 99.46
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 99.46
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 99.46
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 99.46
3tv3_H239 PGT128 heavy chain, IG gamma-1 chain C region; FAB 99.46
3tv3_H239 PGT128 heavy chain, IG gamma-1 chain C region; FAB 99.45
3qhz_H232 Human monoclonal antibody DEL2D1, FAB heavy chain; 99.45
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 99.44
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 99.44
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 99.44
1ypz_F230 T-cell receptor gamma chain, beta-2-microglobulin; 99.44
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 99.44
1bec_A238 14.3.D T cell antigen receptor; T cell receptor; 1 99.44
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 99.44
3u2s_H248 PG9 heavy chain; greek KEY, immunoglobulin, immune 99.44
3n9g_H230 FAB fragment of MAB CR4354, heavy chain; human neu 99.44
1ypz_E207 T cell receptor delta, beta-2-microglobulin; H2-T2 99.43
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 99.43
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 99.43
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 99.43
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 99.43
1oga_E252 TRBC1, T-cell receptor beta chain C region; immune 99.43
3to4_D253 NKT vbeta2 (mouse variable domain, human constant; 99.43
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 99.42
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 99.42
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 99.42
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 99.41
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 99.41
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 99.41
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 99.41
3u2s_H248 PG9 heavy chain; greek KEY, immunoglobulin, immune 99.41
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 99.41
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 99.41
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 99.41
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 99.4
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 99.4
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 99.4
3n9g_H230 FAB fragment of MAB CR4354, heavy chain; human neu 99.4
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 99.39
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 99.39
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 99.39
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 99.38
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 99.38
3iu4_H263 CHP3 FAB heavy chain; antibody, ganglioside, idiot 99.38
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 99.38
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 99.38
1iam_A185 ICAM-1, CD54, intercellular adhesion molecule-1; r 99.37
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 99.37
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 99.37
3iu4_H263 CHP3 FAB heavy chain; antibody, ganglioside, idiot 99.37
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 99.36
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 99.36
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 99.36
1ypz_E207 T cell receptor delta, beta-2-microglobulin; H2-T2 99.36
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 99.36
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 99.36
1he7_A126 High affinity nerve growth factor receptor; transf 99.36
3mlr_H226 Human monoclonal anti-HIV-1 GP120 V3 antibody 255 99.36
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 99.36
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 99.35
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 99.35
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 99.35
1iam_A185 ICAM-1, CD54, intercellular adhesion molecule-1; r 99.34
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 99.34
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 99.34
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 99.34
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 99.34
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 99.34
3sob_H256 Antibody heavy chain, low-density lipoprotein rece 99.34
3sob_H256 Antibody heavy chain, low-density lipoprotein rece 99.33
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 99.33
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 99.33
1ow0_A214 IG alpha-1 chain C region; IGA1, fcari, CD89, anti 99.33
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 99.33
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 99.33
1wwb_X103 Protein (brain derived neurotrophic factor recepto 99.33
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 99.33
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 99.32
3mlr_H226 Human monoclonal anti-HIV-1 GP120 V3 antibody 255 99.32
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 99.31
2v9t_A117 Roundabout homolog 1; structural protein-receptor 99.31
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 99.31
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 99.3
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 99.3
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 99.29
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 99.29
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 99.29
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 99.29
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=1.8e-73  Score=716.33  Aligned_cols=713  Identities=21%  Similarity=0.312  Sum_probs=539.2

Q ss_pred             cccceeecce-eEEeeCCeEEEEEEecCCCeeEEEEccCCCeeEEEee-CCCceeccCcEEEEecCCeEEEEEceeccCC
Q psy16863        135 APAFIRRLHD-IAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFSFRA-QGDHPIFGNRFRAINRDGRTELNIRRVRRDD  212 (1075)
Q Consensus       135 ~p~~~~~~~~-~~v~~G~~~~l~c~~~~~~~~~c~~~~~~~~~~~W~~-~~~~~~~~~~~~~~~~~~~~~L~I~~~~~~D  212 (1075)
                      +|.|+..+.+ +.+.+|++++|.|.+.          |.|.+.+.|++ +|..+....+......++  +|.|.+++.+|
T Consensus        38 ~P~~~~~p~~~~~~~~g~~~~l~C~a~----------g~p~p~~~W~k~~g~~~~~~~~~~~~~~~g--~l~i~~~~~~~  105 (816)
T 3dmk_A           38 GPVFLKEPTNRIDFSNSTGAEIECKAS----------GNPMPEIIWIRSDGTAVGDVPGLRQISSDG--KLVFPPFRAED  105 (816)
T ss_dssp             EEEEEECCCSEEEEETTTCEEEECEEE----------EESCCEEEEEETTSCBCCCBTTTBEECSTT--EEEECCCCGGG
T ss_pred             CCcEEeCCCCeEEEECCCCeEEEeeec----------CCCCCEEEEEeCCCCCccCCCceEEEeeCC--cEEEcCCChHH
Confidence            4677776665 5688899998777664          45678999999 565443333333445555  69999998887


Q ss_pred             ------CeEEEEEEEcCceeE-EEEEEEeeeccCCCCCccccccccceeeccceeEEEEEecCCCceEEEEecCCCeeeE
Q psy16863        213 ------GGRYSVTASNESGYS-TAKFELSVESQVPDAPAFIRRLHDIAVKVGTRARLLVEIRSPTEIKCQFDLNNTIPFS  285 (1075)
Q Consensus       213 ------~G~Y~C~a~n~~g~~-~~~~~l~V~~~~~~~p~~~~~~~~~~v~~g~~~~l~c~~~~~~~~~c~~~~~~~~~~~  285 (1075)
                            +|.|+|.|.|..|.. +..+.|.+.    .++.+...+.+..+.+|+.++|.|.+.+..       ......+.
T Consensus       106 ~~~~~d~G~Y~C~a~n~~G~~~S~~~~v~~~----~~~~~~~~~~~~~v~~G~~v~L~C~~~~~~-------~~~~~~v~  174 (816)
T 3dmk_A          106 YRQEVHAQVYACLARNQFGSIISRDVHVRAV----VAQYYEADVNKEHVIRGNSAVIKCLIPSFV-------ADFVEVVS  174 (816)
T ss_dssp             CCHHHHEEEEEEEEEETTEEEEEEEEEEEEE----CCCCCCCBCCCEEEETTSCEEECCBCCHHH-------HTTEEEEE
T ss_pred             ccccccceEEEEEEecCcceEEccceEEEEE----EccccEEEEecceEecCceEEEEECCCccc-------cccEEEEE
Confidence                  899999999999986 455555543    235566677778899999999999764211       01125677


Q ss_pred             EecCCCccc-----cCCCeEEEeeCCeEEEEEcccCCCCC-EEEEEEEEeCCee-EE---EEEEEEEecC-CCCCCeeee
Q psy16863        286 FRAQGDHPI-----FGNRFRAINRDGRTELNIRRVRRDDG-GRYSVTASNESGY-ST---AKFELSVESQ-VPDAPAFIR  354 (1075)
Q Consensus       286 w~~~~~~~~-----~~~~~~~~~~~~~~~L~I~~~~~~d~-G~Y~C~a~n~~g~-~~---~~~~l~V~~~-~~~~p~~~~  354 (1075)
                      |++++....     ...++.+..++   .|.|.+++.+|+ |.|+|.|.|..+. ..   ....+.|... ...+|.+..
T Consensus       175 W~~~~~~~~~~~~~~~~r~~~~~~g---~L~I~~v~~~D~~g~Y~C~~~~~~~~~~~~s~~~~~l~v~~~~~~~~P~i~~  251 (816)
T 3dmk_A          175 WHTDEEENYFPGAEYDGKYLVLPSG---ELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPISSAVPKVVS  251 (816)
T ss_dssp             EEETTSCEECBSSCBTTTEEECTTS---CEEESSCCGGGSSCEEEEEEEETTTCCEEECSBCEEEEEECCCSCCCCBCCG
T ss_pred             EEecCceEeccccCCCceEEEecCc---eEEEecCChhhccceeEEEEeeeeeeeeeecccccceEEeCCCCCCCCcccc
Confidence            887776543     24566554443   699999999998 9999999985432 11   1234555432 123455543


Q ss_pred             ec--CceeeccCCeEEEEEEEecCCCcEEEEEECCEec------CCCCcEEEEEcCCEEEEEEcccCCCCceeEEEEEEe
Q psy16863        355 RL--HDIAVKVGTRARLLVEIRSPTEIKIHWYRNDRKL------EENKIYRTQHDGNFYFIDLSSVSLFDSGRWTCLAEN  426 (1075)
Q Consensus       355 ~~--~~~~v~~G~~v~l~C~~~g~p~~~v~W~k~g~~l------~~~~~~~~~~~g~~~~L~I~~v~~~d~G~Y~C~a~n  426 (1075)
                      ..  ....+.+|+.+.|.|.+.|.|.+.|+|+|++...      ....+..  ..+.  .|.|.+++.+|+|.|+|.|.|
T Consensus       252 ~~~~~~~~v~~g~~v~L~C~~~g~p~p~v~W~k~~~~~~~~~~~~~~~~~~--~~~~--~L~i~~v~~~D~G~Y~C~a~n  327 (816)
T 3dmk_A          252 LAKFDMKTYSGSSTMALLCPAQGYPVPVFRWYKFIEGTTRKQAVVLNDRVK--QVSG--TLIIKDAVVEDSGKYLCVVNN  327 (816)
T ss_dssp             GGGEEEEEECTTSCEEECCCCBCSSCCEEEEEEECTTSSCEEECCCSSSEE--EETT--EEEECSCCGGGCEEEEEEEEC
T ss_pred             ccCccceEEeCCCeEEEEEEeeecCCCeEEEEeCCCCCccCcceecCCceE--eccc--eEEECCCCHhHCEEEEEEEEc
Confidence            22  4567899999999999999999999999965322      2223322  1222  589999999999999999999


Q ss_pred             CCCceeeEEEEEeecCCCCCCCeeeeecceEEecCCeEEEEEEEECCCCCeEEEEeCCEeccCCCEEEEEeCCCCCCCcE
Q psy16863        427 AVGRSHCSCELSVLVPKAYKAPFFTKELEAILTEQGTVSLECKVMGIPTPQLIWYKDNKKIKAGDIFALTANPKDPSSLG  506 (1075)
Q Consensus       427 ~~g~~~~s~~l~V~~~~~~~~p~~~~~~~~~~~~g~~v~l~C~~~g~p~~~v~W~~~g~~l~~~~~~~l~i~~~~~~d~G  506 (1075)
                      ..|.....+.|.|..++.    ....+....+.+|+++.|.|.+.|.|.+.++|+|+|..+..+. ..|.|..+..+|+|
T Consensus       328 ~~g~~~~~~~l~V~~~~~----~~~~~~~~~v~~G~~v~l~C~~~g~p~~~v~W~k~g~~~~~~~-~~L~i~~v~~~d~G  402 (816)
T 3dmk_A          328 SVGGESVETVLTVTAPLS----AKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSE-SVLRIESVKKEDKG  402 (816)
T ss_dssp             SSCEEEEEEEEEECEEEE----EEEESSEEECCTTSCEEEEEEEEEECCCEEEEEETTEECSCCS-SEEEESSCCGGGCE
T ss_pred             CCCceEEEEEEEEcCCCc----eeeCCCceEecCCCCEEEEEEEeccCCCEEEEEECCEECCCCC-CEEEEcCCCHHHCE
Confidence            999888788888875432    1222333447899999999999999999999999999997654 46999999999999


Q ss_pred             EEEEEEEecceeeEEEEEEEEeccccccCCCCCCcCCCCCCCCCCeeeeeccceEeecCCeEEEEEEEecCCCCceEEEE
Q psy16863        507 TYTCEAVNCMGAAFSTSRVIARGQQSFLDNDDVPFNSLMPPGPAPIFIKEVENVKAKIGTSAILECQVLVPPWPRSIYWY  586 (1075)
Q Consensus       507 ~Y~C~a~n~~g~~~~~~~v~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~G~~~~L~C~~~~~p~p~~v~W~  586 (1075)
                      .|+|.|.|..|....+..+.|..                 ...+|.+...+....+.+|+.++|.|.+.+.|.| .+.|+
T Consensus       403 ~Y~C~a~n~~g~~~~~~~l~v~~-----------------~~~~p~i~~~~~~~~v~~G~~v~L~C~~~g~p~p-~v~W~  464 (816)
T 3dmk_A          403 MYQCFVRNDRESAEASAELKLGG-----------------RFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTP-EISWE  464 (816)
T ss_dssp             EEEEEEECSSCEEEECCEEECCC-----------------SSCCCEEEEECCCEEECSSSCEEEEEEEECSSCC-EEEEE
T ss_pred             EEEEEEECCCCcEEEEEEEEEcc-----------------ccCCCceEecCcceEEcCCCCEEEEEEEecCCCC-EEEEE
Confidence            99999999999887777776642                 1246677777788889999999999999999987 89999


Q ss_pred             eCCeEEecCCcEEEE----EcCCceEEEEEeeeeecCCceEEEEEECCCCceeeeeEEEEEeCCCCcCCCceeeccceee
Q psy16863        587 NKEGVVEASDKYHIM----ADGLGGYSIEINYLEAVDDGEWKCVATSSSGVKQFSAAYVHVLMPKNYRKPRFVESLKAVM  662 (1075)
Q Consensus       587 ~~~~~i~~~~~~~~~----~~~~~~~~L~i~~~~~~d~G~Y~C~a~n~~g~~~~~~~~l~v~~p~~~~~p~~~~~~~~~~  662 (1075)
                      +++..+..+.++...    .++.....|.|.++..+|+|.|+|.|.|..|... ....+.|..++     .+.......+
T Consensus       465 ~~g~~l~~~~~~~~~~~~~~~~~~~~~L~i~~v~~~d~G~Y~C~a~n~~g~~~-~~~~l~V~~~p-----~~~~~~~~~v  538 (816)
T 3dmk_A          465 LDGKKIANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAE-HSAKLNVYGLP-----YIRQMEKKAI  538 (816)
T ss_dssp             ETTEECCSCTTEEEEEEECTTSCEEEEEEESSCCTTTCEEEEEEEEETTEEEE-EEEEEEECSSC-----EECCCCCEEE
T ss_pred             ECCEECCCCCCcccccEEecCCCcEEEEEEeeccccCCEEEEEEEEECCCeEE-EEEEEEEecCC-----eeEccCCeEE
Confidence            999998877776542    2333445799999999999999999999998865 34567776553     2222233456


Q ss_pred             ecCCeEEEEEEEecCCCCeEEEEECCEEcCCCCe--------EEEee---cCCCceEEEEEEecCceE-EEEEEEEEEec
Q psy16863        663 TDDGLVSFECKVVGFPTPTLQWFKDNEELKPGDV--------YQLTG---TSSLGSYCCVAKNVMGKA-ESSTQLTIEDI  730 (1075)
Q Consensus       663 ~~g~~~~l~C~v~g~p~p~v~W~k~g~~l~~~~~--------~~~~~---~~d~G~Y~C~a~N~~g~~-~~~~~l~V~~~  730 (1075)
                      ..|+.+.|.|.+.|.|.+.+.|+|+|..+..+.+        +.+..   .+|+|.|+|.|.|..|.. ...+.+.|.. 
T Consensus       539 ~~G~~v~l~C~~~g~p~~~i~W~k~~~~l~~~~~~~~~~~~~l~i~~v~~~~d~G~Y~C~a~n~~g~~~~~~~~v~v~~-  617 (816)
T 3dmk_A          539 VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQEGYSARGSLEVQVMV-  617 (816)
T ss_dssp             ETTCCEEEECCEECSSEEEEEEEETTEESCCSTTEEECTTSEEEESSCCHHHHCEEEEEEEEESSSCEEEEEEEEEEEC-
T ss_pred             ecCCeEEEEEEecCCCCCEEEEEECCeEcccCCceEEecCCeEEEEecCccccCEEEEEEEEECCCceeeeeEEEEEec-
Confidence            7899999999999999999999999998865443        33433   258999999999999954 3456666653 


Q ss_pred             cccCchhhhhhhccCCCCCeEEe-ccceeeeecCCeEEEEEEEecCCCC-eEEEEECCEEeecCCcEEEEEeeCcEEEEE
Q psy16863        731 RNHLSEEDKLLLLTNNKAPKFIE-GLKSCQATVNEEFKFTVQVSISPEP-KVSWFRDDQQVVESDNVKILKETLGVCHLK  808 (1075)
Q Consensus       731 ~~~~~~~~~~~~~~~~~~p~~~~-~~~~~~~~~g~~~~l~C~v~g~p~p-~v~W~k~g~~i~~~~~~~~~~~~~~~~~L~  808 (1075)
                                       +|.+.. ......+..|+.+.|.|.+.+.|.| .|+|+|+|+++..+.++.+.........|.
T Consensus       618 -----------------~p~~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~i~W~~~g~~l~~~~~~~~~~~~~~~~~L~  680 (816)
T 3dmk_A          618 -----------------LPRIIPFAFEEGPAQVGQYLTLHCSVPGGDLPLNIDWTLDGQAISEDLGITTSRVGRRGSVLT  680 (816)
T ss_dssp             -----------------CCCCBCCCCCSSCEESSCEEEEEEBCCCSSSCCEEEEEETTBCCCGGGTCEEEEETTTEEEEE
T ss_pred             -----------------CCccccccccccccCCCCeEEEEEEEeCCCCCCEEEEEECCeEcCCCCCeeEEEcCCCeeEEE
Confidence                             343332 2345568899999999999876654 999999999998777776665555678999


Q ss_pred             EccccCCCCeEEEEEEEeCCceEEEEEEEEEEecCCCCCCeeeeecc-eeecCCCeEEEEEEEEccCCCeeEEEECCEEc
Q psy16863        809 IHALEVADQAEWKCIATNDFGQSITSCFLKLNVPKHYKKPKFLEELK-AVLSEGGAVNLECKVIGVPQPTLKWFKDGREL  887 (1075)
Q Consensus       809 I~~~~~~D~G~Y~C~A~N~~G~~~~s~~l~V~~~~~~~~p~~~~~~~-~~~~~g~~~~L~C~v~g~p~p~v~W~k~g~~l  887 (1075)
                      |.+++.+|+|.|+|.|.|..|....++.|.|..||.     +...+. ..+.+|+.++|.|.+.|.|.|.|+|+|+|..+
T Consensus       681 i~~v~~~d~G~Y~C~a~N~~g~~~~~~~l~V~~~P~-----~~~~~~~~~v~~G~~v~l~C~~~g~P~p~i~W~k~~~~~  755 (816)
T 3dmk_A          681 IEAVEASHAGNFTCHARNLAGHQQFTTPLNVYVPPR-----WILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDT  755 (816)
T ss_dssp             EESCCGGGCEEEEEEEECSSCEEEEEEEECEEEEEE-----EEECCCCEEEETTCCEEEECEEEEESCCEEECCEECSSS
T ss_pred             EccCChhhCEEEEEEEEeCCccEEEEEEEEEEeCCc-----eeeecccceecCCCcEEEEEEEecCCCCeEEEEecCCCC
Confidence            999999999999999999999999999999987653     333333 34778999999999999999999999987544


Q ss_pred             CC-------CCe-----eEEEECCCCceeeEEEEEEEEeCCeeEEEEEEEEEec
Q psy16863        888 KA-------GDI-----HKIISGEDGTCCLGIYTCEAHNCMGTTSSSAALLGFE  929 (1075)
Q Consensus       888 ~~-------~~~-----~~i~~~~~~~~d~G~Y~C~a~N~~G~~~~~~~l~v~~  929 (1075)
                      ..       +..     ..|.+......|+|.|+|.|.|.+|++.+++.+..+.
T Consensus       756 ~~~~~~~~~~~~~~~~~~~L~i~~v~~~d~G~Y~C~a~N~~G~~~~~v~~~~~~  809 (816)
T 3dmk_A          756 PGEYKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQ  809 (816)
T ss_dssp             TTCCBCCCCBTTEEEETTEEEECSCCGGGCEEEEEEEECSSSSCEEEEEEEEEE
T ss_pred             CccccccccCCCEEecCCEEEECcCChhhCeEEEEEEEeCCCCCcEEEEEEEee
Confidence            32       111     1467777888999999999999999999999887654



>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E Back     alignment and structure
>1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... Back     alignment and structure
>3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... Back     alignment and structure
>3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* Back     alignment and structure
>3n9g_H FAB fragment of MAB CR4354, heavy chain; human neutralizing antibody, immun anti-WEST NIle virus; 1.43A {Homo sapiens} PDB: 3iyw_H 3qeh_A 3sqo_H 4hk0_A 4hk3_J 4hkx_A* 3u0t_D 3c08_H 3lmj_H 3lqa_H* 3c09_H* 4dn3_H 3pp4_H 3pp3_H 4hkb_J 2jb5_H* 2jb6_B* 2eh7_H 2eh8_H 3jwd_H* ... Back     alignment and structure
>1ypz_E T cell receptor delta, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... Back     alignment and structure
>3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n9g_H FAB fragment of MAB CR4354, heavy chain; human neutralizing antibody, immun anti-WEST NIle virus; 1.43A {Homo sapiens} PDB: 3iyw_H 3qeh_A 3sqo_H 4hk0_A 4hk3_J 4hkx_A* 3u0t_D 3c08_H 3lmj_H 3lqa_H* 3c09_H* 4dn3_H 3pp4_H 3pp3_H 4hkb_J 2jb5_H* 2jb6_B* 2eh7_H 2eh8_H 3jwd_H* ... Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Back     alignment and structure
>1iam_A ICAM-1, CD54, intercellular adhesion molecule-1; rhinovirus receptor, cell adhesion, integrin ligand, glycopr LFA-1 ligand, immunoglobulin fold; HET: NAG; 2.10A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ic1_A* 1d3l_A 1d3e_I 1d3i_I 3tcx_A Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ypz_E T cell receptor delta, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>3mlr_H Human monoclonal anti-HIV-1 GP120 V3 antibody 255 heavy chain; human monoclonal antibody, FAB, third variable antibody-antigen interaction; 1.80A {Homo sapiens} PDB: 3mls_H 3mlt_H 3mlu_H 3mlv_H Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iam_A ICAM-1, CD54, intercellular adhesion molecule-1; rhinovirus receptor, cell adhesion, integrin ligand, glycopr LFA-1 ligand, immunoglobulin fold; HET: NAG; 2.10A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ic1_A* 1d3l_A 1d3e_I 1d3i_I 3tcx_A Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3sob_H Antibody heavy chain, low-density lipoprotein receptor-related protein; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_B 3uls_H 3ulu_D* 3ulv_D* Back     alignment and structure
>3sob_H Antibody heavy chain, low-density lipoprotein receptor-related protein; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_B 3uls_H 3ulu_D* 3ulv_D* Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>3mlr_H Human monoclonal anti-HIV-1 GP120 V3 antibody 255 heavy chain; human monoclonal antibody, FAB, third variable antibody-antigen interaction; 1.80A {Homo sapiens} PDB: 3mls_H 3mlt_H 3mlu_H 3mlv_H Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1075
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 2e-15
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 2e-13
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 4e-12
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 1e-11
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 4e-11
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 4e-11
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 5e-11
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 3e-10
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 2e-06
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 9e-04
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 8e-15
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 1e-12
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 1e-12
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 7e-12
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 2e-11
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 2e-09
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 1e-06
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 1e-06
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 1e-05
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 2e-04
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 9e-14
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 3e-13
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 5e-12
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 3e-10
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 7e-10
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 3e-09
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 5e-09
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 5e-09
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 3e-13
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 4e-10
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 4e-10
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 5e-10
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 5e-10
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 6e-10
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 2e-08
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 4e-08
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 2e-04
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 5e-13
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 7e-11
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 7e-11
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 1e-10
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 3e-10
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 9e-10
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 3e-08
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 1e-07
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 8e-05
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 1e-11
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 5e-11
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 8e-11
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 1e-10
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 1e-09
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 4e-08
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 9e-08
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 9e-08
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 2e-04
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 4e-04
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 2e-11
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 1e-10
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 2e-10
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 6e-10
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 9e-09
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 2e-08
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 2e-08
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 1e-07
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 7e-04
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 3e-11
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 6e-09
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 5e-08
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 2e-07
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 7e-07
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 7e-07
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 2e-06
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 3e-06
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 0.001
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 6e-11
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 8e-10
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 2e-08
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 7e-08
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 1e-05
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 2e-05
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 1e-10
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 2e-07
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 2e-07
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 1e-06
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 1e-06
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 4e-06
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 2e-05
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 4e-10
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 4e-07
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 6e-06
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 2e-05
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 2e-05
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 2e-04
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 4e-10
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 4e-10
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 4e-07
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 4e-07
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 1e-06
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 5e-06
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 3e-04
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 3e-04
d2aw2a1104 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator 5e-10
d2aw2a1104 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator 4e-08
d2aw2a1104 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator 3e-06
d2aw2a1104 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator 6e-04
d2aw2a1104 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator 0.001
d2aw2a1104 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator 0.002
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 5e-10
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 2e-09
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 2e-07
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 9e-07
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 9e-07
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 4e-05
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 7e-04
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 0.002
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 3e-09
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 6e-09
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 4e-08
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 4e-07
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 2e-06
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 2e-06
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 3e-06
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 6e-05
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 4e-09
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 4e-09
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 2e-07
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 2e-06
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 1e-05
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 1e-05
d1rhfa285 b.1.1.4 (A:98-182) Tyrosine-protein kinase recepto 5e-09
d1rhfa285 b.1.1.4 (A:98-182) Tyrosine-protein kinase recepto 2e-06
d1rhfa285 b.1.1.4 (A:98-182) Tyrosine-protein kinase recepto 7e-06
d1rhfa285 b.1.1.4 (A:98-182) Tyrosine-protein kinase recepto 3e-05
d1rhfa285 b.1.1.4 (A:98-182) Tyrosine-protein kinase recepto 2e-04
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 5e-09
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 6e-08
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 3e-06
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 3e-06
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 1e-05
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 8e-05
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 2e-04
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 2e-04
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 6e-09
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 1e-08
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 2e-07
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 2e-07
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 5e-07
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 7e-07
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 5e-06
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 5e-06
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 0.001
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 7e-09
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 8e-07
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 8e-06
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 1e-05
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 1e-05
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 1e-05
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 2e-05
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 9e-04
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 2e-08
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 4e-08
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 6e-08
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 8e-08
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 1e-07
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 2e-07
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 2e-07
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 3e-07
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 4e-04
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 3e-08
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 3e-08
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 5e-07
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 7e-07
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 2e-05
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 7e-05
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 1e-04
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 5e-04
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 4e-08
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 6e-08
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 2e-07
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 2e-06
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 1e-05
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 7e-05
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 7e-05
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 5e-04
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 5e-08
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 6e-08
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 8e-08
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 3e-07
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 6e-06
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 3e-05
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 8e-05
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 8e-05
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 4e-04
d2ifga192 b.1.1.4 (A:192-283) High affinity nerve growth fac 5e-08
d2ifga192 b.1.1.4 (A:192-283) High affinity nerve growth fac 5e-06
d2ifga192 b.1.1.4 (A:192-283) High affinity nerve growth fac 8e-05
d2ifga192 b.1.1.4 (A:192-283) High affinity nerve growth fac 3e-04
d2ifga192 b.1.1.4 (A:192-283) High affinity nerve growth fac 0.004
d2ifga192 b.1.1.4 (A:192-283) High affinity nerve growth fac 0.004
d1tiua_89 b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re 7e-08
d1tiua_89 b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re 1e-05
d1tiua_89 b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re 6e-05
d1tiua_89 b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re 0.001
d1tiua_89 b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re 0.001
d1tiua_89 b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re 0.003
d1tiua_89 b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re 0.004
d1zxqa1106 b.1.1.3 (A:87-192) Intercellular cell adhesion mol 8e-08
d1zxqa1106 b.1.1.3 (A:87-192) Intercellular cell adhesion mol 1e-07
d1zxqa1106 b.1.1.3 (A:87-192) Intercellular cell adhesion mol 4e-06
d1nbqa2104 b.1.1.4 (A:130-233) Junction adhesion molecule, JA 8e-08
d1nbqa2104 b.1.1.4 (A:130-233) Junction adhesion molecule, JA 4e-07
d1nbqa2104 b.1.1.4 (A:130-233) Junction adhesion molecule, JA 8e-07
d1nbqa2104 b.1.1.4 (A:130-233) Junction adhesion molecule, JA 2e-04
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 9e-08
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 1e-07
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 1e-06
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 1e-05
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 1e-05
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 2e-05
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 2e-05
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 6e-05
d2oz4a384 b.1.1.4 (A:367-450) Intercellular adhesion molecul 1e-07
d2oz4a384 b.1.1.4 (A:367-450) Intercellular adhesion molecul 3e-07
d2oz4a384 b.1.1.4 (A:367-450) Intercellular adhesion molecul 2e-06
d2oz4a384 b.1.1.4 (A:367-450) Intercellular adhesion molecul 1e-04
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 3e-07
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 4e-07
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 3e-06
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 5e-06
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 2e-05
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 2e-05
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 4e-05
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 0.004
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 5e-07
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 2e-06
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 4e-06
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 2e-05
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 2e-05
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 3e-05
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 5e-05
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 9e-05
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 7e-07
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 1e-06
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 2e-06
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 1e-04
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 0.002
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 2e-06
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 3e-06
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 1e-05
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 1e-05
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 1e-05
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 4e-05
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 4e-05
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 6e-05
d1wwbx_103 b.1.1.4 (X:) Ligand binding domain of trkB recepto 3e-06
d1wwbx_103 b.1.1.4 (X:) Ligand binding domain of trkB recepto 3e-05
d1wwbx_103 b.1.1.4 (X:) Ligand binding domain of trkB recepto 2e-04
d1wwbx_103 b.1.1.4 (X:) Ligand binding domain of trkB recepto 5e-04
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 5e-06
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 5e-06
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 5e-06
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 2e-05
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 2e-04
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 0.001
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 6e-06
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 2e-04
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 0.002
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 0.002
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 0.003
d1ccza193 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-ter 6e-06
d1ccza193 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-ter 2e-05
d1ccza193 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-ter 2e-05
d1pkoa_126 b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( 9e-06
d1pkoa_126 b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( 1e-05
d1pkoa_126 b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( 2e-04
d1pkoa_126 b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( 3e-04
d1pkoa_126 b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( 3e-04
d1f97a1102 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM 1e-05
d1f97a1102 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM 1e-05
d1f97a1102 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM 8e-04
d1f97a1102 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM 0.001
d1iray3107 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor 2e-05
d1iray3107 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor 2e-05
d1iray3107 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor 3e-05
d1iray3107 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor 3e-05
d1iray3107 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor 0.001
d1iray3107 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor 0.002
d1epfa197 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NC 3e-05
d1n26a193 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai 6e-05
d1n26a193 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai 0.002
d1n26a193 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai 0.004
d1iama1103 b.1.1.3 (A:83-185) Intercellular cell adhesion mol 6e-05
d1iama1103 b.1.1.3 (A:83-185) Intercellular cell adhesion mol 1e-04
d1iama1103 b.1.1.3 (A:83-185) Intercellular cell adhesion mol 7e-04
d1iray2103 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor 9e-05
d1iray1101 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H 2e-04
d2fcba288 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (C 0.001
d2fcba288 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (C 0.003
d1fnla289 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (C 0.001
d1fnla289 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (C 0.002
d1olza192 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain { 0.002
d1nbqa1105 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM 0.002
d1nbqa1105 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM 0.004
d1cs6a2105 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gall 0.002
d1cs6a2105 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gall 0.003
d1dr9a1105 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human ( 0.004
d1l6za296 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, 0.004
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Immunoglobulin
family: I set domains
domain: Telokin
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 70.6 bits (172), Expect = 2e-15
 Identities = 18/93 (19%), Positives = 39/93 (41%)

Query: 350 PAFIRRLHDIAVKVGTRARLLVEIRSPTEIKIHWYRNDRKLEENKIYRTQHDGNFYFIDL 409
           P  I+   D  V+ G    L  ++     I   W +  ++++E++  + ++  N   + +
Sbjct: 1   PQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTI 60

Query: 410 SSVSLFDSGRWTCLAENAVGRSHCSCELSVLVP 442
            +      G +T L EN +G       L+V+  
Sbjct: 61  LAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK 93


>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 97 Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 105 Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 105 Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1075
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.74
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.72
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.68
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.67
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.67
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.63
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.62
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.61
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.61
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.59
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.58
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.58
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.58
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.56
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.55
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.53
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.51
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.5
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.5
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.5
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.49
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.49
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.49
d2avga1110 Cardiac myosin binding protein C, different domain 99.48
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.47
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.47
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.47
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.46
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.46
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.46
d1pd6a_94 Cardiac myosin binding protein C, different domain 99.45
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.45
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.45
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.44
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.44
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 99.44
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.44
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.44
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.44
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.43
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 99.43
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.43
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 99.42
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.42
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.41
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 99.41
d1gxea_130 Cardiac myosin binding protein C, different domain 99.39
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.37
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 99.37
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.37
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.36
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.36
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.36
d1pd6a_94 Cardiac myosin binding protein C, different domain 99.36
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 99.35
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 99.35
d2avga1110 Cardiac myosin binding protein C, different domain 99.35
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.35
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 99.35
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.34
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.34
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.34
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.33
d1gxea_130 Cardiac myosin binding protein C, different domain 99.33
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.33
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.33
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.33
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 99.33
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.32
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.31
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.31
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.3
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.3
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.3
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 99.29
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 99.28
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.27
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 99.26
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.25
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 99.25
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 99.25
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.24
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.24
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 99.23
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 99.23
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 99.22
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 99.22
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.21
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 99.21
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 99.2
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.2
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.19
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.17
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.15
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 99.14
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 99.13
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 99.13
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.12
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 99.11
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.1
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 99.07
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 99.07
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 99.06
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.06
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.03
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.03
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.03
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.01
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 98.99
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.99
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.95
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 98.93
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 98.91
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 98.78
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.77
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 98.76
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 98.66
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 98.61
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 98.49
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 98.41
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 98.29
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 98.27
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.26
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 98.22
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 98.21
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 98.15
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 98.11
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 98.09
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 98.09
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.07
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 98.06
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 98.05
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 98.02
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 98.01
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 98.01
d1ospl1107 Immunoglobulin light chain kappa variable domain, 98.0
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 97.99
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.98
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 97.98
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 97.97
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 97.97
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 97.96
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 97.96
d1jhll_108 Immunoglobulin light chain kappa variable domain, 97.95
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.94
d1op3k1106 Immunoglobulin light chain kappa variable domain, 97.94
d1mexl1107 Immunoglobulin light chain kappa variable domain, 97.94
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 97.94
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 97.93
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 97.93
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 97.92
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 97.91
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 97.91
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 97.91
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 97.91
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.91
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 97.89
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 97.89
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 97.88
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 97.88
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 97.88
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 97.87
d2rhea_114 Immunoglobulin light chain lambda variable domain, 97.87
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 97.87
d1d5il1107 Immunoglobulin light chain kappa variable domain, 97.87
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 97.87
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 97.87
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 97.86
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 97.86
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 97.86
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.85
d1jhll_108 Immunoglobulin light chain kappa variable domain, 97.84
d8faba1103 Immunoglobulin light chain lambda variable domain, 97.83
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 97.81
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 97.81
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 97.81
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 97.8
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.8
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 97.8
d1ospl1107 Immunoglobulin light chain kappa variable domain, 97.8
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 97.8
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 97.8
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 97.79
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.79
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 97.79
d1w72l1109 Immunoglobulin light chain lambda variable domain, 97.77
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 97.77
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 97.77
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 97.76
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 97.76
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.75
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 97.74
d2gsia1111 Immunoglobulin light chain kappa variable domain, 97.74
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 97.74
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.74
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.73
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 97.73
d1mexl1107 Immunoglobulin light chain kappa variable domain, 97.73
d1lgva1112 Immunoglobulin light chain lambda variable domain, 97.72
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 97.72
d1oaql_110 Immunoglobulin light chain lambda variable domain, 97.71
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 97.71
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 97.71
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 97.7
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 97.7
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.7
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 97.7
d1j05a_111 Immunoglobulin light chain kappa variable domain, 97.7
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 97.7
d1nfde1108 Immunoglobulin light chain lambda variable domain, 97.69
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 97.69
d1mjul1112 Immunoglobulin light chain kappa variable domain, 97.69
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 97.69
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 97.68
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 97.68
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 97.67
d1d5il1107 Immunoglobulin light chain kappa variable domain, 97.66
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 97.65
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 97.65
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 97.62
d1op3k1106 Immunoglobulin light chain kappa variable domain, 97.62
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 97.62
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 97.62
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 97.61
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 97.6
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 97.6
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 97.6
d1hdmb198 Class II MHC beta chain, C-terminal domain {Human 97.6
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 97.6
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 97.59
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.59
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 97.59
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 97.58
d1d5mb198 Class II MHC beta chain, C-terminal domain {Human 97.57
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 97.57
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.55
d1fnga1101 Class II MHC alpha chain, C-terminal domain {Mouse 97.55
d1de4a194 Hemochromatosis protein Hfe, alpha-3 domain {Human 97.54
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 97.54
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 97.54
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 97.54
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 97.53
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 97.52
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 97.52
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 97.52
d1uvqa199 Class II MHC alpha chain, C-terminal domain {Human 97.52
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 97.52
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 97.52
d1j05a_111 Immunoglobulin light chain kappa variable domain, 97.51
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 97.51
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 97.49
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 97.48
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 97.48
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.48
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 97.46
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 97.46
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 97.46
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 97.46
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 97.45
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 97.45
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 97.44
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.43
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 97.43
d1fp5a2105 Immunoglobulin heavy chain epsilon constant domain 97.43
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 97.43
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 97.42
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 97.42
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 97.41
d1t7va194 Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu 97.41
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 97.41
d3frua191 Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor 97.41
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.4
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.39
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 97.38
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.38
d1q0xl2102 Immunoglobulin light chain lambda constant domain, 97.37
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.37
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 97.36
d8faba1103 Immunoglobulin light chain lambda variable domain, 97.36
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 97.36
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 97.35
d2gsia1111 Immunoglobulin light chain kappa variable domain, 97.35
d1mjul1112 Immunoglobulin light chain kappa variable domain, 97.34
d1oaql_110 Immunoglobulin light chain lambda variable domain, 97.34
d1hdma1103 Class II MHC alpha chain, C-terminal domain {Human 97.32
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.31
d1w72l1109 Immunoglobulin light chain lambda variable domain, 97.31
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 97.31
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.3
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 97.3
d2rhea_114 Immunoglobulin light chain lambda variable domain, 97.3
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 97.3
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 97.28
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 97.28
d1lgva1112 Immunoglobulin light chain lambda variable domain, 97.27
d1rzfl2102 Immunoglobulin light chain lambda constant domain, 97.27
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 97.26
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.26
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 97.25
d1uvqb197 Class II MHC beta chain, C-terminal domain {Human 97.24
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 97.24
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.23
d1o0va1104 Immunoglobulin heavy chain epsilon constant domain 97.23
d2mhaa189 Class I MHC, alpha-3 domain {Mouse (Mus musculus) 97.21
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 97.21
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.2
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.2
d1k5na195 Class I MHC, alpha-3 domain {Human (Homo sapiens) 97.2
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 97.19
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 97.18
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 97.18
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 97.17
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 97.17
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 97.16
d1de4a194 Hemochromatosis protein Hfe, alpha-3 domain {Human 97.16
d1fltx_95 Second domain of the Flt-1 receptor {Human (Homo s 97.13
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.13
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 97.11
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 97.11
d1q0xl2102 Immunoglobulin light chain lambda constant domain, 97.1
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.09
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.07
d1t7va194 Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu 97.07
d1nfde1108 Immunoglobulin light chain lambda variable domain, 97.07
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 97.06
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.05
d1kcvh2101 Immunoglobulin heavy chain gamma constant domain 1 97.04
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.04
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 97.04
d1jpth1117 Immunoglobulin heavy chain variable domain, VH {En 97.03
d1kxvc_119 Camelid IG heavy chain variable domain, VHh {Camel 97.02
d1mfah1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.02
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 97.01
d1l6xa2102 Immunoglobulin heavy chain gamma constant domain 3 97.01
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 97.0
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 96.98
d1fp5a2105 Immunoglobulin heavy chain epsilon constant domain 96.98
d1pg7x1120 Immunoglobulin heavy chain variable domain, VH {Mo 96.98
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 96.97
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 96.97
d1mjul2107 Immunoglobulin light chain kappa constant domain, 96.96
d2jelh1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.96
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 96.96
d1hyrc194 Class I MHC homolog, alpha-3 domain {Human (Homo s 96.96
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 96.96
d7fabh1116 Immunoglobulin heavy chain variable domain, VH {Hu 96.96
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 96.95
d2h26a196 CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T 96.94
d1fnga1101 Class II MHC alpha chain, C-terminal domain {Mouse 96.94
d1eapb1119 Immunoglobulin heavy chain variable domain, VH {Mo 96.94
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 96.94
d1o0va1104 Immunoglobulin heavy chain epsilon constant domain 96.93
d1jnhb1117 Immunoglobulin heavy chain variable domain, VH {Mo 96.92
d1nlbh1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.92
d1f3dh1115 Immunoglobulin heavy chain variable domain, VH {Mo 96.92
d1kxvc_119 Camelid IG heavy chain variable domain, VHh {Camel 96.91
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 96.9
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 96.9
d1mjuh2102 Immunoglobulin heavy chain gamma constant domain 1 96.9
d1c5db1117 Immunoglobulin heavy chain variable domain, VH {Ra 96.89
d1hxmb2107 T-cell antigen receptor {Human (Homo sapiens), del 96.89
d1cqka_101 Immunoglobulin heavy chain gamma constant domain 3 96.89
d1ow0a2108 Immunoglobulin heavy chain alpha constant domain 3 96.88
d1ow0a2108 Immunoglobulin heavy chain alpha constant domain 3 96.88
d1nlbh1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.88
d1hdmb198 Class II MHC beta chain, C-terminal domain {Human 96.86
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.85
d1rzfl2102 Immunoglobulin light chain lambda constant domain, 96.84
d1a2yb_116 Immunoglobulin heavy chain variable domain, VH {Mo 96.83
d1l6xa2102 Immunoglobulin heavy chain gamma constant domain 3 96.82
d2nxyd1128 Immunoglobulin heavy chain variable domain, VH {Hu 96.82
d1mjuh1116 Immunoglobulin heavy chain variable domain, VH {Mo 96.82
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 96.81
d1dlfh_120 Immunoglobulin heavy chain variable domain, VH {Mo 96.81
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 96.81
d1indh1114 Immunoglobulin heavy chain variable domain, VH {Mo 96.81
d1i1ca2102 Immunoglobulin heavy chain gamma constant domain 3 96.8
d1hdma1103 Class II MHC alpha chain, C-terminal domain {Human 96.8
d1n0xh1127 Immunoglobulin heavy chain variable domain, VH {Hu 96.8
d1rhhb1130 Immunoglobulin heavy chain variable domain, VH {Hu 96.79
d1zvya1124 Camelid IG heavy chain variable domain, VHh {Camel 96.79
d1lmka1126 Immunoglobulin heavy chain variable domain, VH {Mo 96.79
d1j05b_121 Immunoglobulin heavy chain variable domain, VH {Mo 96.77
d1qnzh_119 Immunoglobulin heavy chain variable domain, VH {Mo 96.77
d1rihh1125 Immunoglobulin heavy chain variable domain, VH {Mo 96.77
d7fabh1116 Immunoglobulin heavy chain variable domain, VH {Hu 96.76
d1hxma286 T-cell antigen receptor {Human (Homo sapiens), gam 96.76
d3frua191 Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor 96.76
d1oari_103 Immunoglobulin heavy chain variable domain, VH {Ra 96.76
d1uvqa199 Class II MHC alpha chain, C-terminal domain {Human 96.76
d1rz7h1119 Immunoglobulin heavy chain variable domain, VH {Hu 96.75
d1ct8b1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.74
d1dn0b2105 Immunoglobulin heavy chain mu constant domain 1, C 96.74
d1eapb1119 Immunoglobulin heavy chain variable domain, VH {Mo 96.74
d1cqka_101 Immunoglobulin heavy chain gamma constant domain 3 96.74
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.74
d1oari_103 Immunoglobulin heavy chain variable domain, VH {Ra 96.73
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 96.73
d2p49b1121 Camelid IG heavy chain variable domain, VHh {Camel 96.73
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 96.72
d1rz7h1119 Immunoglobulin heavy chain variable domain, VH {Hu 96.72
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 96.71
d1ol0a_121 Immunoglobulin heavy chain variable domain, VH {En 96.7
d1f3dh1115 Immunoglobulin heavy chain variable domain, VH {Mo 96.7
d1d5mb198 Class II MHC beta chain, C-terminal domain {Human 96.69
d1bz7b1122 Immunoglobulin heavy chain variable domain, VH {Mo 96.69
d1pg7x1120 Immunoglobulin heavy chain variable domain, VH {Mo 96.69
d1c5db1117 Immunoglobulin heavy chain variable domain, VH {Ra 96.68
d1yedb1124 Immunoglobulin heavy chain variable domain, VH {Mo 96.67
d1dfbh1126 Immunoglobulin heavy chain variable domain, VH {Hu 96.66
d1ieha_135 Camelid IG heavy chain variable domain, VHh {Llama 96.65
d1qnzh_119 Immunoglobulin heavy chain variable domain, VH {Mo 96.65
d1xiwa_91 CD3 epsilon chain ectodomain fragment {Human (Homo 96.64
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 96.64
d1zvya1124 Camelid IG heavy chain variable domain, VHh {Camel 96.64
d2b1hh1124 Immunoglobulin heavy chain variable domain, VH {En 96.64
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 96.63
d1ncwh1119 Immunoglobulin heavy chain variable domain, VH {Mo 96.62
d1igtb4102 Immunoglobulin heavy chain gamma constant domain 3 96.62
d1op3h1125 Immunoglobulin heavy chain variable domain, VH {En 96.62
d1mjuh1116 Immunoglobulin heavy chain variable domain, VH {Mo 96.61
d1ncwh1119 Immunoglobulin heavy chain variable domain, VH {Mo 96.61
d1jpth1117 Immunoglobulin heavy chain variable domain, VH {En 96.6
d1mqkh_123 Immunoglobulin heavy chain variable domain, VH {Mo 96.6
d1i1ca2102 Immunoglobulin heavy chain gamma constant domain 3 96.59
d1jnhb1117 Immunoglobulin heavy chain variable domain, VH {Mo 96.59
d1mfah1117 Immunoglobulin heavy chain variable domain, VH {Mo 96.59
d2fx7h1127 Immunoglobulin heavy chain variable domain, VH {Hu 96.57
d1rzfh1133 Immunoglobulin heavy chain variable domain, VH {Hu 96.57
d1c5cl2107 Immunoglobulin light chain kappa constant domain, 96.56
d2jelh1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.56
d1ad9b1120 Immunoglobulin heavy chain variable domain, VH {En 96.53
d1indh1114 Immunoglobulin heavy chain variable domain, VH {Mo 96.53
d1igtb4102 Immunoglobulin heavy chain gamma constant domain 3 96.53
d1dfbh1126 Immunoglobulin heavy chain variable domain, VH {Hu 96.52
d1etzb1126 Immunoglobulin heavy chain variable domain, VH {Mo 96.52
d1dlfh_120 Immunoglobulin heavy chain variable domain, VH {Mo 96.52
d2fb4h1127 Immunoglobulin heavy chain variable domain, VH {Hu 96.52
d1i3ua_127 Camelid IG heavy chain variable domain, VHh {Llama 96.51
d1dn0b2105 Immunoglobulin heavy chain mu constant domain 1, C 96.51
d1sjva_107 Camelid IG heavy chain variable domain, VHh {Llama 96.51
d1j05b_121 Immunoglobulin heavy chain variable domain, VH {Mo 96.51
d2mhaa189 Class I MHC, alpha-3 domain {Mouse (Mus musculus) 96.51
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 96.5
d1nfde2104 Immunoglobulin light chain lambda constant domain, 96.5
d1r0ah1123 Immunoglobulin heavy chain variable domain, VH {Mo 96.5
d1fltx_95 Second domain of the Flt-1 receptor {Human (Homo s 96.5
d1q9rb1122 Immunoglobulin heavy chain variable domain, VH {Mo 96.49
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 96.49
d1i3ua_127 Camelid IG heavy chain variable domain, VHh {Llama 96.49
d3d85d187 The p40 domain of interleukin-12 (IL-12 beta chain 96.48
d1nfdf1121 Immunoglobulin heavy chain variable domain, VH {Ha 96.48
d1etzb1126 Immunoglobulin heavy chain variable domain, VH {Mo 96.48
d1tjgh1132 Immunoglobulin heavy chain variable domain, VH {En 96.45
d1bz7b1122 Immunoglobulin heavy chain variable domain, VH {Mo 96.43
d2h26a196 CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T 96.42
d1ol0a_121 Immunoglobulin heavy chain variable domain, VH {En 96.41
d2nxyd1128 Immunoglobulin heavy chain variable domain, VH {Hu 96.41
d1ogae2127 T-cell antigen receptor {Human (Homo sapiens), bet 96.41
d1rhhb1130 Immunoglobulin heavy chain variable domain, VH {Hu 96.39
d1rjca1126 Camelid IG heavy chain variable domain, VHh {Camel 96.37
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 96.37
d1mqkh_123 Immunoglobulin heavy chain variable domain, VH {Mo 96.37
d1tjgh1132 Immunoglobulin heavy chain variable domain, VH {En 96.36
d1hxmb2107 T-cell antigen receptor {Human (Homo sapiens), del 96.35
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 96.35
d1a2yb_116 Immunoglobulin heavy chain variable domain, VH {Mo 96.35
d1nfde2104 Immunoglobulin light chain lambda constant domain, 96.35
d1ogae2127 T-cell antigen receptor {Human (Homo sapiens), bet 96.35
d1ct8b1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.34
d1rjca1126 Camelid IG heavy chain variable domain, VHh {Camel 96.32
d3c2ah1131 Immunoglobulin heavy chain variable domain, VH {Hu 96.32
d1rihh1125 Immunoglobulin heavy chain variable domain, VH {Mo 96.31
d1op3h1125 Immunoglobulin heavy chain variable domain, VH {En 96.3
d1mjul2107 Immunoglobulin light chain kappa constant domain, 96.3
d1uvqb197 Class II MHC beta chain, C-terminal domain {Human 96.28
d1rzga1130 Immunoglobulin heavy chain variable domain, VH {Hu 96.28
d1ad9b1120 Immunoglobulin heavy chain variable domain, VH {En 96.28
d1u58a198 Immunomodulatory protein m144, alpha-3 domain {Mur 96.27
d2fb4h1127 Immunoglobulin heavy chain variable domain, VH {Hu 96.27
d1c5cl2107 Immunoglobulin light chain kappa constant domain, 96.25
d1i1ca1103 Immunoglobulin heavy chain gamma constant domain 2 96.25
d1sjva_107 Camelid IG heavy chain variable domain, VHh {Llama 96.24
d2p49b1121 Camelid IG heavy chain variable domain, VHh {Camel 96.24
d1r0ah1123 Immunoglobulin heavy chain variable domain, VH {Mo 96.24
d1q9rb1122 Immunoglobulin heavy chain variable domain, VH {Mo 96.21
d2fx7h1127 Immunoglobulin heavy chain variable domain, VH {Hu 96.2
d1lo4h1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.19
d2b1hh1124 Immunoglobulin heavy chain variable domain, VH {En 96.17
d1n0xh1127 Immunoglobulin heavy chain variable domain, VH {Hu 96.15
d1lo4h1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.13
d3cx5j1127 Immunoglobulin heavy chain variable domain, VH {Mo 96.12
d1fn4b1116 Immunoglobulin heavy chain variable domain, VH {Ra 96.11
d1fn4b1116 Immunoglobulin heavy chain variable domain, VH {Ra 96.11
d1rzfh1133 Immunoglobulin heavy chain variable domain, VH {Hu 96.11
d1ieha_135 Camelid IG heavy chain variable domain, VHh {Llama 96.11
d1k5na195 Class I MHC, alpha-3 domain {Human (Homo sapiens) 96.1
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Immunoglobulin
family: I set domains
domain: Titin
species: Human (Homo sapiens), different modules [TaxId: 9606]
Probab=99.74  E-value=7.3e-18  Score=145.12  Aligned_cols=95  Identities=25%  Similarity=0.419  Sum_probs=89.0

Q ss_pred             CCCeEEeccceeeeecCCeEEEEEEEecCCCCeEEEEECCEEeecCCcEEEEEeeCcEEEEEEccccCCCCeEEEEEEEe
Q psy16863        747 KAPKFIEGLKSCQATVNEEFKFTVQVSISPEPKVSWFRDDQQVVESDNVKILKETLGVCHLKIHALEVADQAEWKCIATN  826 (1075)
Q Consensus       747 ~~p~~~~~~~~~~~~~g~~~~l~C~v~g~p~p~v~W~k~g~~i~~~~~~~~~~~~~~~~~L~I~~~~~~D~G~Y~C~A~N  826 (1075)
                      ++|.|+..+++..+.+|+.+.|.|.+.|.|.|.++|||||.+|..+.++.+.....+.+.|.|.+++.+|+|.|+|.|.|
T Consensus         3 eaP~f~~~~~~~~v~~g~~v~l~c~v~g~P~p~v~W~k~~~~i~~~~~~~~~~~~~~~~~L~I~~~~~~D~G~Y~c~a~N   82 (98)
T d1g1ca_           3 EAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTGEDSASIMVKAIN   82 (98)
T ss_dssp             EEEEEEECCCCEEEETTSCEEEEEEEEEESCCEEEEEETTEECCCCSSEEEEEEETTEEEEEECSCCGGGCEEEEEEEEE
T ss_pred             cCCeEecCCCcEEEcCCCcEEEEEEEEEecCCeEEEEeCceEEeeeeeeEEEeccceEEEEEeccCccccCEEEEEEEEE
Confidence            58899999999999999999999999999999999999999999988888777777889999999999999999999999


Q ss_pred             CCceEEEEEEEEEEe
Q psy16863        827 DFGQSITSCFLKLNV  841 (1075)
Q Consensus       827 ~~G~~~~s~~l~V~~  841 (1075)
                      .+|.+.+++.|.|+.
T Consensus        83 ~~G~~~~~~~L~V~~   97 (98)
T d1g1ca_          83 IAGETSSHAFLLVQA   97 (98)
T ss_dssp             TTEEEEEEEEEEEEC
T ss_pred             CCcEEEEEEEEEEEE
Confidence            999999999998873



>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} Back     information, alignment and structure
>d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcvh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} Back     information, alignment and structure
>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} Back     information, alignment and structure
>d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1mjuh2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} Back     information, alignment and structure
>d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1lmka1 b.1.1.1 (A:2-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1hxma2 b.1.1.2 (A:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} Back     information, alignment and structure
>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} Back     information, alignment and structure
>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yedb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1op3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2fx7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1rzfh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ad9b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d2fb4h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q9rb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d3d85d1 b.1.1.4 (D:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfdf1 b.1.1.1 (F:1-114) Immunoglobulin heavy chain variable domain, VH {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} Back     information, alignment and structure
>d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} Back     information, alignment and structure
>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} Back     information, alignment and structure
>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d3c2ah1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1op3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1rzga1 b.1.1.1 (A:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ad9b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} Back     information, alignment and structure
>d2fb4h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ca1 b.1.1.2 (A:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1q9rb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d2fx7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1lo4h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]} Back     information, alignment and structure
>d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1lo4h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]} Back     information, alignment and structure
>d3cx5j1 b.1.1.1 (J:1-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1fn4b1 b.1.1.1 (B:1-106) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fn4b1 b.1.1.1 (B:1-106) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rzfh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure