Psyllid ID: psy16878

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIMENHKKHALHCTCNENTAASDGLLLTLGYKVKHRPRPPKIPHRYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIMENHKKHAGQSPAAADLNLLETARRCELYGVKLHPAKDHDNILLNLSVAHMGILVFQNQTKIN
ccHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccEEEEEEEEccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccEEEccccccEEEEEEEccEEEEEEcccccc
cccEEEEHHccccccccccccHHHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccHcccccHHHHcEccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEccccEEEEEcccEcc
MASYIVQAecgdyvsedypdhtylssykfvpnqtpELERRIMENHKkhalhctcnentaasdGLLLTLGykvkhrprppkiphrYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAEcgdyvsedypdhtylssykfvpnqtpELERRIMENHkkhagqspaaaDLNLLETARRCelygvklhpakdhdnILLNLSVAHMGILVFQNQTKIN
MASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIMENHKKHALHCTCNENTAASDGLLLTLGYKVKHRPRPPKIPHRYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIMENHKkhagqspaaADLNLLETARRCELYGVKLHPAKDHDNILLNLSVAHMGILVFQNQTKIN
MASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIMENHKKHALHCTCNENTAASDGLLLTLGYKVkhrprppkiphrYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIMENHKKHAGQSPAAADLNLLETARRCELYGVKLHPAKDHDNILLNLSVAHMGILVFQNQTKIN
***YIVQAECGDYVSEDYPDHTYLSSYKFVPNQT**LERRIMENHKKHALHCTCNENTAASDGLLLTLGYKVKHRPRPPKIPHRYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVP*************************DLNLLETARRCELYGVKLHPAKDHDNILLNLSVAHMGILVFQ******
MASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIMENHKKHALHCTCNENTAASDGLLLTLGYKVKHRPRPPKIPHRYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIMENHKKHAGQSPAAADLNLLETARRCELYGVKLHPAKDHDNILLNLSVAHMGILVFQNQTKI*
MASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIMENHKKHALHCTCNENTAASDGLLLTLGYKVKHRPRPPKIPHRYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIMEN*********AAADLNLLETARRCELYGVKLHPAKDHDNILLNLSVAHMGILVFQNQTKIN
*ASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIMENHKKHALHCTCNENTAASDGLLLTLGYKVKHRPRPPKIPHRYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIMENHKKHAGQSPAAADLNLLETARRCELYGVKLHPAKDHDNILLNLSVAHMGILVFQNQT***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIMENHKKHALHCTCNENTAASDGLLLTLGYKVKHRPRPPKIPHRYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIMENHKKHAGQSPAAADLNLLETARRCELYGVKLHPAKDHDNILLNLSVAHMGILVFQNQTKIN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query213 2.2.26 [Sep-21-2011]
Q9Y4F1 1045 FERM, RhoGEF and pleckstr yes N/A 0.596 0.121 0.530 8e-34
Q5RAB8 1045 FERM, RhoGEF and pleckstr yes N/A 0.596 0.121 0.530 9e-34
Q9V8R9 1698 Protein 4.1 homolog OS=Dr no N/A 0.685 0.085 0.446 4e-32
Q91VS8 1065 FERM, RhoGEF and pleckstr no N/A 0.596 0.119 0.476 7e-31
Q6ZUT3 714 FERM domain-containing pr no N/A 0.596 0.177 0.484 2e-29
O94887 1054 FERM, RhoGEF and pleckstr no N/A 0.596 0.120 0.469 9e-29
A2AD83 703 FERM domain-containing pr no N/A 0.596 0.180 0.461 4e-28
P29074 926 Tyrosine-protein phosphat no N/A 0.600 0.138 0.473 8e-27
Q9N179 617 Protein 4.1 OS=Bos taurus no N/A 0.807 0.278 0.367 1e-26
Q9Z2H5 879 Band 4.1-like protein 1 O no N/A 0.643 0.155 0.432 4e-26
>sp|Q9Y4F1|FARP1_HUMAN FERM, RhoGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens GN=FARP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  143 bits (361), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 95/130 (73%), Gaps = 3/130 (2%)

Query: 84  RYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQT 143
           RYLF LQ+K+DL+QG L CN+ +AAL+ S+IVQ+E GD+  ++  D  +L+  K++P Q 
Sbjct: 133 RYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDF--DEALDREHLAKNKYIPQQD 190

Query: 144 PELERRIMENHKKHAGQSPAAADLNLLETARRCELYGVKLHPAKDHDNILLNLSVAHMGI 203
             LE +I+E H  H GQ+PA +D  LLE ARR E+YG++LHPAKD +   +NL+VA+ GI
Sbjct: 191 A-LEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKINLAVANTGI 249

Query: 204 LVFQNQTKIN 213
           LVFQ  TKIN
Sbjct: 250 LVFQGFTKIN 259
May function as Rho-guanine nucleotide exchange factor.
Homo sapiens (taxid: 9606)
>sp|Q5RAB8|FARP1_PONAB FERM, RhoGEF and pleckstrin domain-containing protein 1 OS=Pongo abelii GN=FARP1 PE=2 SV=1 Back     alignment and function description
>sp|Q9V8R9|41_DROME Protein 4.1 homolog OS=Drosophila melanogaster GN=cora PE=1 SV=1 Back     alignment and function description
>sp|Q91VS8|FARP2_MOUSE FERM, RhoGEF and pleckstrin domain-containing protein 2 OS=Mus musculus GN=Farp2 PE=1 SV=2 Back     alignment and function description
>sp|Q6ZUT3|FRMD7_HUMAN FERM domain-containing protein 7 OS=Homo sapiens GN=FRMD7 PE=1 SV=1 Back     alignment and function description
>sp|O94887|FARP2_HUMAN FERM, RhoGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens GN=FARP2 PE=1 SV=3 Back     alignment and function description
>sp|A2AD83|FRMD7_MOUSE FERM domain-containing protein 7 OS=Mus musculus GN=Frmd7 PE=1 SV=1 Back     alignment and function description
>sp|P29074|PTN4_HUMAN Tyrosine-protein phosphatase non-receptor type 4 OS=Homo sapiens GN=PTPN4 PE=1 SV=1 Back     alignment and function description
>sp|Q9N179|41_BOVIN Protein 4.1 OS=Bos taurus GN=EPB41 PE=2 SV=1 Back     alignment and function description
>sp|Q9Z2H5|E41L1_MOUSE Band 4.1-like protein 1 OS=Mus musculus GN=Epb41l1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
270007175 3185 hypothetical protein TcasGA2_TC013716 [T 0.610 0.040 0.853 7e-65
383847386 3219 PREDICTED: uncharacterized protein LOC10 0.657 0.043 0.804 8e-62
242005620 998 FERM, RhoGEF and pleckstrin domain-conta 0.657 0.140 0.783 2e-61
189237184 3113 PREDICTED: similar to Cdep CG31536-PE [T 0.610 0.041 0.853 4e-61
332023216 3267 FERM, RhoGEF and pleckstrin domain-conta 0.657 0.042 0.804 4e-61
340722043 3394 PREDICTED: hypothetical protein LOC10064 0.657 0.041 0.797 7e-61
350407968 3363 PREDICTED: hypothetical protein LOC10074 0.657 0.041 0.797 7e-61
307182693 3311 FERM, RhoGEF and pleckstrin domain-conta 0.657 0.042 0.804 8e-61
380018705 1045 PREDICTED: FERM, RhoGEF and pleckstrin d 0.647 0.132 0.801 8e-61
345490744 3196 PREDICTED: hypothetical protein LOC10067 0.657 0.043 0.797 8e-61
>gi|270007175|gb|EFA03623.1| hypothetical protein TcasGA2_TC013716 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  252 bits (644), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 123/130 (94%)

Query: 84  RYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQT 143
           RYLFCLQ+KRDL+QGL+ CNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVP Q 
Sbjct: 145 RYLFCLQVKRDLAQGLMQCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPQQD 204

Query: 144 PELERRIMENHKKHAGQSPAAADLNLLETARRCELYGVKLHPAKDHDNILLNLSVAHMGI 203
            E+ER+IMENHKKH+GQSPA ADLNLLETARRCELYG+K+HPAKDH+N+ LNL+VAHMGI
Sbjct: 205 QEMERKIMENHKKHSGQSPAEADLNLLETARRCELYGIKMHPAKDHENVPLNLAVAHMGI 264

Query: 204 LVFQNQTKIN 213
           +VFQN TKIN
Sbjct: 265 IVFQNYTKIN 274

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383847386|ref|XP_003699335.1| PREDICTED: uncharacterized protein LOC100883306 [Megachile rotundata] Back     alignment and taxonomy information
>gi|242005620|ref|XP_002423662.1| FERM, RhoGEF and pleckstrin domain-containing protein, putative [Pediculus humanus corporis] gi|212506822|gb|EEB10924.1| FERM, RhoGEF and pleckstrin domain-containing protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|189237184|ref|XP_966992.2| PREDICTED: similar to Cdep CG31536-PE [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332023216|gb|EGI63472.1| FERM, RhoGEF and pleckstrin domain-containing protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340722043|ref|XP_003399420.1| PREDICTED: hypothetical protein LOC100648719 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350407968|ref|XP_003488256.1| PREDICTED: hypothetical protein LOC100741855 [Bombus impatiens] Back     alignment and taxonomy information
>gi|307182693|gb|EFN69817.1| FERM, RhoGEF and pleckstrin domain-containing protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380018705|ref|XP_003693264.1| PREDICTED: FERM, RhoGEF and pleckstrin domain-containing protein 2-like [Apis florea] Back     alignment and taxonomy information
>gi|345490744|ref|XP_003426445.1| PREDICTED: hypothetical protein LOC100678050 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
WB|WBGene00001490 1091 frm-3 [Caenorhabditis elegans 0.577 0.112 0.585 6.4e-36
UNIPROTKB|F1P065 993 FARP1 "Uncharacterized protein 0.591 0.126 0.534 4.1e-33
UNIPROTKB|F1MFC6 1046 LOC782949 "Uncharacterized pro 0.591 0.120 0.534 2.2e-32
RGD|1305346 992 Farp1 "FERM, RhoGEF (Arhgef) a 0.591 0.127 0.534 4.9e-32
UNIPROTKB|I3LEG0 999 FARP1 "Uncharacterized protein 0.591 0.126 0.527 5e-32
UNIPROTKB|E2REU8 1044 FARP1 "Uncharacterized protein 0.591 0.120 0.527 5.9e-32
UNIPROTKB|Q9Y4F1 1045 FARP1 "FERM, RhoGEF and plecks 0.591 0.120 0.527 9.6e-32
UNIPROTKB|I3LPW8 506 I3LPW8 "Uncharacterized protei 0.591 0.249 0.527 1e-31
UNIPROTKB|C9JME2 1076 FARP1 "FERM, RhoGEF and plecks 0.591 0.117 0.527 1.1e-31
UNIPROTKB|Q5RAB8 1045 FARP1 "FERM, RhoGEF and plecks 0.591 0.120 0.527 3.2e-31
WB|WBGene00001490 frm-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 399 (145.5 bits), Expect = 6.4e-36, P = 6.4e-36
 Identities = 72/123 (58%), Positives = 96/123 (78%)

Query:    85 YLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTP 144
             YLF +QIKRDL+ G LHC++NTA+L+++Y+VQ+ECGD+ SEDYPD TYLS  +FVPNQT 
Sbjct:   120 YLFTMQIKRDLALGELHCSDNTASLLSAYLVQSECGDFSSEDYPDATYLSHTRFVPNQTL 179

Query:   145 ELERRIMENHKKHAGQSPAAADLNLLETARRCELYGVKLHPAKDHDNILLNLSVAHMGIL 204
             E ++++M+NH+   G +P  +DL +LE ARRC+ YGVKLH AKD D     LSV H+GI 
Sbjct:   180 EFQKKVMDNHRNFIGMTPGESDLAMLEVARRCDFYGVKLHAAKDIDGNDAALSVMHLGIK 239

Query:   205 VFQ 207
             VF+
Sbjct:   240 VFR 242
GO:0005737 "cytoplasm" evidence=IEA
GO:0008092 "cytoskeletal protein binding" evidence=IEA
GO:0019898 "extrinsic to membrane" evidence=IEA
UNIPROTKB|F1P065 FARP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MFC6 LOC782949 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1305346 Farp1 "FERM, RhoGEF (Arhgef) and pleckstrin domain protein 1 (chondrocyte-derived)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LEG0 FARP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2REU8 FARP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y4F1 FARP1 "FERM, RhoGEF and pleckstrin domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LPW8 I3LPW8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|C9JME2 FARP1 "FERM, RhoGEF and pleckstrin domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAB8 FARP1 "FERM, RhoGEF and pleckstrin domain-containing protein 1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9Y4F1FARP1_HUMANNo assigned EC number0.53070.59620.1215yesN/A
Q5RAB8FARP1_PONABNo assigned EC number0.53070.59620.1215yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
smart00295201 smart00295, B41, Band 4 4e-29
pfam00373113 pfam00373, FERM_M, FERM central domain 3e-25
cd13193122 cd13193, FERM_C_FARP1-like, FERM, RhoGEF and pleck 3e-24
cd13189123 cd13189, FERM_C_PTPN4_PTPN3_like, Protein tyrosine 5e-17
cd13184113 cd13184, FERM_C_4_1_family, Protein 4 6e-17
cd13186111 cd13186, FERM_C_NBL4_NBL5, Novel band 4 3e-11
cd13192105 cd13192, FERM_C_FRMD3_FRMD5, FERM domain-containin 3e-08
smart00295201 smart00295, B41, Band 4 3e-06
pfam00373113 pfam00373, FERM_M, FERM central domain 3e-04
cd13195131 cd13195, FERM_C_MYLIP_IDOL, The E3 ubiquitin ligas 6e-04
pfam0938090 pfam09380, FERM_C, FERM C-terminal PH-like domain 0.001
>gnl|CDD|214604 smart00295, B41, Band 4 Back     alignment and domain information 
 Score =  106 bits (268), Expect = 4e-29
 Identities = 54/157 (34%), Positives = 73/157 (46%), Gaps = 14/157 (8%)

Query: 42  MENHKKHALHCTCNENT---AASDGLLLTLGYKVKHRPRPP----KIPHRY-LFCLQIKR 93
            E+  +   H      T          LTL ++VK  P  P    + P R  L  LQ++ 
Sbjct: 45  FEDPDEDLRHWLDPAKTLLDQDVKSEPLTLYFRVKFYPPDPNQLKEDPTRLNLLYLQVRN 104

Query: 94  DLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQT------PELE 147
           D+ +G L C E  A L+A+  +QAE GDY  E +     LS  +F+P Q        E  
Sbjct: 105 DILEGRLPCPEEEALLLAALALQAEFGDYDEELHDLRGELSLKRFLPKQLLDSRKLKEWR 164

Query: 148 RRIMENHKKHAGQSPAAADLNLLETARRCELYGVKLH 184
            RI+E HK+  G SP  A L  LE AR+   YGV+L 
Sbjct: 165 ERIVELHKELIGLSPEEAKLKYLELARKLPTYGVELF 201

1 homologues. Also known as ezrin/radixin/moesin (ERM) protein domains. Present in myosins, ezrin, radixin, moesin, protein tyrosine phosphatases. Plasma membrane-binding domain. These proteins play structural and regulatory roles in the assembly and stabilization of specialized plasmamembrane domains. Some PDZ domain containing proteins bind one or more of this family. Now includes JAKs. Length = 201
>gnl|CDD|215882 pfam00373, FERM_M, FERM central domain Back     alignment and domain information
>gnl|CDD|241347 cd13193, FERM_C_FARP1-like, FERM, RhoGEF and pleckstrin domain-containing protein 1 and related proteins FERM domain Back     alignment and domain information
>gnl|CDD|241343 cd13189, FERM_C_PTPN4_PTPN3_like, Protein tyrosine phosphatase non-receptor proteins 3 and 4 (PTPN4 and PTPN3) FERM domain C-lobe Back     alignment and domain information
>gnl|CDD|241338 cd13184, FERM_C_4_1_family, Protein 4 Back     alignment and domain information
>gnl|CDD|241340 cd13186, FERM_C_NBL4_NBL5, Novel band 4 Back     alignment and domain information
>gnl|CDD|241346 cd13192, FERM_C_FRMD3_FRMD5, FERM domain-containing protein 3 and 5 FERM (FRMD3 and 5) domain C-lobe Back     alignment and domain information
>gnl|CDD|214604 smart00295, B41, Band 4 Back     alignment and domain information
>gnl|CDD|215882 pfam00373, FERM_M, FERM central domain Back     alignment and domain information
>gnl|CDD|241349 cd13195, FERM_C_MYLIP_IDOL, The E3 ubiquitin ligase myosin regulatory light chain-interacting protein (MYLIP; also called inducible degrader of the LDL receptor, IDOL) FERM domain C-lobe Back     alignment and domain information
>gnl|CDD|220216 pfam09380, FERM_C, FERM C-terminal PH-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 213
KOG3530|consensus 616 100.0
KOG3527|consensus 975 100.0
KOG0792|consensus 1144 99.97
KOG3529|consensus 596 99.95
PF00373126 FERM_M: FERM central domain; InterPro: IPR019748 T 99.93
smart00295207 B41 Band 4.1 homologues. Also known as ezrin/radix 99.89
KOG3531|consensus 1036 99.78
KOG4261|consensus 1003 99.7
KOG3531|consensus 1036 99.52
KOG0248|consensus936 99.39
KOG3527|consensus 975 99.33
KOG4371|consensus 1332 99.33
KOG3530|consensus 616 99.28
cd0083692 FERM_C FERM_C domain. The FERM_C domain is the thi 98.67
KOG3552|consensus 1298 98.66
KOG0792|consensus 1144 98.28
KOG4371|consensus 1332 98.11
cd0043585 ACBP Acyl CoA binding protein (ACBP) binds thiol e 98.02
KOG4257|consensus 974 97.77
PF0088787 ACBP: Acyl CoA binding protein; InterPro: IPR00058 97.74
KOG3727|consensus664 97.49
PTZ0045890 acyl CoA binding protein; Provisional 97.12
COG428187 ACB Acyl-CoA-binding protein [Lipid metabolism] 97.04
PF00373126 FERM_M: FERM central domain; InterPro: IPR019748 T 96.5
KOG3529|consensus 596 95.78
KOG0817|consensus142 95.29
KOG4335|consensus558 95.0
smart00295207 B41 Band 4.1 homologues. Also known as ezrin/radix 94.45
KOG3878|consensus 469 92.29
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 86.17
>KOG3530|consensus Back     alignment and domain information 
Probab=100.00  E-value=6e-45  Score=325.70  Aligned_cols=168  Identities=44%  Similarity=0.658  Sum_probs=156.8

Q ss_pred             hhhhhcccccCCCccccccceeEEeEEeccCC-CCCch---hHHHHHHHHHHhhcccceeecCHHHHHHHHHHHHHHHhC
Q psy16878         45 HKKHALHCTCNENTAASDGLLLTLGYKVKHRP-RPPKI---PHRYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECG  120 (213)
Q Consensus        45 hk~~~~~~~~~~~~~~~~g~~~~l~frvkf~p-~~~~l---~~r~l~~lQ~~~di~~g~l~~~~~~a~~Laal~lQa~~G  120 (213)
                      +..||++..+.+.|+++.|+|++|+||||||| +|..|   .||++||+|+|+||++|||+|+.++|++||||++|+|+|
T Consensus        61 ~~~hWLD~tK~I~kqvK~gppytL~~rVKfY~sdP~~Lree~tRYqfflQlKqDll~GRL~Cp~~~AaeLaAl~lQsELG  140 (616)
T KOG3530|consen   61 KVRHWLDPTKSIKKQVKIGPPYTLHLRVKFYPSDPNNLREENTRYQFFLQLKQDLLSGRLYCPFETAAELAALILQSELG  140 (616)
T ss_pred             hcceecCcchhHHHHhccCCCeEEEEEEEeccCChhhhhchhhHHHHHHHHHHHHhcCCCCCchhhHHHHHHHHHHHHhc
Confidence            34455555555566777899999999999988 68877   999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCcccccccccCCchHHHHHHHHHHHhhcCCCHHHHHHHHHHHHhcCcCCCCeeeeccCCCCCeEEEEEeC
Q psy16878        121 DYVSEDYPDHTYLSSYKFVPNQTPELERRIMENHKKHAGQSPAAADLNLLETARRCELYGVKLHPAKDHDNILLNLSVAH  200 (213)
Q Consensus       121 d~~~~~~~~~~~l~~~~~~P~~~~~~~~~i~~~h~~l~G~s~~~A~~~fL~~a~~l~~YG~~~f~vkd~~~~~~~lgv~~  200 (213)
                      ||++++| +++|+++++|+|.+++++|.+|.+.||+++|++|++||++||+.|+.|++|||+.|+|++++|.+..||+++
T Consensus       141 DYn~~~H-t~~yVSefRf~p~Qte~LE~~I~e~hK~~rGqspaqAElnyLnkAkwLemYGVDmH~V~g~dg~ey~LGLTp  219 (616)
T KOG3530|consen  141 DYNEEEH-TGGYVSEFRFLPNQTEELEERIFELHKELRGQSPAQAELNYLNKAKWLEMYGVDMHPVKGHDGSEYYLGLTP  219 (616)
T ss_pred             CCChhhc-cccceeeeEecccccHHHHHHHHHHHHHhcCCCHHHHHHHHHhhhhhhhhccccceeeecCCCceeEeeccC
Confidence            9999999 699999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccEEEcCCcccC
Q psy16878        201 MGILVFQNQTKIN  213 (213)
Q Consensus       201 ~Gi~v~~~~~k~~  213 (213)
                      .||.||++.+||.
T Consensus       220 tGIlvf~g~~kig  232 (616)
T KOG3530|consen  220 TGILVFEGKKKIG  232 (616)
T ss_pred             ceEEEEECCceee
Confidence            9999999999873

>KOG3527|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>KOG3529|consensus Back     alignment and domain information
>PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>KOG4261|consensus Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>KOG3527|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG3530|consensus Back     alignment and domain information
>cd00836 FERM_C FERM_C domain Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>cd00435 ACBP Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>PF00887 ACBP: Acyl CoA binding protein; InterPro: IPR000582 Acyl-CoA-binding protein (ACBP) is a small (10 Kd) protein that binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters [] Back     alignment and domain information
>KOG3727|consensus Back     alignment and domain information
>PTZ00458 acyl CoA binding protein; Provisional Back     alignment and domain information
>COG4281 ACB Acyl-CoA-binding protein [Lipid metabolism] Back     alignment and domain information
>PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 Back     alignment and domain information
>KOG3529|consensus Back     alignment and domain information
>KOG0817|consensus Back     alignment and domain information
>KOG4335|consensus Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>KOG3878|consensus Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
3qij_A296 Primitive-Monoclinic Crystal Structure Of The Ferm 2e-26
1gg3_A279 Crystal Structure Of The Protein 4.1r Membrane Bind 2e-26
2he7_A283 Ferm Domain Of Epb41l3 (Dal-1) Length = 283 4e-26
3bin_A283 Structure Of The Dal-1 And Tslc1 (372-383) Complex 4e-26
2rq1_A109 Solution Structure Of The 4.1r Ferm Alpha Lobe Doma 4e-17
1ni2_A296 Structure Of The Active Ferm Domain Of Ezrin Length 4e-11
1gc6_A297 Crystal Structure Of The Radixin Ferm Domain Comple 2e-10
2zpy_A312 Crystal Structure Of The Mouse Radxin Ferm Domain C 2e-10
2emt_A322 Crystal Structure Analysis Of The Radixin Ferm Doma 2e-10
2d10_A312 Crystal Structure Of The Radixin Ferm Domain Comple 3e-10
2d2q_A310 Crystal Structure Of The Dimerized Radixin Ferm Dom 3e-10
1j19_A317 Crystal Structure Of The Radxin Ferm Domain Complex 3e-10
1sgh_A297 Moesin Ferm Domain Bound To Ebp50 C-Terminal Peptid 4e-10
1e5w_A 346 Structure Of Isolated Ferm Domain And First Long He 6e-10
3u8z_A300 Human Merlin Ferm Domain Length = 300 1e-09
1h4r_A314 Crystal Structure Of The Ferm Domain Of Merlin, The 1e-09
1h4r_B314 Crystal Structure Of The Ferm Domain Of Merlin, The 1e-09
1ef1_A294 Crystal Structure Of The Moesin Ferm DomainTAIL DOM 1e-09
1isn_A323 Crystal Structure Of Merlin Ferm Domain Length = 32 2e-09
2i1j_A 575 Moesin From Spodoptera Frugiperda At 2.1 Angstroms 3e-06
>pdb|3QIJ|A Chain A, Primitive-Monoclinic Crystal Structure Of The Ferm Domain Of Protein 4.1r Length = 296 Back     alignment and structure 
Iteration: 1

 Score =  115 bits (288), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 83/129 (64%), Gaps = 1/129 (0%)
Query: 85  YLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTP 144
           Y  CLQ+++D+  G L C+  T AL+ SY +Q+E GDY  E +    Y+S +K  PNQT 
Sbjct: 111 YYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELH-GVDYVSDFKLAPNQTK 169
Query: 145 ELERRIMENHKKHAGQSPAAADLNLLETARRCELYGVKLHPAKDHDNILLNLSVAHMGIL 204
           ELE ++ME HK +   +PA ADL  LE A++  +YGV LH AKD + + + L V   G+L
Sbjct: 170 ELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLL 229
Query: 205 VFQNQTKIN 213
           V++++ +IN
Sbjct: 230 VYKDKLRIN 238
>pdb|1GG3|A Chain A, Crystal Structure Of The Protein 4.1r Membrane Binding Domain Length = 279 Back     alignment and structure
>pdb|2HE7|A Chain A, Ferm Domain Of Epb41l3 (Dal-1) Length = 283 Back     alignment and structure
>pdb|3BIN|A Chain A, Structure Of The Dal-1 And Tslc1 (372-383) Complex Length = 283 Back     alignment and structure
>pdb|2RQ1|A Chain A, Solution Structure Of The 4.1r Ferm Alpha Lobe Domain Length = 109 Back     alignment and structure
>pdb|1NI2|A Chain A, Structure Of The Active Ferm Domain Of Ezrin Length = 296 Back     alignment and structure
>pdb|1GC6|A Chain A, Crystal Structure Of The Radixin Ferm Domain Complexed With Inositol-(1,4,5)-Triphosphate Length = 297 Back     alignment and structure
>pdb|2ZPY|A Chain A, Crystal Structure Of The Mouse Radxin Ferm Domain Complexed With The Mouse Cd44 Cytoplasmic Peptide Length = 312 Back     alignment and structure
>pdb|2EMT|A Chain A, Crystal Structure Analysis Of The Radixin Ferm Domain Complexed With Adhesion Molecule Psgl-1 Length = 322 Back     alignment and structure
>pdb|2D10|A Chain A, Crystal Structure Of The Radixin Ferm Domain Complexed With The Nherf-1 C-Terminal Tail Peptide Length = 312 Back     alignment and structure
>pdb|2D2Q|A Chain A, Crystal Structure Of The Dimerized Radixin Ferm Domain Length = 310 Back     alignment and structure
>pdb|1J19|A Chain A, Crystal Structure Of The Radxin Ferm Domain Complexed With The Icam-2 Cytoplasmic Peptide Length = 317 Back     alignment and structure
>pdb|1SGH|A Chain A, Moesin Ferm Domain Bound To Ebp50 C-Terminal Peptide Length = 297 Back     alignment and structure
>pdb|1E5W|A Chain A, Structure Of Isolated Ferm Domain And First Long Helix Of Moesin Length = 346 Back     alignment and structure
>pdb|3U8Z|A Chain A, Human Merlin Ferm Domain Length = 300 Back     alignment and structure
>pdb|1H4R|A Chain A, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 Back     alignment and structure
>pdb|1H4R|B Chain B, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 Back     alignment and structure
>pdb|1EF1|A Chain A, Crystal Structure Of The Moesin Ferm DomainTAIL DOMAIN COMPLEX Length = 294 Back     alignment and structure
>pdb|1ISN|A Chain A, Crystal Structure Of Merlin Ferm Domain Length = 323 Back     alignment and structure
>pdb|2I1J|A Chain A, Moesin From Spodoptera Frugiperda At 2.1 Angstroms Resolution Length = 575 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 3e-44
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 7e-11
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 1e-42
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 4e-09
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 3e-40
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 3e-07
1mix_A206 Talin; focal adhesion, integrin binding, FERM doma 5e-40
1mix_A206 Talin; focal adhesion, integrin binding, FERM doma 8e-08
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 8e-40
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 9e-09
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 5e-38
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 3e-07
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 1e-37
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 2e-06
4dxa_B322 KREV interaction trapped protein 1; GTPase, FERM, 3e-29
4dxa_B322 KREV interaction trapped protein 1; GTPase, FERM, 9e-07
3au4_A555 Myosin-X; protein-protein complex, motor protein c 4e-14
4eku_A 392 Protein-tyrosine kinase 2-beta; proline-rich tyros 1e-10
2al6_A 375 Focal adhesion kinase 1; transferase; 2.35A {Gallu 2e-07
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Length = 371 Back     alignment and structure
 Score =  150 bits (380), Expect = 3e-44
 Identities = 30/158 (18%), Positives = 58/158 (36%), Gaps = 13/158 (8%)

Query: 67  TLGYKVKHRPRPPKIP-----HRYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGD 121
           TL  + K       +         L  +Q + D+  G    + + A   A +  Q + G 
Sbjct: 161 TLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGP 220

Query: 122 YVSEDYPDHTYLSSYKFVPNQ--TPELERRIMENHKKHAGQSPAAADLNLLETARRCELY 179
           +  + +    +L    F+P +    + ER+I + HK     S   A +  ++ AR  + Y
Sbjct: 221 HNEQKHKAG-FLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTY 279

Query: 180 GVKLHPAKDHD-----NILLNLSVAHMGILVFQNQTKI 212
           GV     K+        +   L +    ++    +TK 
Sbjct: 280 GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKE 317
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Length = 371 Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 Back     alignment and structure
>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Length = 206 Back     alignment and structure
>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Length = 206 Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Length = 222 Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Length = 222 Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} Length = 322 Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} Length = 322 Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Length = 555 Back     alignment and structure
>4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} Length = 392 Back     alignment and structure
>2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Length = 375 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 100.0
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 100.0
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 100.0
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 100.0
1mix_A206 Talin; focal adhesion, integrin binding, FERM doma 100.0
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 100.0
4dxa_B322 KREV interaction trapped protein 1; GTPase, FERM, 100.0
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 99.98
3au4_A555 Myosin-X; protein-protein complex, motor protein c 99.96
3pvl_A 655 Myosin VIIA isoform 1; protein complex, novel fold 99.95
2al6_A 375 Focal adhesion kinase 1; transferase; 2.35A {Gallu 99.95
4eku_A 392 Protein-tyrosine kinase 2-beta; proline-rich tyros 99.87
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.78
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 98.26
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 98.04
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 97.98
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 97.96
1mix_A206 Talin; focal adhesion, integrin binding, FERM doma 97.79
1hbk_A89 ACBP, acyl-COA binding protein; fatty acid metabol 97.66
2cb8_A87 Acyl-COA-binding protein; acyl-coenzyme A binding 97.64
3epy_A89 Acyl-COA-binding domain-containing protein 7; acyl 97.61
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 97.6
1st7_A86 ACBP, acyl-COA-binding protein; four helix bundle, 97.55
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 97.46
2cop_A109 Acyl-coenzyme A binding domain containing 6; acyl 97.44
4dxa_B322 KREV interaction trapped protein 1; GTPase, FERM, 97.44
2wh5_A106 Acyl-COA-binding domain-containing protein 4; alte 97.36
2lbb_A96 Acyl COA binding protein; protein binding, structu 97.24
3flv_A119 Acyl-COA-binding domain-containing protein 5; lipi 97.23
3fp5_A106 Acyl-COA binding protein; ACBP, cacao disease, fat 97.15
2cqu_A116 Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi 97.02
2al6_A375 Focal adhesion kinase 1; transferase; 2.35A {Gallu 93.97
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 93.92
3au4_A555 Myosin-X; protein-protein complex, motor protein c 92.44
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
Probab=100.00  E-value=3.1e-39  Score=276.71  Aligned_cols=150  Identities=41%  Similarity=0.729  Sum_probs=140.5

Q ss_pred             cceeEEeEEeccCC-CCCch---hHHHHHHHHHHhhcccceeecCHHHHHHHHHHHHHHHhCCCCCCCCCCCCccccccc
Q psy16878         63 GLLLTLGYKVKHRP-RPPKI---PHRYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKF  138 (213)
Q Consensus        63 g~~~~l~frvkf~p-~~~~l---~~r~l~~lQ~~~di~~g~l~~~~~~a~~Laal~lQa~~Gd~~~~~~~~~~~l~~~~~  138 (213)
                      +.++++.||||||| +|..+   ++|++||+|+|+||++|+++|+.++|+.||||++|+++|||+++.+ ..+|++...+
T Consensus        85 ~~~~~l~frvkfy~~~~~~l~~~~tr~l~ylQ~~~dil~G~~~c~~e~a~~LAAl~~Qae~Gd~~~~~~-~~~yl~~~~~  163 (296)
T 3qij_A           85 GVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELH-GVDYVSDFKL  163 (296)
T ss_dssp             --CCEEEEEESSCCSCGGGSSCHHHHHHHHHHHHHHHHHTSSCCCHHHHHHHHHHHHHHHHCSCCHHHH-TTCCCTTSCC
T ss_pred             CCCcEEEEEEEEeCCCchhccCHHHHHHHHHHHHHHHHcCCCCCCHHHHHHHHHHHHHHhcCCCCcccc-chhhCcHhhc
Confidence            34789999999976 66655   9999999999999999999999999999999999999999998876 5789998999


Q ss_pred             ccCCchHHHHHHHHHHHhhcCCCHHHHHHHHHHHHhcCcCCCCeeeeccCCCCCeEEEEEeCCccEEEcCCcccC
Q psy16878        139 VPNQTPELERRIMENHKKHAGQSPAAADLNLLETARRCELYGVKLHPAKDHDNILLNLSVAHMGILVFQNQTKIN  213 (213)
Q Consensus       139 ~P~~~~~~~~~i~~~h~~l~G~s~~~A~~~fL~~a~~l~~YG~~~f~vkd~~~~~~~lgv~~~Gi~v~~~~~k~~  213 (213)
                      +|.+.++|+++|.+.|++++|||+.+|+..||+.|++||+||+++|+|+++.|.+++||||.+||.||++++||+
T Consensus       164 ~P~~~~~~~~~I~~~h~~~~g~s~~eA~~~yL~~a~~l~~yG~~~f~vk~~~~~~~~LgV~~~Gi~v~~~~~kl~  238 (296)
T 3qij_A          164 APNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRIN  238 (296)
T ss_dssp             SSSCCHHHHHHHHHHHHTCCSCCHHHHHHHHHHHHTTSTTTTCEEEEEECTTSCEEEEEECSSEEEEEETTEEEE
T ss_pred             CCcCHHHHHHHHHHHHHHccCCCHHHHHHHHHHHHhcccccCceEEEEEcCCCCEEEEEECCCeEEEEeCCCeEE
Confidence            999999999999999999999999999999999999999999999999999999999999999999999998864
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Back     alignment and structure
>4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Back     alignment and structure
>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Back     alignment and structure
>1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 Back     alignment and structure
>2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A Back     alignment and structure
>3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} SCOP: a.11.1.1 Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A Back     alignment and structure
>2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} Back     alignment and structure
>2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} Back     alignment and structure
>3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} Back     alignment and structure
>3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} SCOP: a.11.1.0 Back     alignment and structure
>2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 213
d1gg3a1106 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1 6e-28
d1gg3a1106 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1 1e-08
d1h4ra1111 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) 2e-27
d1h4ra1111 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) 3e-07
d1ef1a1111 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [ 1e-25
d1ef1a1111 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [ 2e-06
d1mixa1114 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus 2e-25
d1mixa1114 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus 3e-06
d2al6a1123 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chic 3e-15
d1ef1a299 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) 6e-10
d1h4ra299 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) 8e-10
d1gg3a292 b.55.1.5 (A:188-279) Erythroid membrane protein 4. 2e-08
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure

class: All alpha proteins
fold: Acyl-CoA binding protein-like
superfamily: Second domain of FERM
family: Second domain of FERM
domain: Erythroid membrane protein 4.1R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 99.6 bits (248), Expect = 6e-28
 Identities = 43/96 (44%), Positives = 61/96 (63%), Gaps = 1/96 (1%)

Query: 84  RYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQT 143
           RY  CLQ+++D+  G L C+  T AL+ SY +Q+E GDY  E +    Y+S +K  PNQT
Sbjct: 12  RYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELH-GVDYVSDFKLAPNQT 70

Query: 144 PELERRIMENHKKHAGQSPAAADLNLLETARRCELY 179
            ELE ++ME HK +   +PA ADL  LE A++  +Y
Sbjct: 71  KELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMY 106
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 114 Back     information, alignment and structure
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 114 Back     information, alignment and structure
>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 123 Back     information, alignment and structure
>d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
d1gg3a1106 Erythroid membrane protein 4.1R {Human (Homo sapie 99.97
d1mixa1114 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 99.95
d1h4ra1111 Merlin {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1ef1a1111 Moesin {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2al6a1123 Focal adhesion kinase 1 {Chicken (Gallus gallus) [ 99.87
d1ef1a299 Moesin {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1h4ra299 Merlin {Human (Homo sapiens) [TaxId: 9606]} 98.91
d1gg3a1106 Erythroid membrane protein 4.1R {Human (Homo sapie 98.88
d1h4ra1111 Merlin {Human (Homo sapiens) [TaxId: 9606]} 98.7
d1ef1a1111 Moesin {Human (Homo sapiens) [TaxId: 9606]} 98.65
d1gg3a292 Erythroid membrane protein 4.1R {Human (Homo sapie 98.44
d1mixa1114 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 98.31
d1hb6a_86 Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 98.03
d1hbka_89 Acyl-CoA binding protein {Plasmodium falciparum [T 97.43
d2al6a1123 Focal adhesion kinase 1 {Chicken (Gallus gallus) [ 97.39
d1mixa292 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 96.65
d1gg3a381 Erythroid membrane protein 4.1R {Human (Homo sapie 95.84
d1ef1a384 Moesin {Human (Homo sapiens) [TaxId: 9606]} 94.57
d1h4ra384 Merlin {Human (Homo sapiens) [TaxId: 9606]} 93.79
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Acyl-CoA binding protein-like
superfamily: Second domain of FERM
family: Second domain of FERM
domain: Erythroid membrane protein 4.1R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=2.2e-32  Score=199.07  Aligned_cols=103  Identities=44%  Similarity=0.767  Sum_probs=99.4

Q ss_pred             CCCCch---hHHHHHHHHHHhhcccceeecCHHHHHHHHHHHHHHHhCCCCCCCCCCCCcccccccccCCchHHHHHHHH
Q psy16878         76 PRPPKI---PHRYLFCLQIKRDLSQGLLHCNENTAALMASYIVQAECGDYVSEDYPDHTYLSSYKFVPNQTPELERRIME  152 (213)
Q Consensus        76 p~~~~l---~~r~l~~lQ~~~di~~g~l~~~~~~a~~Laal~lQa~~Gd~~~~~~~~~~~l~~~~~~P~~~~~~~~~i~~  152 (213)
                      |+|..|   +||++||+|+|+||++|+++|+.++|+.||||++||++|||+++.+ ..+|+....++|.+.++|+++|.+
T Consensus         1 pdp~~L~~e~Tr~l~ylQlr~~i~~G~~~~~~~~a~~Laal~~Qae~GD~~~~~~-~~~yl~~~~~~p~~~~~~~~~I~~   79 (106)
T d1gg3a1           1 PDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELH-GVDYVSDFKLAPNQTKELEEKVME   79 (106)
T ss_dssp             SSGGGSSCHHHHHHHHHHHHHHHHTTSSCCCHHHHHHHHHHHHHHHHCSCCTTSC-SSCCGGGSCCCSSCCHHHHHHHHH
T ss_pred             CCHHHhccHHHHHHHHHHHHHHHHhcccCCCHHHHHHHHHHHHHHHhCCCCcccc-chhhhhHHhcCCccHHHHHHHHHH
Confidence            788877   9999999999999999999999999999999999999999999887 589999999999999999999999


Q ss_pred             HHHhhcCCCHHHHHHHHHHHHhcCcCC
Q psy16878        153 NHKKHAGQSPAAADLNLLETARRCELY  179 (213)
Q Consensus       153 ~h~~l~G~s~~~A~~~fL~~a~~l~~Y  179 (213)
                      .|++++|||+.+|+..||++|++||+|
T Consensus        80 ~h~~l~G~s~~~A~~~fL~~~~~l~~Y  106 (106)
T d1gg3a1          80 LHKSYRSMTPAQADLEFLENAKKLSMY  106 (106)
T ss_dssp             HHHHCCSCCHHHHHHHHHHHHHHSTTT
T ss_pred             HHHHccCcCHHHHHHHHHHHHhcCCCC
Confidence            999999999999999999999999998
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure