Psyllid ID: psy16880


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
DGSIIHTFVHSNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLCDSAVRSISFCSKQRTLISGGDDGSICMWNLNSKLCDR
cccEEEEccccccccEEEEEEcccccEEEEEcccccEEEEEcccccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEc
cccHHHHHcccccccEEEEEEcccccEEEEEccccEEEEEEcccccccccEEEEEEcccccEEEEEccccEEEEEEcccccccc
dgsiihtfvhsnnsavrSISFCskqhtlisggddgsiCMWNLNSKLCDSAVRSIsfcskqrtlisggddgsicmwnlnsklcdr
dgsiihtfvhsnnsaVRSISFCSKQHTLISGGDDGSICMWNLNSKLCDSAVRSISFCSKQRtlisggddgsicmwnlnsklcdr
DGSIIHTFVHSNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLCDSAVRSISFCSKQRTLISGGDDGSICMWNLNSKLCDR
***IIHTFVHSNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLCDSAVRSISFCSKQRTLISGGDDGSICMWNLNS*****
DGSIIHTFVHSNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLCDSAVRSISFCSKQRTLISGGDDGSICMWNLNSKLCDR
DGSIIHTFVHSNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLCDSAVRSISFCSKQRTLISGGDDGSICMWNLNSKLCDR
*GSIIHTFVHSNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLCDSAVRSISFCSKQRTLISGGDDGSICMWNLNSK*C**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DGSIIHTFVHSNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLCDSAVRSISFCSKQRTLISGGDDGSICMWNLNSKLCDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query84 2.2.26 [Sep-21-2011]
Q55FR9 1221 Coatomer subunit alpha OS yes N/A 0.857 0.058 0.316 6e-06
Q9SJT9 1218 Coatomer subunit alpha-2 no N/A 0.952 0.065 0.295 8e-06
Q94A40 1216 Coatomer subunit alpha-1 no N/A 0.952 0.065 0.295 1e-05
Q0J3D9 1218 Coatomer subunit alpha-3 yes N/A 0.952 0.065 0.284 1e-05
Q9AUR8 1218 Coatomer subunit alpha-1 yes N/A 0.952 0.065 0.284 1e-05
Q9AUR7 1218 Coatomer subunit alpha-2 yes N/A 0.952 0.065 0.284 2e-05
A0AUS0 487 WD repeat, SAM and U-box yes N/A 0.916 0.158 0.309 3e-05
Q9EPN12936 Neurobeachin OS=Mus muscu no N/A 0.785 0.022 0.315 4e-05
Q8NFP92946 Neurobeachin OS=Homo sapi no N/A 0.785 0.022 0.315 4e-05
F6ZT52 470 POC1 centriolar protein h no N/A 0.904 0.161 0.301 4e-05
>sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 Back     alignment and function desciption
 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 7/79 (8%)

Query: 11  SNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLC-------DSAVRSISFCSKQRTL 63
            +   VR I+F   Q   +SGGDD  I +WN   + C          +RS+ F  +   +
Sbjct: 49  EHEGPVRGINFHMTQPLFVSGGDDYKIKVWNYKQRRCLFTLKGHKDYIRSVEFHREAPWI 108

Query: 64  ISGGDDGSICMWNLNSKLC 82
           +S  DD  I +WN  S+ C
Sbjct: 109 VSSSDDMVIRIWNWQSRTC 127




The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
Dictyostelium discoideum (taxid: 44689)
>sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 Back     alignment and function description
>sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=1 SV=2 Back     alignment and function description
>sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 Back     alignment and function description
>sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 Back     alignment and function description
>sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 Back     alignment and function description
>sp|A0AUS0|WSDU1_DANRE WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 Back     alignment and function description
>sp|Q9EPN1|NBEA_MOUSE Neurobeachin OS=Mus musculus GN=Nbea PE=1 SV=1 Back     alignment and function description
>sp|Q8NFP9|NBEA_HUMAN Neurobeachin OS=Homo sapiens GN=NBEA PE=1 SV=3 Back     alignment and function description
>sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
428299395 1139 YD repeat protein [Calothrix sp. PCC 630 0.976 0.071 0.340 6e-08
425455607 1108 Genome sequencing data, contig C309 [Mic 0.916 0.069 0.388 2e-07
434394192 1232 WD-40 repeat-containing protein [Gloeoca 0.976 0.066 0.382 3e-07
425465666 816 Genome sequencing data, contig C309 (fra 0.761 0.078 0.422 3e-07
37521813 1721 hypothetical protein glr2244 [Gloeobacte 0.940 0.045 0.341 3e-07
307155260 1449 WD40 repeat-containing protein [Cyanothe 0.952 0.055 0.352 4e-07
354568144 1376 (Myosin heavy-chain) kinase [Fischerella 0.797 0.048 0.324 4e-07
126658553 1523 Peptidase C14, caspase catalytic subunit 0.892 0.049 0.409 6e-07
166366485 1230 WD repeat-containing protein [Microcysti 0.928 0.063 0.360 7e-07
183983394 1600 putative regulatory protein [Mycobacteri 0.809 0.042 0.416 8e-07
>gi|428299395|ref|YP_007137701.1| YD repeat protein [Calothrix sp. PCC 6303] gi|428235939|gb|AFZ01729.1| YD repeat protein [Calothrix sp. PCC 6303] Back     alignment and taxonomy information
 Score = 61.6 bits (148), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 50/88 (56%), Gaps = 6/88 (6%)

Query: 1   DGSIIHTFVHSNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLCDS------AVRSI 54
           +G+++    H+NN +V SISF      + SG +D +I +WNLN  L  +      +VR++
Sbjct: 605 NGTLVKIIKHTNNGSVSSISFSPDGKIIASGSNDNTIKLWNLNGTLIKTLIGHKASVRTV 664

Query: 55  SFCSKQRTLISGGDDGSICMWNLNSKLC 82
           +F    + + SG DD +I +WNL+  L 
Sbjct: 665 NFSPNGKIIASGSDDTTIKLWNLDGTLI 692




Source: Calothrix sp. PCC 6303

Species: Calothrix parietina

Genus: Calothrix

Family: Rivulariaceae

Order: Nostocales

Class:

Phylum: Cyanobacteria

Superkingdom: Bacteria

>gi|425455607|ref|ZP_18835327.1| Genome sequencing data, contig C309 [Microcystis aeruginosa PCC 9807] gi|389803520|emb|CCI17593.1| Genome sequencing data, contig C309 [Microcystis aeruginosa PCC 9807] Back     alignment and taxonomy information
>gi|434394192|ref|YP_007129139.1| WD-40 repeat-containing protein [Gloeocapsa sp. PCC 7428] gi|428266033|gb|AFZ31979.1| WD-40 repeat-containing protein [Gloeocapsa sp. PCC 7428] Back     alignment and taxonomy information
>gi|425465666|ref|ZP_18844973.1| Genome sequencing data, contig C309 (fragment) [Microcystis aeruginosa PCC 9809] gi|389832046|emb|CCI24681.1| Genome sequencing data, contig C309 (fragment) [Microcystis aeruginosa PCC 9809] Back     alignment and taxonomy information
>gi|37521813|ref|NP_925190.1| hypothetical protein glr2244 [Gloeobacter violaceus PCC 7421] gi|35212812|dbj|BAC90185.1| WD-repeat protein [Gloeobacter violaceus PCC 7421] Back     alignment and taxonomy information
>gi|307155260|ref|YP_003890644.1| WD40 repeat-containing protein [Cyanothece sp. PCC 7822] gi|306985488|gb|ADN17369.1| WD40 repeat, subgroup [Cyanothece sp. PCC 7822] Back     alignment and taxonomy information
>gi|354568144|ref|ZP_08987310.1| (Myosin heavy-chain) kinase [Fischerella sp. JSC-11] gi|353541109|gb|EHC10579.1| (Myosin heavy-chain) kinase [Fischerella sp. JSC-11] Back     alignment and taxonomy information
>gi|126658553|ref|ZP_01729700.1| Peptidase C14, caspase catalytic subunit p20 [Cyanothece sp. CCY0110] gi|126620140|gb|EAZ90862.1| Peptidase C14, caspase catalytic subunit p20 [Cyanothece sp. CCY0110] Back     alignment and taxonomy information
>gi|166366485|ref|YP_001658758.1| WD repeat-containing protein [Microcystis aeruginosa NIES-843] gi|166088858|dbj|BAG03566.1| WD-repeat protein [Microcystis aeruginosa NIES-843] Back     alignment and taxonomy information
>gi|183983394|ref|YP_001851685.1| putative regulatory protein [Mycobacterium marinum M] gi|183176720|gb|ACC41830.1| conserved hypothetical regulatory protein [Mycobacterium marinum M] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
TAIR|locus:2135393 910 AT4G04940 "AT4G04940" [Arabido 0.880 0.081 0.357 5.2e-06
TAIR|locus:2082891 438 RID3 "AT3G49180" [Arabidopsis 0.357 0.068 0.366 5.5e-06
TAIR|locus:2050064 1218 AT2G21390 [Arabidopsis thalian 0.952 0.065 0.295 3.2e-05
TAIR|locus:2092722 305 LST8-1 "AT3G18140" [Arabidopsi 0.845 0.232 0.303 3.5e-05
ZFIN|ZDB-GENE-061110-97 487 zgc:154085 "zgc:154085" [Danio 0.916 0.158 0.309 3.5e-05
CGD|CAL0004039 735 orf19.3301 [Candida albicans ( 0.928 0.106 0.298 3.7e-05
TAIR|locus:2036823 1216 AT1G62020 [Arabidopsis thalian 0.952 0.065 0.295 4.1e-05
FB|FBgn0033440322 CG10459 [Drosophila melanogast 0.380 0.099 0.406 4.5e-05
CGD|CAL0000105 1221 orf19.1672 [Candida albicans ( 0.928 0.063 0.325 6.7e-05
MGI|MGI:1917485 405 Poc1a "POC1 centriolar protein 0.904 0.187 0.265 7.1e-05
TAIR|locus:2135393 AT4G04940 "AT4G04940" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 118 (46.6 bits), Expect = 5.2e-06, P = 5.2e-06
 Identities = 30/84 (35%), Positives = 45/84 (53%)

Query:     1 DGSIIHTFVHSNNSAVRSISFCSKQHTLI-SGGDDGSICMWNLNSKLCDSAVR------- 52
             D  I+ TF H++  AV ++SF +    L+ SGG  G I +WNLN K   S +R       
Sbjct:   213 DEEIV-TFEHASRGAVTALSFSTDGRPLLASGGSFGVISIWNLNKKRLQSVIRDAHDSSI 271

Query:    53 -SISFCSKQRTLISGGDDGSICMW 75
              S++F + +  L+S   D S+ MW
Sbjct:   272 ISLNFLANEPVLMSASADNSLKMW 295




GO:0000166 "nucleotide binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006364 "rRNA processing" evidence=IEA
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=RCA
GO:0006606 "protein import into nucleus" evidence=RCA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA
TAIR|locus:2082891 RID3 "AT3G49180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050064 AT2G21390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092722 LST8-1 "AT3G18140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061110-97 zgc:154085 "zgc:154085" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
CGD|CAL0004039 orf19.3301 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
TAIR|locus:2036823 AT1G62020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0033440 CG10459 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
CGD|CAL0000105 orf19.1672 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
MGI|MGI:1917485 Poc1a "POC1 centriolar protein homolog A (Chlamydomonas)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-10
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 8e-08
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 1e-07
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-07
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 55.0 bits (133), Expect = 1e-10
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 8/90 (8%)

Query: 2   GSIIHTFVHSNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLC-------DSAVRSI 54
           G  + T    +   V S++F      L+S   DG+I +W+L++  C       ++ V S+
Sbjct: 167 GKCVATL-TGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGHENGVNSV 225

Query: 55  SFCSKQRTLISGGDDGSICMWNLNSKLCDR 84
           +F      L SG +DG+I +W+L +  C +
Sbjct: 226 AFSPDGYLLASGSEDGTIRVWDLRTGECVQ 255


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 84
KOG0271|consensus 480 99.83
KOG0272|consensus459 99.78
KOG0272|consensus459 99.78
KOG0263|consensus707 99.77
KOG0263|consensus707 99.75
KOG0266|consensus 456 99.74
KOG0279|consensus 315 99.73
KOG0271|consensus 480 99.73
KOG0286|consensus343 99.71
KOG0315|consensus 311 99.71
PTZ00421 493 coronin; Provisional 99.7
KOG0266|consensus 456 99.69
KOG0273|consensus524 99.69
KOG0279|consensus 315 99.69
KOG0318|consensus 603 99.68
KOG0315|consensus 311 99.67
KOG0282|consensus 503 99.67
KOG0295|consensus406 99.64
PTZ00420 568 coronin; Provisional 99.63
KOG0286|consensus343 99.63
KOG0265|consensus 338 99.63
KOG0291|consensus 893 99.63
KOG0275|consensus 508 99.62
KOG0284|consensus 464 99.61
KOG0283|consensus 712 99.61
PTZ00421 493 coronin; Provisional 99.61
PTZ00420 568 coronin; Provisional 99.61
KOG1407|consensus313 99.6
KOG0291|consensus 893 99.59
KOG0285|consensus 460 99.58
KOG0292|consensus 1202 99.58
KOG0285|consensus 460 99.57
KOG0645|consensus 312 99.57
KOG0316|consensus307 99.57
KOG0264|consensus422 99.57
KOG0284|consensus 464 99.56
KOG1273|consensus 405 99.55
KOG4283|consensus 397 99.54
KOG0643|consensus 327 99.53
KOG0647|consensus 347 99.53
KOG0283|consensus 712 99.53
KOG0276|consensus 794 99.53
KOG0316|consensus 307 99.53
KOG0295|consensus406 99.52
KOG0319|consensus 775 99.52
KOG0273|consensus 524 99.52
KOG1446|consensus 311 99.52
KOG0318|consensus 603 99.51
PLN00181 793 protein SPA1-RELATED; Provisional 99.51
KOG0276|consensus 794 99.51
KOG2394|consensus 636 99.5
KOG0282|consensus 503 99.5
KOG0302|consensus 440 99.5
KOG0269|consensus 839 99.49
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 99.49
KOG0277|consensus311 99.48
KOG1274|consensus 933 99.48
KOG1034|consensus 385 99.48
KOG1539|consensus 910 99.48
KOG0264|consensus 422 99.47
KOG0973|consensus 942 99.47
KOG0640|consensus 430 99.46
KOG0293|consensus 519 99.46
KOG0275|consensus 508 99.46
KOG0313|consensus423 99.46
KOG0645|consensus 312 99.46
KOG0265|consensus 338 99.45
KOG0278|consensus334 99.45
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.44
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.44
KOG0319|consensus 775 99.44
KOG0647|consensus 347 99.43
KOG0289|consensus506 99.43
KOG0772|consensus 641 99.43
KOG0640|consensus430 99.42
KOG0313|consensus423 99.42
KOG0641|consensus350 99.42
KOG1446|consensus 311 99.41
KOG0302|consensus440 99.41
KOG0292|consensus 1202 99.41
KOG0296|consensus 399 99.41
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.4
KOG0643|consensus 327 99.4
KOG1539|consensus 910 99.39
KOG2110|consensus 391 99.39
KOG0296|consensus 399 99.39
KOG0268|consensus433 99.39
KOG0305|consensus 484 99.39
KOG2111|consensus346 99.38
KOG0310|consensus 487 99.38
KOG0303|consensus 472 99.38
KOG0646|consensus 476 99.38
KOG1445|consensus 1012 99.37
KOG0310|consensus 487 99.36
KOG1310|consensus 758 99.36
KOG0281|consensus 499 99.36
KOG0973|consensus 942 99.36
KOG0281|consensus499 99.34
KOG1273|consensus 405 99.34
KOG0772|consensus 641 99.34
PLN00181793 protein SPA1-RELATED; Provisional 99.34
KOG0277|consensus 311 99.34
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.33
KOG0267|consensus 825 99.32
KOG0293|consensus 519 99.31
KOG0305|consensus 484 99.31
KOG0274|consensus 537 99.31
KOG0274|consensus 537 99.3
KOG0269|consensus 839 99.3
KOG0300|consensus481 99.3
KOG0294|consensus 362 99.28
KOG1063|consensus 764 99.28
KOG0308|consensus 735 99.27
KOG1188|consensus 376 99.27
KOG0288|consensus459 99.26
KOG2048|consensus 691 99.25
KOG1009|consensus 434 99.24
KOG0289|consensus 506 99.24
KOG1407|consensus313 99.23
KOG0278|consensus 334 99.23
KOG0294|consensus 362 99.23
KOG1272|consensus 545 99.22
KOG0303|consensus 472 99.22
KOG0642|consensus 577 99.2
KOG0300|consensus 481 99.2
KOG4283|consensus 397 99.2
KOG2096|consensus 420 99.2
KOG0290|consensus364 99.19
KOG0641|consensus350 99.19
KOG1332|consensus 299 99.17
KOG0306|consensus 888 99.17
KOG0639|consensus705 99.16
KOG1036|consensus 323 99.16
KOG0306|consensus 888 99.16
KOG0267|consensus 825 99.16
KOG2919|consensus406 99.14
KOG0308|consensus 735 99.13
KOG0307|consensus 1049 99.13
KOG2096|consensus 420 99.13
KOG0299|consensus 479 99.13
KOG0646|consensus 476 99.11
KOG0771|consensus 398 99.11
KOG0649|consensus325 99.1
KOG2445|consensus 361 99.09
KOG0322|consensus323 99.09
KOG0270|consensus 463 99.09
KOG0639|consensus 705 99.08
KOG0268|consensus 433 99.08
KOG0301|consensus 745 99.08
KOG1036|consensus 323 99.07
KOG0288|consensus459 99.06
KOG4328|consensus498 99.06
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 99.06
KOG3881|consensus412 99.06
KOG0321|consensus 720 99.05
KOG0270|consensus463 99.05
KOG1538|consensus 1081 99.04
KOG0299|consensus 479 99.03
KOG0649|consensus 325 99.03
KOG2055|consensus514 99.03
KOG0321|consensus 720 99.02
KOG2048|consensus 691 99.01
KOG0280|consensus339 99.01
KOG2321|consensus 703 99.01
KOG3914|consensus 390 99.0
KOG4227|consensus 609 99.0
KOG1188|consensus 376 98.99
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.97
KOG0650|consensus 733 98.95
KOG2055|consensus 514 98.95
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.93
KOG1332|consensus 299 98.93
KOG0301|consensus 745 98.92
KOG1274|consensus 933 98.89
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.88
KOG2106|consensus 626 98.88
KOG4378|consensus 673 98.86
KOG2110|consensus 391 98.85
KOG0974|consensus 967 98.85
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.85
KOG0290|consensus364 98.85
KOG1524|consensus 737 98.84
KOG2106|consensus626 98.83
KOG0771|consensus398 98.82
COG2319 466 FOG: WD40 repeat [General function prediction only 98.82
KOG0642|consensus 577 98.82
KOG1240|consensus 1431 98.82
KOG2139|consensus 445 98.8
KOG1007|consensus370 98.8
KOG1009|consensus 434 98.8
KOG4227|consensus 609 98.79
KOG1445|consensus 1012 98.78
KOG1523|consensus 361 98.78
KOG4378|consensus 673 98.78
KOG4328|consensus 498 98.76
KOG1587|consensus 555 98.76
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.76
KOG1034|consensus 385 98.76
KOG1409|consensus 404 98.74
KOG1524|consensus 737 98.7
KOG0644|consensus 1113 98.69
KOG1063|consensus 764 98.68
KOG2394|consensus 636 98.68
KOG1007|consensus 370 98.67
KOG1587|consensus555 98.65
KOG1272|consensus 545 98.65
KOG2445|consensus 361 98.64
KOG0322|consensus323 98.63
KOG4547|consensus 541 98.63
KOG0644|consensus 1113 98.63
KOG1963|consensus 792 98.62
KOG0307|consensus 1049 98.62
KOG1310|consensus 758 98.61
KOG1538|consensus 1081 98.61
KOG1408|consensus 1080 98.61
PRK01742 429 tolB translocation protein TolB; Provisional 98.61
KOG1523|consensus 361 98.61
COG4946 668 Uncharacterized protein related to the periplasmic 98.58
KOG1963|consensus 792 98.58
KOG1408|consensus 1080 98.58
KOG2919|consensus 406 98.57
KOG0650|consensus733 98.56
KOG4714|consensus319 98.54
KOG2315|consensus 566 98.45
PRK05137 435 tolB translocation protein TolB; Provisional 98.45
COG2319 466 FOG: WD40 repeat [General function prediction only 98.38
KOG2315|consensus 566 98.32
PRK03629 429 tolB translocation protein TolB; Provisional 98.32
PRK04922 433 tolB translocation protein TolB; Provisional 98.31
PRK02889 427 tolB translocation protein TolB; Provisional 98.29
KOG3881|consensus 412 98.28
PRK11028 330 6-phosphogluconolactonase; Provisional 98.27
PRK00178 430 tolB translocation protein TolB; Provisional 98.25
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 98.23
KOG1517|consensus1387 98.2
KOG1517|consensus1387 98.19
KOG2139|consensus 445 98.18
KOG4532|consensus 344 98.18
KOG1064|consensus2439 98.18
PRK11028 330 6-phosphogluconolactonase; Provisional 98.16
KOG2111|consensus 346 98.14
KOG1064|consensus2439 98.13
KOG2695|consensus425 98.1
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.09
TIGR02800 417 propeller_TolB tol-pal system beta propeller repea 98.08
KOG4497|consensus 447 98.08
KOG4532|consensus344 98.02
KOG2695|consensus425 98.01
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.99
KOG1240|consensus 1431 97.98
KOG1409|consensus404 97.97
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.97
KOG1334|consensus559 97.97
KOG4190|consensus 1034 97.96
KOG4640|consensus 665 97.96
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.95
KOG0974|consensus 967 97.95
PRK01742429 tolB translocation protein TolB; Provisional 97.94
PRK04792 448 tolB translocation protein TolB; Provisional 97.91
KOG1334|consensus 559 97.91
KOG1645|consensus 463 97.91
PRK02889427 tolB translocation protein TolB; Provisional 97.88
KOG4190|consensus 1034 97.84
PRK04922433 tolB translocation protein TolB; Provisional 97.81
PRK01029428 tolB translocation protein TolB; Provisional 97.8
PRK03629429 tolB translocation protein TolB; Provisional 97.8
KOG2041|consensus 1189 97.79
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.78
KOG4497|consensus447 97.78
PRK01029428 tolB translocation protein TolB; Provisional 97.76
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 97.72
PRK05137 435 tolB translocation protein TolB; Provisional 97.7
KOG3617|consensus 1416 97.7
KOG2321|consensus 703 97.7
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 97.66
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.64
KOG1275|consensus 1118 97.63
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.58
KOG3621|consensus 726 97.55
KOG0309|consensus 1081 97.54
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.49
KOG2079|consensus 1206 97.48
KOG4714|consensus319 97.48
PRK00178 430 tolB translocation protein TolB; Provisional 97.46
KOG0882|consensus 558 97.41
KOG2079|consensus 1206 97.41
KOG1354|consensus 433 97.39
KOG4640|consensus 665 97.39
KOG4547|consensus 541 97.35
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.32
KOG2041|consensus 1189 97.27
KOG1354|consensus 433 97.18
PRK04792 448 tolB translocation protein TolB; Provisional 97.13
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.1
KOG0280|consensus339 97.05
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.96
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 96.95
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.94
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 96.89
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 96.88
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 96.87
KOG2314|consensus 698 96.78
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.76
KOG2066|consensus 846 96.76
KOG1275|consensus 1118 96.76
COG4946 668 Uncharacterized protein related to the periplasmic 96.75
KOG1912|consensus 1062 96.75
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 96.74
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.6
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 96.57
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 96.43
KOG1920|consensus 1265 96.39
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 96.33
KOG3914|consensus 390 96.3
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.14
PRK04043 419 tolB translocation protein TolB; Provisional 96.07
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.78
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.69
KOG2314|consensus 698 95.68
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 95.61
KOG3617|consensus 1416 95.55
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.54
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 95.43
KOG1832|consensus 1516 95.42
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 95.42
PRK02888 635 nitrous-oxide reductase; Validated 95.18
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.09
KOG4649|consensus 354 95.05
PRK04043 419 tolB translocation protein TolB; Provisional 95.02
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 95.02
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 94.82
KOG0882|consensus 558 94.66
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 94.52
KOG1645|consensus 463 94.47
PF13360 238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 94.4
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 94.26
KOG0309|consensus 1081 94.24
KOG2114|consensus 933 93.88
KOG3621|consensus 726 93.87
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 93.81
KOG2444|consensus 238 93.77
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 93.35
PRK02888 635 nitrous-oxide reductase; Validated 93.32
KOG4460|consensus 741 93.29
KOG2395|consensus 644 92.77
KOG1920|consensus 1265 92.44
COG3386307 Gluconolactonase [Carbohydrate transport and metab 92.38
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 92.33
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 92.23
KOG1008|consensus 783 92.04
KOG2395|consensus 644 91.52
KOG1008|consensus 783 91.48
KOG1912|consensus 1062 91.43
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 91.16
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 90.79
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 90.65
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 90.35
COG0823 425 TolB Periplasmic component of the Tol biopolymer t 90.35
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.34
KOG3616|consensus 1636 90.33
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 90.29
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 90.08
KOG2377|consensus 657 89.98
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 89.58
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 89.37
KOG3630|consensus 1405 89.23
KOG2444|consensus238 89.0
KOG2377|consensus 657 88.74
COG0823 425 TolB Periplasmic component of the Tol biopolymer t 88.52
PF00780 275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 88.37
PRK13616 591 lipoprotein LpqB; Provisional 88.35
PF06977 248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 87.07
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 87.02
PF12768 281 Rax2: Cortical protein marker for cell polarity 86.99
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 86.96
COG3204316 Uncharacterized protein conserved in bacteria [Fun 86.5
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 86.49
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 86.21
KOG1832|consensus 1516 85.88
COG5167 776 VID27 Protein involved in vacuole import and degra 85.75
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 85.62
KOG1916|consensus 1283 85.3
COG3204 316 Uncharacterized protein conserved in bacteria [Fun 85.15
KOG2066|consensus 846 85.12
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 85.03
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 84.95
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 84.77
KOG1916|consensus 1283 84.58
KOG3630|consensus 1405 83.93
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 83.22
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 83.06
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 81.7
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 81.46
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 80.83
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 80.51
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 80.12
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 80.04
>KOG0271|consensus Back     alignment and domain information
Probab=99.83  E-value=6.6e-20  Score=100.78  Aligned_cols=79  Identities=22%  Similarity=0.449  Sum_probs=72.0

Q ss_pred             eEEEeccCCCcCEEEEEEccCCCEEEEeCCCCcEEEEeCCCCCC-------CCCEEEEEEccCCCEEEEecCCCcEEEEe
Q psy16880          4 IIHTFVHSNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLC-------DSAVRSISFCSKQRTLISGGDDGSICMWN   76 (84)
Q Consensus         4 ~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~~~~~~~~d~~~~~~-------~~~v~~~~~~~~~~~~~~~~~~~~i~~~~   76 (84)
                      +-..+.+| .++|.++.|+|+++.|++|+.|..+++||+.+..+       .+.|.+++|+|+++.+++|+.+|.|++||
T Consensus       107 CssS~~GH-~e~Vl~~~fsp~g~~l~tGsGD~TvR~WD~~TeTp~~t~KgH~~WVlcvawsPDgk~iASG~~dg~I~lwd  185 (480)
T KOG0271|consen  107 CSSSIAGH-GEAVLSVQFSPTGSRLVTGSGDTTVRLWDLDTETPLFTCKGHKNWVLCVAWSPDGKKIASGSKDGSIRLWD  185 (480)
T ss_pred             eccccCCC-CCcEEEEEecCCCceEEecCCCceEEeeccCCCCcceeecCCccEEEEEEECCCcchhhccccCCeEEEec
Confidence            44567889 99999999999999999999999999999987765       67899999999999999999999999999


Q ss_pred             CCCCeec
Q psy16880         77 LNSKLCD   83 (84)
Q Consensus        77 ~~~~~~~   83 (84)
                      +.+++++
T Consensus       186 pktg~~~  192 (480)
T KOG0271|consen  186 PKTGQQI  192 (480)
T ss_pred             CCCCCcc
Confidence            9887754



>KOG0272|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 3e-08
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure

Iteration: 1

Score = 53.5 bits (127), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 26/88 (29%), Positives = 48/88 (54%), Gaps = 7/88 (7%) Query: 1 DGSIIHTFVHSNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLCD------SAVRSI 54 +G ++ T ++S+VR ++F T+ S DD ++ +WN N +L S+VR + Sbjct: 456 NGQLLQTLT-GHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGV 514 Query: 55 SFCSKQRTLISGGDDGSICMWNLNSKLC 82 +F +T+ S DD ++ +WN N +L Sbjct: 515 AFSPDGQTIASASDDKTVKLWNRNGQLL 542

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.82
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.81
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.78
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.77
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 99.77
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.76
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.76
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 99.76
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.75
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.75
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.74
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.74
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.74
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.74
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.74
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.74
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.74
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.74
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.74
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.73
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.73
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.73
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.73
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.72
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.72
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.72
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.72
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.71
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.71
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.71
3iz6_a 380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.71
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.71
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.7
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.7
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.69
2pm7_B 297 Protein transport protein SEC13, protein transport 99.69
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.69
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.69
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.68
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.68
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.68
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.68
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.68
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.67
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.67
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.67
2pm7_B 297 Protein transport protein SEC13, protein transport 99.67
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.66
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.66
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.66
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.65
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.65
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.64
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.64
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.64
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.64
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.64
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.64
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.63
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.63
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.63
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.62
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.62
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.62
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.62
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 99.62
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.62
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.61
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.61
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.61
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.61
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.61
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.61
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.6
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 99.6
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.6
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.59
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.59
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.59
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.59
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.59
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.59
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.59
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.58
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.58
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 99.57
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 99.57
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.57
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.57
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.57
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.56
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.56
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.56
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 99.56
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.55
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.55
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 99.55
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 99.55
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.54
3jro_A 753 Fusion protein of protein transport protein SEC13 99.54
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.54
3jro_A 753 Fusion protein of protein transport protein SEC13 99.53
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.53
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.53
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.53
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.53
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.53
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.53
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 99.52
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.52
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 99.51
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.51
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 99.51
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.51
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.5
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.5
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 99.48
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.46
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.46
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.43
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.43
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.39
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.38
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.37
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.37
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.36
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.35
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.33
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.31
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.28
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.11
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.1
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.09
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.05
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.02
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.01
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.99
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.97
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 98.97
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.95
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.94
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.92
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 98.9
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.89
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.82
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.82
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.82
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 98.82
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.8
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.77
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 98.77
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.76
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.75
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.74
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.72
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.68
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.68
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.67
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.65
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.65
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.65
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 98.65
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.63
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.61
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.56
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.56
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.55
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.53
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.53
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 98.53
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.47
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.43
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 98.42
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.41
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.38
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.35
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.32
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.31
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 98.3
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.28
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 98.26
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.25
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.22
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.19
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.09
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.07
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 98.06
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 98.04
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 98.03
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.02
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.02
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.01
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 97.96
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.93
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 97.92
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.9
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 97.77
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.76
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.75
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.73
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.72
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.72
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 97.7
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.6
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.54
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 97.47
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.45
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 97.39
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 97.39
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.28
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 97.24
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 97.15
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.1
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 97.05
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 96.99
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.91
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 96.9
2qe8_A 343 Uncharacterized protein; structural genomics, join 96.85
1pjx_A 314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.84
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 96.81
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.75
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 96.75
2p4o_A 306 Hypothetical protein; putative lactonase, structur 96.66
2qe8_A 343 Uncharacterized protein; structural genomics, join 96.58
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 96.56
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 96.49
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.46
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 96.37
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 96.35
2ece_A 462 462AA long hypothetical selenium-binding protein; 96.27
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.19
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.16
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.14
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 96.07
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 95.84
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 95.63
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 95.48
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.46
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 95.21
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.17
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 94.78
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.7
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 94.56
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 94.53
2ece_A 462 462AA long hypothetical selenium-binding protein; 94.5
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 94.47
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 94.34
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 94.05
3qqz_A 255 Putative uncharacterized protein YJIK; MCSG, PSI-2 93.96
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 93.73
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 93.67
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 93.66
3nok_A 268 Glutaminyl cyclase; beta-propeller, cyclotransfera 93.43
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 93.23
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 92.88
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 92.73
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 92.48
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 92.32
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 92.31
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 91.96
1tl2_A 236 L10, protein (tachylectin-2); animal lectin, horse 91.77
2fp8_A 322 Strictosidine synthase; six bladed beta propeller 90.87
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 90.72
1npe_A 267 Nidogen, entactin; glycoprotein, basement membrane 90.34
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 89.6
2fp8_A 322 Strictosidine synthase; six bladed beta propeller 88.79
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 88.44
3hxj_A 330 Pyrrolo-quinoline quinone; all beta protein. incom 88.36
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 87.97
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 87.57
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 86.0
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 82.39
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 80.44
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 80.32
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 80.04
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
Probab=99.82  E-value=5.4e-19  Score=97.42  Aligned_cols=74  Identities=14%  Similarity=0.162  Sum_probs=66.3

Q ss_pred             EEeccCCCcCEEEEEEccCCCEEEEeCCCCcEEEEeCCCCCC--------CCCEEEEEEccCCCEEEEecCCCcEEEEeC
Q psy16880          6 HTFVHSNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLC--------DSAVRSISFCSKQRTLISGGDDGSICMWNL   77 (84)
Q Consensus         6 ~~~~~~~~~~v~~~~~~~~~~~l~~~~~~~~~~~~d~~~~~~--------~~~v~~~~~~~~~~~~~~~~~~~~i~~~~~   77 (84)
                      ..+.+| ...|.+++|+|++++|++|+.|+.+++||+.+...        ...|.+++|+|+++++++++.|++|+||++
T Consensus       263 ~~~~~~-~~~V~~~~~Spdg~~lasgs~D~~V~iwd~~~~~~~~~~~~gH~~~V~~v~fSpdg~~laS~S~D~tvrvw~i  341 (365)
T 4h5i_A          263 KQVTNR-FKGITSMDVDMKGELAVLASNDNSIALVKLKDLSMSKIFKQAHSFAITEVTISPDSTYVASVSAANTIHIIKL  341 (365)
T ss_dssp             EEEESS-CSCEEEEEECTTSCEEEEEETTSCEEEEETTTTEEEEEETTSSSSCEEEEEECTTSCEEEEEETTSEEEEEEC
T ss_pred             eeecCC-CCCeEeEEECCCCCceEEEcCCCEEEEEECCCCcEEEEecCcccCCEEEEEECCCCCEEEEEeCCCeEEEEEc
Confidence            345667 88999999999999999999999999999987654        568999999999999999999999999998


Q ss_pred             CCC
Q psy16880         78 NSK   80 (84)
Q Consensus        78 ~~~   80 (84)
                      +..
T Consensus       342 p~~  344 (365)
T 4h5i_A          342 PLN  344 (365)
T ss_dssp             CTT
T ss_pred             CCC
Confidence            643



>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 84
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-06
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-07
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-07
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 7e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 7e-06
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.001
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.003
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.003
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 48.6 bits (114), Expect = 5e-09
 Identities = 14/78 (17%), Positives = 28/78 (35%), Gaps = 7/78 (8%)

Query: 6   HTFVHSNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLC-------DSAVRSISFCS 58
                +    + S+SF      L++G DD +  +W+             D+ V  +    
Sbjct: 263 TYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTD 322

Query: 59  KQRTLISGGDDGSICMWN 76
               + +G  D  + +WN
Sbjct: 323 DGMAVATGSWDSFLKIWN 340


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.77
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.77
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.76
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 99.75
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.75
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.74
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.72
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.72
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.7
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.68
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.68
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 99.67
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.66
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.65
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.64
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.62
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.62
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.59
d1sq9a_ 393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.55
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.54
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.53
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.53
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.53
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.48
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.47
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.45
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.43
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.42
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.42
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.4
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.3
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.2
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.16
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.14
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.12
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.11
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.09
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 99.02
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 98.93
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.93
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.91
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.71
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.71
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.66
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.61
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.56
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 98.52
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.48
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.29
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 98.04
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.95
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.64
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.31
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.29
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 96.97
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.78
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.64
d2hqsa1 269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.57
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.56
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.53
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.44
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 96.37
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 96.18
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 95.72
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 95.69
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 94.83
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 94.27
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 94.08
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 93.56
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 91.49
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 91.02
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 88.34
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 86.68
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 85.2
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 84.58
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 82.02
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 81.91
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 80.71
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 80.24
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 80.12
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.77  E-value=5.2e-18  Score=88.67  Aligned_cols=75  Identities=25%  Similarity=0.527  Sum_probs=68.6

Q ss_pred             CCceEEEeccCCCcCEEEEEEccCCCEEEEeCCCCcEEEEeCCCCCC-------CCCEEEEEEccCCCEEEEecCCCcEE
Q psy16880          1 DGSIIHTFVHSNNSAVRSISFCSKQHTLISGGDDGSICMWNLNSKLC-------DSAVRSISFCSKQRTLISGGDDGSIC   73 (84)
Q Consensus         1 ~g~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~~~~~~~~d~~~~~~-------~~~v~~~~~~~~~~~~~~~~~~~~i~   73 (84)
                      +++++..+.+| ...|.+++++|++.+|++++.|+.+.+||+.+...       ...|.+++|+|+++.+++++.|+.|+
T Consensus       236 ~~~~~~~~~~~-~~~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~h~~~V~~~~~s~~~~~l~s~s~Dg~i~  314 (317)
T d1vyhc1         236 TGMCLMTLVGH-DNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVK  314 (317)
T ss_dssp             TTEEEEEEECC-SSCEEEEEECSSSSCEEEEETTTEEEEECCTTSCCCEEEECCSSCEEEEEECSSSSCEEEEETTSEEE
T ss_pred             CCcEEEEEeCC-CCCEEEEEECCCCCEEEEEECCCeEEEEECCCCcEEEEEcCCCCCEEEEEEcCCCCEEEEEeCCCeEE
Confidence            35678888888 99999999999999999999999999999987765       67899999999999999999999999


Q ss_pred             EEe
Q psy16880         74 MWN   76 (84)
Q Consensus        74 ~~~   76 (84)
                      +||
T Consensus       315 iWd  317 (317)
T d1vyhc1         315 VWE  317 (317)
T ss_dssp             EEC
T ss_pred             EeC
Confidence            997



>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure