Psyllid ID: psy17057

---

Local Sequence Feature Prediction

Residue Number Marker
--------10--------20--------30--------40--------50--------60--------70--------80
Protein Sequence
MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSAWFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG
Secondary Structure (PSIPRED)
cccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHcHHHHHHcccccccccccccccccEEEEcccccEEEc
Secondary Structure Prediction (SSPRO)
ccccccccccccEEEEEHHHHHHHHHHHcccccccccccEEEEcHHHHHHcccEEEEccccccccEEEEEEEccccEEEc
Coil and Loop (DISEMBL)
magstmrdktpFKLVVLLVLLHedfgllnrdtkFFDMFSTVIVSAWFQAFgnaktahnnnssrfgKFIQVNYKENGMVHG
Flexible Loop (DISEMBL)
magstmrdktpfKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSAWFQAFGNAKTahnnnssrfgkfiqVNYKENGMVHG
Low Complexity Region (SEG)
MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSAWFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG
Disordered region (IsUnstruct)
**********PFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSAWFQAFGNAKTAHNN**SRFGKFIQVNY********
Disordered Region (DISOPRED)
*AGSTMRDKTPFKLVVLL*********************TVIVSAWFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVH*
Disordered Region (DISEMBL)
********KTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSAWFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG
Disordered Region (DISPRO)
********KTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSAWFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVH*
Transmembrane Helix (TMHMM)
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
Transmembrane Helix (HMMTOP)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (MEMSAT)
iiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
TM Helix, Signal Peptide (MEMSAT_SVM)
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
TM Helix, Signal Peptide (Phobius)
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooo
Signal Peptide (SignalP HMM Mode)
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooo
Signal Peptide (SignalP NN Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Coiled Coils (COILS)
MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSAWFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG
Positional Conservation
no confident homologs detected

---

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query	80	2.2.26 [Sep-21-2011]
Q9QY06	2114	Unconventional myosin-IXb	yes	N/A	0.425	0.016	0.852	2e-11
Q63358	1980	Unconventional myosin-IXb	yes	N/A	0.425	0.017	0.823	1e-10
Q9Z1N3	2626	Unconventional myosin-IXa	no	N/A	0.425	0.012	0.823	2e-10
Q8C170	2542	Unconventional myosin-IXa	no	N/A	0.425	0.013	0.823	2e-10
B2RTY4	2548	Unconventional myosin-IXa	yes	N/A	0.425	0.013	0.823	2e-10
Q13459	2157	Unconventional myosin-IXb	no	N/A	0.425	0.015	0.794	5e-10
F8VQB6	2062	Unconventional myosin-X O	no	N/A	0.962	0.037	0.379	3e-07
P79114	2052	Unconventional myosin-X O	no	N/A	0.462	0.018	0.594	5e-07
P08964	1928	Myosin-1 OS=Saccharomyces	yes	N/A	0.425	0.017	0.588	6e-07
D3ZJP6	2060	Unconventional myosin-X O	no	N/A	0.462	0.017	0.594	8e-07

>sp|Q9QY06|MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus GN=Myo9b PE=1 SV=2

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNY ENG+V G
Sbjct: 279 LEAFGNAKTAHNNNSSRFGKFIQVNYLENGIVRG 312

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. May be involved in the remodeling of the actin cytoskeleton. Binds actin with high affinity both in the absence and presence of ATP and its mechanochemical activity is inhibited by calcium ions. Also acts as a GTPase activating protein on Rho.
Mus musculus (taxid: 10090)

>sp|Q63358|MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus GN=Myo9b PE=1 SV=1

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 31/34 (91%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNY E+G+V G
Sbjct: 279 LEAFGNAKTAHNNNSSRFGKFIQVNYLESGIVRG 312

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. May be involved in the remodeling of the actin cytoskeleton. Binds actin with high affinity both in the absence and presence of ATP and its mechanochemical activity is inhibited by calcium ions. Also acts as a GTPase activating protein on Rho.

Rattus norvegicus (taxid: 10116)

>sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNY+E G V G
Sbjct: 279 LEAFGNAKTAHNNNSSRFGKFIQVNYQETGTVLG 312

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho by stimulating it's GTPase activity in neurons, has a role in the regulation of neuronal morphology and function.

Rattus norvegicus (taxid: 10116)

>sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNY+E G V G
Sbjct: 279 LEAFGNAKTAHNNNSSRFGKFIQVNYQETGTVLG 312

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho activity in neurons, has a role in the regulation of neuronal morphology and function.

Mus musculus (taxid: 10090)

>sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/34 (82%), Positives = 30/34 (88%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNY+E G V G
Sbjct: 279 LEAFGNAKTAHNNNSSRFGKFIQVNYQETGTVLG 312

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho activity in neurons, has a role in the regulation of neuronal morphology and function.

Homo sapiens (taxid: 9606)

>sp|Q13459|MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQV+Y E+G+V G
Sbjct: 279 LEAFGNAKTAHNNNSSRFGKFIQVSYLESGIVRG 312

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. May be involved in the remodeling of the actin cytoskeleton. Binds actin with high affinity both in the absence and presence of ATP and its mechanochemical activity is inhibited by calcium ions. Also acts as a GTPase activating protein on Rho.

Homo sapiens (taxid: 9606)

>sp|F8VQB6|MYO10_MOUSE Unconventional myosin-X OS=Mus musculus GN=Myo10 PE=1 SV=1

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 2   AGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSAWFQAFGNAKTAHNNNS 61
           AG T   K   K + ++     D GL  + +      + +  S   +AFGNAKT +NNNS
Sbjct: 161 AGKTESTKLILKFLSVISQQTLDLGLQEKTSSVEQ--AILQSSPIMEAFGNAKTVYNNNS 218

Query: 62  SRFGKFIQVNYKENGMVHG 80
           SRFGKF+Q+N  + G + G
Sbjct: 219 SRFGKFVQLNICQQGNIQG 237

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. MYO10 binds to actin filaments and actin bundles and functions as plus end-directed motor. The tail domain binds to membranous compartments containing phosphatidylinositol 3,4,5-trisphosphate or integrins, and mediates cargo transport along actin filaments (By similarity). Regulates cell shape, cell spreading and cell adhesion. Stimulates the formation and elongation of filopodia. May play a role in neurite outgrowth and axon guidance. Plays a role in formation of the podosome belt in osteoclasts.

Mus musculus (taxid: 10090)

>sp|P79114|MYO10_BOVIN Unconventional myosin-X OS=Bos taurus GN=MYO10 PE=1 SV=1

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 28/37 (75%)

Query: 44  SAWFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           S   +AFGNAKT +NNNSSRFGKF+Q+N  + G + G
Sbjct: 201 SPIMEAFGNAKTVYNNNSSRFGKFVQLNIGQKGNIQG 237

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. MYO10 binds to actin filaments and actin bundles and functions as plus end-directed motor. The tail domain binds to membranous compartments containing phosphatidylinositol 3,4,5-trisphosphate, which are then moved relative to actin filaments. Stimulates the formation and elongation of filopodia. Regulates cell shape, cell spreading and cell adhesion. Plays a role in formation of the podosome belt in osteoclasts.

Bos taurus (taxid: 9913)

>sp|P08964|MYO1_YEAST Myosin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MYO1 PE=1 SV=3

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 29/34 (85%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            ++FGNA+T  NNNSSRFGKFI++ + E+GM++G
Sbjct: 231 LESFGNAQTVRNNNSSRFGKFIKIEFNEHGMING 264

Required for cell division.

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)

>sp|D3ZJP6|MYO10_RAT Unconventional myosin-X OS=Rattus norvegicus GN=Myo10 PE=1 SV=1

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 28/37 (75%)

Query: 44  SAWFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           S   +AFGNAKT +NNNSSRFGKF+Q+N  + G + G
Sbjct: 201 SPIMEAFGNAKTVYNNNSSRFGKFVQLNICQKGNIQG 237

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. MYO10 binds to actin filaments and actin bundles and functions as plus end-directed motor. The tail domain binds to membranous compartments containing phosphatidylinositol 3,4,5-trisphosphate or integrins, and mediates cargo transport along actin filaments. Regulates cell shape, cell spreading and cell adhesion. May play a role in neurite outgrowth and axon guidance. Plays a role in formation of the podosome belt in osteoclasts (By similarity). Stimulates the formation and elongation of filopodia.

Rattus norvegicus (taxid: 10116)

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Length	Definition	Q cover	H cover	Identity	E-value
Query	80
383855596	2288	PREDICTED: unconventional myosin-IXa-lik	0.425	0.014	0.941	4e-12
350414458	2176	PREDICTED: myosin-IXa-like [Bombus impat	0.425	0.015	0.941	4e-12
340715385	2139	PREDICTED: LOW QUALITY PROTEIN: myosin-I	0.425	0.015	0.941	4e-12
307214947	2177	Myosin-IXb [Harpegnathos saltator]	0.425	0.015	0.941	4e-12
307173524	2287	Myosin-IXa [Camponotus floridanus]	0.425	0.014	0.941	4e-12
345485984	2155	PREDICTED: myosin-IXa [Nasonia vitripenn	0.425	0.015	0.941	4e-12
328785348	2183	PREDICTED: myosin-IXa [Apis mellifera]	0.425	0.015	0.941	4e-12
380020084	2290	PREDICTED: LOW QUALITY PROTEIN: unconven	0.425	0.014	0.941	4e-12
357623270	1062	hypothetical protein KGM_18974 [Danaus p	0.425	0.032	0.941	4e-12
332022806	2287	Myosin-IXa [Acromyrmex echinatior]	0.425	0.014	0.941	4e-12

>gi|383855596|ref|XP_003703296.1| PREDICTED: unconventional myosin-IXa-like [Megachile rotundata]

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG
Sbjct: 271 LEAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 304

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350414458|ref|XP_003490324.1| PREDICTED: myosin-IXa-like [Bombus impatiens]

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG
Sbjct: 271 LEAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 304

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340715385|ref|XP_003396195.1| PREDICTED: LOW QUALITY PROTEIN: myosin-IXa-like [Bombus terrestris]

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG
Sbjct: 271 LEAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 304

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307214947|gb|EFN89792.1| Myosin-IXb [Harpegnathos saltator]

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG
Sbjct: 271 LEAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 304

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307173524|gb|EFN64434.1| Myosin-IXa [Camponotus floridanus]

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG
Sbjct: 272 LEAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 305

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345485984|ref|XP_001605165.2| PREDICTED: myosin-IXa [Nasonia vitripennis]

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG
Sbjct: 272 LEAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 305

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328785348|ref|XP_003250584.1| PREDICTED: myosin-IXa [Apis mellifera]

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG
Sbjct: 271 LEAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 304

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380020084|ref|XP_003693926.1| PREDICTED: LOW QUALITY PROTEIN: unconventional myosin-IXa-like [Apis florea]

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG
Sbjct: 271 LEAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 304

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357623270|gb|EHJ74495.1| hypothetical protein KGM_18974 [Danaus plexippus]

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG
Sbjct: 270 LEAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 303

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332022806|gb|EGI63079.1| Myosin-IXa [Acromyrmex echinatior]

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/34 (94%), Positives = 33/34 (97%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG
Sbjct: 271 LEAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 304

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

---

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Length	Definition	Q cover	H cover	Identity	E-value
Query	80
UNIPROTKB|E1BS57	2001	Gga.50857 "Uncharacterized pro	0.412	0.016	0.878	1.2e-09
UNIPROTKB|E1C471	2031	Gga.50857 "Uncharacterized pro	0.412	0.016	0.878	1.2e-09
MGI|MGI:106624	2114	Myo9b "myosin IXb" [Mus muscul	0.412	0.015	0.878	1.2e-09
UNIPROTKB|E1C470	2140	Gga.50857 "Uncharacterized pro	0.412	0.015	0.878	1.3e-09
RGD|3146	1980	Myo9b "myosin IXb" [Rattus nor	0.412	0.016	0.848	3.9e-09
UNIPROTKB|Q4W1H3	2010	Myo9b "Unconventional myosin-I	0.412	0.016	0.848	4e-09
ZFIN|ZDB-GENE-080424-5	2522	myo9al1 "myosin IXa-like 1" [D	0.412	0.013	0.848	4e-09
UNIPROTKB|G3MXH1	1104	Bt.27781 "Uncharacterized prot	0.412	0.029	0.848	4.1e-09
UNIPROTKB|E1BNV7	2159	MYO9B "Uncharacterized protein	0.412	0.015	0.848	4.3e-09
UNIPROTKB|E2R266	2161	MYO9B "Uncharacterized protein	0.412	0.015	0.848	4.3e-09

UNIPROTKB|E1BS57 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)]

 Score = 156 (60.0 bits), Expect = 1.2e-09, P = 1.2e-09
 Identities = 29/33 (87%), Positives = 31/33 (93%)

Query:    48 QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
             +AFGNAKTAHNNNSSRFGKFIQVNY ENG+V G
Sbjct:   279 EAFGNAKTAHNNNSSRFGKFIQVNYLENGVVRG 311

GO:0003774 "motor activity" evidence=IEA

GO:0035556 "intracellular signal transduction" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0016459 "myosin complex" evidence=IEA

GO:0046872 "metal ion binding" evidence=IEA

UNIPROTKB|E1C471 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)]

 Score = 156 (60.0 bits), Expect = 1.2e-09, P = 1.2e-09
 Identities = 29/33 (87%), Positives = 31/33 (93%)

Query:    48 QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
             +AFGNAKTAHNNNSSRFGKFIQVNY ENG+V G
Sbjct:   279 EAFGNAKTAHNNNSSRFGKFIQVNYLENGVVRG 311

GO:0003774 "motor activity" evidence=IEA

GO:0035556 "intracellular signal transduction" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0016459 "myosin complex" evidence=IEA

GO:0046872 "metal ion binding" evidence=IEA

MGI|MGI:106624 Myo9b "myosin IXb" [Mus musculus (taxid:10090)]

 Score = 156 (60.0 bits), Expect = 1.2e-09, P = 1.2e-09
 Identities = 29/33 (87%), Positives = 31/33 (93%)

Query:    48 QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
             +AFGNAKTAHNNNSSRFGKFIQVNY ENG+V G
Sbjct:   280 EAFGNAKTAHNNNSSRFGKFIQVNYLENGIVRG 312

GO:0000146 "microfilament motor activity" evidence=ISO;IDA

GO:0000166 "nucleotide binding" evidence=IEA

GO:0001726 "ruffle" evidence=ISO;IDA

GO:0002548 "monocyte chemotaxis" evidence=IMP

GO:0003774 "motor activity" evidence=ISO

GO:0003779 "actin binding" evidence=ISO

GO:0005096 "GTPase activator activity" evidence=ISO

GO:0005100 "Rho GTPase activator activity" evidence=ISO;IMP;IDA

GO:0005516 "calmodulin binding" evidence=ISO

GO:0005524 "ATP binding" evidence=ISO

GO:0005622 "intracellular" evidence=IMP

GO:0005737 "cytoplasm" evidence=ISO

GO:0005856 "cytoskeleton" evidence=IEA

GO:0005884 "actin filament" evidence=ISO

GO:0005938 "cell cortex" evidence=ISO

GO:0006200 "ATP catabolic process" evidence=ISO

GO:0007165 "signal transduction" evidence=IEA

GO:0007266 "Rho protein signal transduction" evidence=ISO;IMP

GO:0008270 "zinc ion binding" evidence=ISO

GO:0016459 "myosin complex" evidence=IEA

GO:0016887 "ATPase activity" evidence=ISO

GO:0030010 "establishment of cell polarity" evidence=IMP

GO:0030027 "lamellipodium" evidence=ISO;IDA

GO:0030898 "actin-dependent ATPase activity" evidence=ISO

GO:0031941 "filamentous actin" evidence=ISO

GO:0032321 "positive regulation of Rho GTPase activity" evidence=ISO;IMP;IDA

GO:0032433 "filopodium tip" evidence=IDA

GO:0033275 "actin-myosin filament sliding" evidence=ISO

GO:0035556 "intracellular signal transduction" evidence=IEA

GO:0043008 "ATP-dependent protein binding" evidence=ISO

GO:0043531 "ADP binding" evidence=ISO

GO:0046872 "metal ion binding" evidence=IEA

GO:0048246 "macrophage chemotaxis" evidence=IMP

GO:0048471 "perinuclear region of cytoplasm" evidence=ISO

GO:0051015 "actin filament binding" evidence=ISO

GO:0072673 "lamellipodium morphogenesis" evidence=IMP

UNIPROTKB|E1C470 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)]

 Score = 156 (60.0 bits), Expect = 1.3e-09, P = 1.3e-09
 Identities = 29/33 (87%), Positives = 31/33 (93%)

Query:    48 QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
             +AFGNAKTAHNNNSSRFGKFIQVNY ENG+V G
Sbjct:   279 EAFGNAKTAHNNNSSRFGKFIQVNYLENGVVRG 311

GO:0005524 "ATP binding" evidence=IEA

GO:0016459 "myosin complex" evidence=IEA

GO:0046872 "metal ion binding" evidence=IEA

GO:0000146 "microfilament motor activity" evidence=IEA

GO:0001726 "ruffle" evidence=IEA

GO:0002548 "monocyte chemotaxis" evidence=IEA

GO:0005100 "Rho GTPase activator activity" evidence=IEA

GO:0007266 "Rho protein signal transduction" evidence=IEA

GO:0030010 "establishment of cell polarity" evidence=IEA

GO:0030027 "lamellipodium" evidence=IEA

GO:0032433 "filopodium tip" evidence=IEA

GO:0048246 "macrophage chemotaxis" evidence=IEA

GO:0072673 "lamellipodium morphogenesis" evidence=IEA

RGD|3146 Myo9b "myosin IXb" [Rattus norvegicus (taxid:10116)]

 Score = 151 (58.2 bits), Expect = 3.9e-09, P = 3.9e-09
 Identities = 28/33 (84%), Positives = 31/33 (93%)

Query:    48 QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
             +AFGNAKTAHNNNSSRFGKFIQVNY E+G+V G
Sbjct:   280 EAFGNAKTAHNNNSSRFGKFIQVNYLESGIVRG 312

GO:0000146 "microfilament motor activity" evidence=IEA;ISO

GO:0001726 "ruffle" evidence=ISO;IDA

GO:0002548 "monocyte chemotaxis" evidence=IEA;ISO

GO:0003779 "actin binding" evidence=ISO;IDA

GO:0005096 "GTPase activator activity" evidence=IDA

GO:0005100 "Rho GTPase activator activity" evidence=ISO;IMP

GO:0005515 "protein binding" evidence=IPI

GO:0005516 "calmodulin binding" evidence=IEA;ISO

GO:0005524 "ATP binding" evidence=ISO;IMP;IDA

GO:0005622 "intracellular" evidence=ISO

GO:0005737 "cytoplasm" evidence=ISO;IDA

GO:0005884 "actin filament" evidence=IDA

GO:0005938 "cell cortex" evidence=IEA;ISO

GO:0006200 "ATP catabolic process" evidence=ISO;IDA

GO:0007266 "Rho protein signal transduction" evidence=ISO;IDA

GO:0008270 "zinc ion binding" evidence=IDA

GO:0016459 "myosin complex" evidence=IEA

GO:0016887 "ATPase activity" evidence=ISO;IMP;IDA

GO:0030010 "establishment of cell polarity" evidence=IEA;ISO

GO:0030027 "lamellipodium" evidence=ISO;IDA

GO:0030898 "actin-dependent ATPase activity" evidence=IMP;IDA

GO:0031941 "filamentous actin" evidence=ISO

GO:0032321 "positive regulation of Rho GTPase activity" evidence=ISO

GO:0032433 "filopodium tip" evidence=IEA;ISO

GO:0043008 "ATP-dependent protein binding" evidence=IDA

GO:0043531 "ADP binding" evidence=ISO;IMP;IDA

GO:0048246 "macrophage chemotaxis" evidence=IEA;ISO

GO:0048471 "perinuclear region of cytoplasm" evidence=ISO;IDA

GO:0051015 "actin filament binding" evidence=IMP;IDA

GO:0072673 "lamellipodium morphogenesis" evidence=IEA;ISO

GO:0032011 "ARF protein signal transduction" evidence=ISO

GO:0042803 "protein homodimerization activity" evidence=ISO

UNIPROTKB|Q4W1H3 Myo9b "Unconventional myosin-IXb" [Rattus norvegicus (taxid:10116)]

 Score = 151 (58.2 bits), Expect = 4.0e-09, P = 4.0e-09
 Identities = 28/33 (84%), Positives = 31/33 (93%)

Query:    48 QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
             +AFGNAKTAHNNNSSRFGKFIQVNY E+G+V G
Sbjct:   280 EAFGNAKTAHNNNSSRFGKFIQVNYLESGIVRG 312

GO:0003774 "motor activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0016459 "myosin complex" evidence=IEA

GO:0035556 "intracellular signal transduction" evidence=IEA

GO:0046872 "metal ion binding" evidence=IEA

ZFIN|ZDB-GENE-080424-5 myo9al1 "myosin IXa-like 1" [Danio rerio (taxid:7955)]

 Score = 152 (58.6 bits), Expect = 4.0e-09, P = 4.0e-09
 Identities = 28/33 (84%), Positives = 31/33 (93%)

Query:    48 QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
             +AFGNAKTAHNNNSSRFGKFIQVNY+E+G V G
Sbjct:   281 EAFGNAKTAHNNNSSRFGKFIQVNYQESGTVRG 313

GO:0016459 "myosin complex" evidence=IEA

GO:0005622 "intracellular" evidence=IEA

GO:0007165 "signal transduction" evidence=IEA

GO:0003774 "motor activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0035556 "intracellular signal transduction" evidence=IEA

GO:0000166 "nucleotide binding" evidence=IEA

GO:0046872 "metal ion binding" evidence=IEA

UNIPROTKB|G3MXH1 Bt.27781 "Uncharacterized protein" [Bos taurus (taxid:9913)]

 Score = 148 (57.2 bits), Expect = 4.1e-09, P = 4.1e-09
 Identities = 28/33 (84%), Positives = 30/33 (90%)

Query:    48 QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
             +AFGNAKTAHNNNSSRFGKFIQVNY+E G V G
Sbjct:   255 EAFGNAKTAHNNNSSRFGKFIQVNYQETGTVLG 287

GO:0016459 "myosin complex" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0007165 "signal transduction" evidence=IEA

GO:0003774 "motor activity" evidence=IEA

UNIPROTKB|E1BNV7 MYO9B "Uncharacterized protein" [Bos taurus (taxid:9913)]

 Score = 151 (58.2 bits), Expect = 4.3e-09, P = 4.3e-09
 Identities = 28/33 (84%), Positives = 31/33 (93%)

Query:    48 QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
             +AFGNAKTAHNNNSSRFGKFIQVNY E+G+V G
Sbjct:   284 EAFGNAKTAHNNNSSRFGKFIQVNYLESGIVRG 316

GO:0072673 "lamellipodium morphogenesis" evidence=IEA

GO:0048246 "macrophage chemotaxis" evidence=IEA

GO:0032433 "filopodium tip" evidence=IEA

GO:0030027 "lamellipodium" evidence=IEA

GO:0030010 "establishment of cell polarity" evidence=IEA

GO:0007266 "Rho protein signal transduction" evidence=IEA

GO:0005100 "Rho GTPase activator activity" evidence=IEA

GO:0002548 "monocyte chemotaxis" evidence=IEA

GO:0001726 "ruffle" evidence=IEA

GO:0000146 "microfilament motor activity" evidence=IEA

GO:0046872 "metal ion binding" evidence=IEA

GO:0016459 "myosin complex" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

UNIPROTKB|E2R266 MYO9B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]

 Score = 151 (58.2 bits), Expect = 4.3e-09, P = 4.3e-09
 Identities = 28/33 (84%), Positives = 31/33 (93%)

Query:    48 QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
             +AFGNAKTAHNNNSSRFGKFIQVNY E+G+V G
Sbjct:   280 EAFGNAKTAHNNNSSRFGKFIQVNYLESGIVRG 312

GO:0046872 "metal ion binding" evidence=IEA

GO:0016459 "myosin complex" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0035556 "intracellular signal transduction" evidence=IEA

GO:0003774 "motor activity" evidence=IEA

---

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P08799	MYS2_DICDI	No assigned EC number	0.5882	0.425	0.0160	yes	N/A
B2RTY4	MYO9A_HUMAN	No assigned EC number	0.8235	0.425	0.0133	yes	N/A
O14157	MYO3_SCHPO	No assigned EC number	0.5882	0.425	0.0161	yes	N/A
Q99323	MYSN_DROME	No assigned EC number	0.5882	0.425	0.0165	yes	N/A
Q63358	MYO9B_RAT	No assigned EC number	0.8235	0.425	0.0171	yes	N/A
Q9QY06	MYO9B_MOUSE	No assigned EC number	0.8529	0.425	0.0160	yes	N/A
P08964	MYO1_YEAST	No assigned EC number	0.5882	0.425	0.0176	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

---

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Length	Definition	E-value
Query	80
cd01385	692	cd01385, MYSc_type_IX, Myosin motor domain, type I	4e-17
smart00242	677	smart00242, MYSc, Myosin	5e-14
cd01377	693	cd01377, MYSc_type_II, Myosin motor domain, type I	5e-13
COG5022	1463	COG5022, COG5022, Myosin heavy chain [Cytoskeleton	4e-12
cd00124	679	cd00124, MYSc, Myosin motor domain	1e-11
cd01384	674	cd01384, MYSc_type_XI, Myosin motor domain, plant-	1e-11
pfam00063	679	pfam00063, Myosin_head, Myosin head (motor domain)	7e-11
cd01382	717	cd01382, MYSc_type_VI, Myosin motor domain, type V	1e-10
cd01381	671	cd01381, MYSc_type_VII, Myosin motor domain, type	2e-10
cd01380	691	cd01380, MYSc_type_V, Myosin motor domain, type V	2e-10
PTZ00014	821	PTZ00014, PTZ00014, myosin-A; Provisional	2e-10
cd01383	677	cd01383, MYSc_type_VIII, Myosin motor domain, plan	1e-09
cd01378	674	cd01378, MYSc_type_I, Myosin motor domain, type I	3e-09
cd01387	677	cd01387, MYSc_type_XV, Myosin motor domain, type X	2e-08
cd01379	653	cd01379, MYSc_type_III, Myosin motor domain, type	5e-07
cd01386	767	cd01386, MYSc_type_XVIII, Myosin motor domain, typ	0.004

>gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins

 Score = 73.4 bits (180), Expect = 4e-17
 Identities = 30/34 (88%), Positives = 32/34 (94%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKTAHNNNSSRFGKFIQVNY+ENGMV G
Sbjct: 142 LEAFGNAKTAHNNNSSRFGKFIQVNYRENGMVRG 175

Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 692

>gnl|CDD|214580 smart00242, MYSc, Myosin

 Score = 64.5 bits (158), Expect = 5e-14
 Identities = 20/34 (58%), Positives = 26/34 (76%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++++   G + G
Sbjct: 140 LEAFGNAKTLRNNNSSRFGKFIEIHFDAKGKIIG 173

Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin. Length = 677

>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins

 Score = 61.8 bits (151), Expect = 5e-13
 Identities = 19/32 (59%), Positives = 25/32 (78%)

Query: 49  AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           AFGNAKT  N+NSSRFGKFI++++   G + G
Sbjct: 148 AFGNAKTVRNDNSSRFGKFIRIHFGNTGKIAG 179

Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 693

>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton]

 Score = 59.3 bits (144), Expect = 4e-12
 Identities = 20/33 (60%), Positives = 27/33 (81%)

Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  N+NSSRFGK+I++ + ENG + G
Sbjct: 202 EAFGNAKTVRNDNSSRFGKYIKIEFDENGEICG 234

Length = 1463

>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain

 Score = 58.0 bits (141), Expect = 1e-11
 Identities = 20/28 (71%), Positives = 23/28 (82%)

Query: 49  AFGNAKTAHNNNSSRFGKFIQVNYKENG 76
           AFGNAKT  NNNSSRFGKFI++ + E G
Sbjct: 134 AFGNAKTVRNNNSSRFGKFIELQFDETG 161

This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 679

>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport

 Score = 57.8 bits (140), Expect = 1e-11
 Identities = 19/33 (57%), Positives = 26/33 (78%)

Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  NNNSSRFGKF+++ + + G + G
Sbjct: 138 EAFGNAKTVRNNNSSRFGKFVEIQFDDYGRISG 170

This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 674

>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain)

 Score = 55.8 bits (135), Expect = 7e-11
 Identities = 20/34 (58%), Positives = 25/34 (73%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 134 LEAFGNAKTLRNNNSSRFGKFIEIQFDATGSIVG 167

Length = 679

>gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins

 Score = 55.2 bits (133), Expect = 1e-10
 Identities = 23/41 (56%), Positives = 29/41 (70%), Gaps = 2/41 (4%)

Query: 42  IVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           IV A    +AFGNAKT  NNNSSRFGKF+++++ E   V G
Sbjct: 129 IVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKNSVVG 169

Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 717

>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins

 Score = 54.8 bits (132), Expect = 2e-10
 Identities = 18/33 (54%), Positives = 26/33 (78%)

Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  N+NSSRFGK+I +++ + G + G
Sbjct: 132 EAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEG 164

Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 671

>gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins

 Score = 54.6 bits (132), Expect = 2e-10
 Identities = 19/33 (57%), Positives = 26/33 (78%)

Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  N+NSSRFGK+IQ+ + + G + G
Sbjct: 138 EAFGNAKTTRNDNSSRFGKYIQILFDKRGRIIG 170

Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 691

>gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional

 Score = 54.3 bits (131), Expect = 2e-10
 Identities = 22/45 (48%), Positives = 30/45 (66%), Gaps = 3/45 (6%)

Query: 39  STVIVSAWF--QAFGNAKTAHNNNSSRFGKFIQVNYKEN-GMVHG 80
              I++A    +AFGNAKT  NNNSSRFG+F+Q+   E  G+ +G
Sbjct: 220 QNAIMAANPVLEAFGNAKTIRNNNSSRFGRFMQLQLGEEGGIRYG 264

Length = 821

>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata

 Score = 52.1 bits (125), Expect = 1e-09
 Identities = 19/37 (51%), Positives = 28/37 (75%)

Query: 44  SAWFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +   +AFGNAKT+ N+NSSRFGK I++++ E G + G
Sbjct: 133 NPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISG 169

This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 677

>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins

 Score = 51.0 bits (123), Expect = 3e-09
 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 2/27 (7%)

Query: 49  AFGNAKTAHNNNSSRFGKF--IQVNYK 73
           AFGNAKT  NNNSSRFGK+  IQ ++K
Sbjct: 136 AFGNAKTLRNNNSSRFGKYMEIQFDFK 162

Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 674

>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins

 Score = 48.8 bits (116), Expect = 2e-08
 Identities = 19/34 (55%), Positives = 27/34 (79%), Gaps = 1/34 (2%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  N+NSSRFGKF+++ + E G++ G
Sbjct: 133 LEAFGNAKTVRNDNSSRFGKFVEI-FLEGGVIVG 165

In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 677

>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins

 Score = 44.8 bits (106), Expect = 5e-07
 Identities = 18/38 (47%), Positives = 29/38 (76%)

Query: 43  VSAWFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           V++  +AFGNA+T  N+NSSRFGK++++ +  +G V G
Sbjct: 128 VNSLVEAFGNARTGINDNSSRFGKYLEMKFTRSGAVVG 165

Myosin III has been shown to play a role in the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 653

>gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins

 Score = 33.7 bits (77), Expect = 0.004
 Identities = 11/31 (35%), Positives = 21/31 (67%)

Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMV 78
           +AFGN  TA N N++RF + + +++ + G +
Sbjct: 134 EAFGNVSTALNGNATRFTQILSLDFDQTGQI 164

This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 767

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Length	Definition	Probability
Query	80
PTZ00014	821	myosin-A; Provisional	99.93
cd01377	693	MYSc_type_II Myosin motor domain, type II myosins.	99.93
cd01380	691	MYSc_type_V Myosin motor domain, type V myosins. M	99.93
cd01385	692	MYSc_type_IX Myosin motor domain, type IX myosins.	99.92
cd01381	671	MYSc_type_VII Myosin motor domain, type VII myosin	99.92
COG5022	1463	Myosin heavy chain [Cytoskeleton]	99.92
cd01383	677	MYSc_type_VIII Myosin motor domain, plant-specific	99.92
cd01379	653	MYSc_type_III Myosin motor domain, type III myosin	99.92
cd01382	717	MYSc_type_VI Myosin motor domain, type VI myosins.	99.91
cd01384	674	MYSc_type_XI Myosin motor domain, plant-specific t	99.91
cd01386	767	MYSc_type_XVIII Myosin motor domain, type XVIII my	99.91
cd00124	679	MYSc Myosin motor domain. This catalytic (head) do	99.91
cd01378	674	MYSc_type_I Myosin motor domain, type I myosins. M	99.91
smart00242	677	MYSc Myosin. Large ATPases. ATPase; molecular moto	99.9
cd01387	677	MYSc_type_XV Myosin motor domain, type XV myosins.	99.9
PF00063	689	Myosin_head: Myosin head (motor domain); InterPro:	99.89
KOG0163|consensus	1259		99.88
KOG0164|consensus	1001		99.88
KOG0161|consensus	1930		99.84
KOG0162|consensus	1106		99.83
KOG0160|consensus	862		99.79
KOG4229|consensus	1062		99.58
cd01363	186	Motor_domain Myosin and Kinesin motor domain. Thes	97.06
PF07724	171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	94.82
PF13207	121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	94.29
COG0444	316	DppD ABC-type dipeptide/oligopeptide/nickel transp	94.01
PF12846	304	AAA_10: AAA-like domain	93.94
cd02025	220	PanK Pantothenate kinase (PanK) catalyzes the phos	93.64
PF00485	194	PRK: Phosphoribulokinase / Uridine kinase family;	93.4
cd01131	198	PilT Pilus retraction ATPase PilT. PilT is a nucle	93.2
PRK05480	209	uridine/cytidine kinase; Provisional	93.09
PTZ00301	210	uridine kinase; Provisional	92.85
cd02023	198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	92.73
TIGR02322	179	phosphon_PhnN phosphonate metabolism protein/1,5-b	92.63
PF13238	129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	92.51
cd02020	147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	92.39
smart00382	148	AAA ATPases associated with a variety of cellular	92.28
cd01120	165	RecA-like_NTPases RecA-like NTPases. This family i	92.27
PF01580	205	FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00	91.97
cd00009	151	AAA The AAA+ (ATPases Associated with a wide varie	91.82
PF00004	132	AAA: ATPase family associated with various cellula	91.45
cd02028	179	UMPK_like Uridine monophosphate kinase_like (UMPK_	91.33
cd00046	144	DEXDc DEAD-like helicases superfamily. A diverse f	91.26
PRK00300	205	gmk guanylate kinase; Provisional	91.2
TIGR01587	358	cas3_core CRISPR-associated helicase Cas3. This mo	91.19
PRK06696	223	uridine kinase; Validated	91.12
PF04851	184	ResIII: Type III restriction enzyme, res subunit;	91.09
PF04665	241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	91.04
cd02019	69	NK Nucleoside/nucleotide kinase (NK) is a protein	90.97
cd01129	264	PulE-GspE PulE/GspE The type II secretory pathway	90.7
TIGR02524	358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	90.6
TIGR00235	207	udk uridine kinase. Model contains a number of lon	90.44
PF00437	270	T2SE: Type II/IV secretion system protein; InterPr	90.23
TIGR02782	299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	90.12
TIGR02173	171	cyt_kin_arch cytidylate kinase, putative. Proteins	90.07
PRK08233	182	hypothetical protein; Provisional	90.06
COG0572	218	Udk Uridine kinase [Nucleotide transport and metab	89.84
cd01130	186	VirB11-like_ATPase Type IV secretory pathway compo	89.66
TIGR02525	372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	89.65
TIGR01420	343	pilT_fam pilus retraction protein PilT. This model	89.63
cd00820	107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	89.58
PRK06762	166	hypothetical protein; Provisional	89.45
cd01124	187	KaiC KaiC is a circadian clock protein primarily f	89.39
PF13401	131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	89.14
PF01935	229	DUF87: Domain of unknown function DUF87; InterPro:	89.09
cd01918	149	HprK_C HprK/P, the bifunctional histidine-containi	89.04
cd02024	187	NRK1 Nicotinamide riboside kinase (NRK) is an enzy	89.0
COG1123	539	ATPase components of various ABC-type transport sy	88.91
COG2204	464	AtoC Response regulator containing CheY-like recei	88.86
cd00071	137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	88.83
PRK04182	180	cytidylate kinase; Provisional	88.8
PRK00023	225	cmk cytidylate kinase; Provisional	88.72
PF05729	166	NACHT: NACHT domain	88.57
PRK00131	175	aroK shikimate kinase; Reviewed	88.53
PRK13833	323	conjugal transfer protein TrbB; Provisional	88.52
PRK09270	229	nucleoside triphosphate hydrolase domain-containin	88.38
PF13671	143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	88.12
PRK07667	193	uridine kinase; Provisional	88.05
PRK13900	332	type IV secretion system ATPase VirB11; Provisiona	87.98
PF07728	139	AAA_5: AAA domain (dynein-related subfamily); Inte	87.97
PRK13851	344	type IV secretion system protein VirB11; Provision	87.89
PF00910	107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	87.68
COG4172	534	ABC-type uncharacterized transport system, duplica	87.59
PF01583	156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	87.43
TIGR01313	163	therm_gnt_kin carbohydrate kinase, thermoresistant	87.33
COG4608	268	AppF ABC-type oligopeptide transport system, ATPas	87.21
PRK10436	462	hypothetical protein; Provisional	87.18
PRK06547	172	hypothetical protein; Provisional	87.16
TIGR02538	564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	86.94
PF06414	199	Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e	86.91
TIGR03263	180	guanyl_kin guanylate kinase. Members of this famil	86.88
cd02027	149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	86.74
PF13191	185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	86.73
PRK14737	186	gmk guanylate kinase; Provisional	86.63
PF07475	171	Hpr_kinase_C: HPr Serine kinase C-terminal domain;	86.21
PRK03846	198	adenylylsulfate kinase; Provisional	86.2
PRK00889	175	adenylylsulfate kinase; Provisional	86.12
TIGR00455	184	apsK adenylylsulfate kinase (apsK). Important resi	85.87
PRK05541	176	adenylylsulfate kinase; Provisional	85.87
COG1102	179	Cmk Cytidylate kinase [Nucleotide transport and me	85.86
TIGR00150	133	HI0065_YjeE ATPase, YjeE family. Members of this f	85.85
COG2804	500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	85.78
TIGR02533	486	type_II_gspE general secretory pathway protein E.	85.66
PRK07261	171	topology modulation protein; Provisional	85.63
TIGR00554	290	panK_bact pantothenate kinase, bacterial type. Sho	85.44
TIGR02237	209	recomb_radB DNA repair and recombination protein R	85.36
cd03115	173	SRP The signal recognition particle (SRP) mediates	85.35
cd00464	154	SK Shikimate kinase (SK) is the fifth enzyme in th	85.08
cd02034	116	CooC The accessory protein CooC, which contains a	85.01
TIGR03015	269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	84.88
TIGR00017	217	cmk cytidylate kinase. This family consists of cyt	84.75
COG0542	786	clpA ATP-binding subunits of Clp protease and DnaK	84.71
COG1132	567	MdlB ABC-type multidrug transport system, ATPase a	84.63
PRK10751	173	molybdopterin-guanine dinucleotide biosynthesis pr	84.52
smart00487	201	DEXDc DEAD-like helicases superfamily.	84.48
PF13555	62	AAA_29: P-loop containing region of AAA domain	84.48
cd00984	242	DnaB_C DnaB helicase C terminal domain. The hexame	84.31
TIGR01360	188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	84.24
cd02029	277	PRK_like Phosphoribulokinase-like (PRK-like) is a	84.21
TIGR00929	785	VirB4_CagE type IV secretion/conjugal transfer ATP	84.18
TIGR03881	229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	84.17
TIGR02746	797	TraC-F-type type-IV secretion system protein TraC.	83.89
PRK11022	326	dppD dipeptide transporter ATP-binding subunit; Pr	83.77
COG1123	539	ATPase components of various ABC-type transport sy	83.71
TIGR03878	259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	83.49
PRK09473	330	oppD oligopeptide transporter ATP-binding componen	83.24
cd02026	273	PRK Phosphoribulokinase (PRK) is an enzyme involve	82.9
PRK13894	319	conjugal transfer ATPase TrbB; Provisional	82.86
PF00270	169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	82.81
cd03229	178	ABC_Class3 This class is comprised of all BPD (Bin	82.72
PRK11308	327	dppF dipeptide transporter ATP-binding subunit; Pr	82.72
cd01983	99	Fer4_NifH The Fer4_NifH superfamily contains a var	82.61
PRK15093	330	antimicrobial peptide ABC transporter ATP-binding	82.53
PLN02796	347	D-glycerate 3-kinase	82.51
cd01394	218	radB RadB. The archaeal protein radB shares simila	82.4
PRK09361	225	radB DNA repair and recombination protein RadB; Pr	82.39
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309	127	Torsin: Torsin; InterPro: IPR010448 This family co	82.33
cd00227	175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	82.08
cd02021	150	GntK Gluconate kinase (GntK) catalyzes the phospho	81.94
PF06745	226	KaiC: KaiC; InterPro: IPR014774 This entry represe	81.9
TIGR02788	308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	81.87
PRK08118	167	topology modulation protein; Reviewed	81.81
TIGR01166	190	cbiO cobalt transport protein ATP-binding subunit.	81.66
TIGR02639	731	ClpA ATP-dependent Clp protease ATP-binding subuni	81.58
cd03293	220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	81.52
cd01393	226	recA_like RecA is a bacterial enzyme which has rol	81.21
TIGR03420	226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	81.1
PRK10865	857	protein disaggregation chaperone; Provisional	81.0
PRK05439	311	pantothenate kinase; Provisional	80.9
cd03259	213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	80.89
COG1474	366	CDC6 Cdc6-related protein, AAA superfamily ATPase	80.83
PRK00091	307	miaA tRNA delta(2)-isopentenylpyrophosphate transf	80.78
PRK15453	290	phosphoribulokinase; Provisional	80.58
PHA02530	300	pseT polynucleotide kinase; Provisional	80.58
cd03225	211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	80.52
TIGR02673	214	FtsE cell division ATP-binding protein FtsE. This	80.51
cd03270	226	ABC_UvrA_I The excision repair protein UvrA domain	80.47
cd03224	222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	80.46
PRK15079	331	oligopeptide ABC transporter ATP-binding protein O	80.46
PLN02348	395	phosphoribulokinase	80.41
COG1124	252	DppF ABC-type dipeptide/oligopeptide/nickel transp	80.4
TIGR00176	155	mobB molybdopterin-guanine dinucleotide biosynthes	80.39
TIGR02868	529	CydC thiol reductant ABC exporter, CydC subunit. T	80.25
PRK13891	852	conjugal transfer protein TrbE; Provisional	80.18
cd01123	235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	80.18

>PTZ00014 myosin-A; Provisional

Probab=99.93  E-value=1.2e-26  Score=189.94  Aligned_cols=74  Identities=34%  Similarity=0.458  Sum_probs=66.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+.+..      ...++++|+++  ||||||||||.+||||||||||++|+|+.+|.|
T Consensus       188 iSGESGAGKTe~tK~im~yla~~~~~~~------~~~ie~~Il~sNpiLEAFGNAKT~rNdNSSRFGKfi~i~F~~~g~i  261 (821)
T PTZ00014        188 VSGESGAGKTEATKQIMRYFASSKSGNM------DLKIQNAIMAANPVLEAFGNAKTIRNNNSSRFGRFMQLQLGEEGGI  261 (821)
T ss_pred             EEcCCCCCchHHHHHHHHHHHHhccCCC------cccHHHHHHHHHHHHHHhhccCcCCCCCcCcceeEEEEEEcCCCcE
Confidence            5799999999999999999998764321      15699999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       262 ~G  263 (821)
T PTZ00014        262 RY  263 (821)
T ss_pred             ee
Confidence            76

>cd01377 MYSc_type_II Myosin motor domain, type II myosins

Probab=99.93  E-value=2.5e-26  Score=185.16  Aligned_cols=80  Identities=34%  Similarity=0.472  Sum_probs=68.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCccc--CccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCC
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNR--DTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENG   76 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~--~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g   76 (80)
                      |.|||||||||++|++|+||+..+.+....  .......++++|+++  ||||||||||.+|+||||||||++|+|+..|
T Consensus        96 iSGESGAGKTes~K~il~yLa~~~~~~~~~~~~~~~~~~i~~~il~snpiLEAFGNAkT~rN~NSSRFGK~i~l~f~~~g  175 (693)
T cd01377          96 ITGESGAGKTENTKKVIQYLASVAASSKKKKQSGKGQGTLEDQILQANPILEAFGNAKTVRNDNSSRFGKFIRIHFGNTG  175 (693)
T ss_pred             EEcCCCCCchHHHHHHHHHHHhhcCCCCcccccccccccHHHHHHHHHHHHHHhhccccCCCCCccccceeEEEEECCCC
Confidence            579999999999999999999987643211  112236799999999  9999999999999999999999999999999


Q ss_pred             eecC
Q psy17057         77 MVHG   80 (80)
Q Consensus        77 ~l~G   80 (80)
                      +|.|
T Consensus       176 ~i~G  179 (693)
T cd01377         176 KIAG  179 (693)
T ss_pred             CEEE
Confidence            9876

Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydro

>cd01380 MYSc_type_V Myosin motor domain, type V myosins

Probab=99.93  E-value=5.6e-26  Score=183.04  Aligned_cols=78  Identities=28%  Similarity=0.382  Sum_probs=68.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|+||+||+..+.....  ......++++|+++  ||||||||+|.+|+||||||||++|+|+..|+|
T Consensus        91 iSGESGaGKTes~K~i~~yLa~~~~~~~~--~~~~~~i~~~il~snpiLEAFGNAkT~~N~NSSRFGK~~~l~f~~~g~i  168 (691)
T cd01380          91 VSGESGAGKTVSAKYIMRYFASVGGSDSR--EVSETQVEEKVLASNPIMEAFGNAKTTRNDNSSRFGKYIQILFDKRGRI  168 (691)
T ss_pred             EEcCCCCCchHHHHHHHHHHHHhcCCCcc--cccccCHHHHHHHHHHHHHHhhcCCCCCCCCccccceEEEEEECCCCCE
Confidence            57999999999999999999988754211  11236799999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       169 ~G  170 (691)
T cd01380         169 IG  170 (691)
T ss_pred             EE
Confidence            76

Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an act

>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins

Probab=99.92  E-value=7.6e-26  Score=182.39  Aligned_cols=75  Identities=49%  Similarity=0.602  Sum_probs=66.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+....     ....++++|+++  ||||||||+|.+|+||||||||++|+|+.+|.|
T Consensus        99 isGESGAGKTet~K~il~yL~~~s~~~~-----~~~~i~~~i~~snpiLEAFGNAkT~~N~NSSRFGK~i~l~F~~~g~i  173 (692)
T cd01385          99 ISGESGSGKTESTNFLIHHLTALSQKGY-----AGSGVEQTILSAGPVLEAFGNAKTAHNNNSSRFGKFIQVNYRENGMV  173 (692)
T ss_pred             EecCCCCCchHHHHHHHHHHHHhccCCc-----cCCcHHHHHHHHHHHHHHhhccccCCCCCccccceeEEEEECCCCCE
Confidence            5799999999999999999998764211     125699999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       174 ~G  175 (692)
T cd01385         174 RG  175 (692)
T ss_pred             EE
Confidence            76

Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the hea

>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins

Probab=99.92  E-value=8e-26  Score=181.76  Aligned_cols=72  Identities=35%  Similarity=0.541  Sum_probs=65.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+...        ..++++|+++  ||||||||+|.+|+||||||||++|+|+..|+|
T Consensus        91 isGESGaGKTes~K~i~~yLa~~s~~~--------~~i~~~il~snpiLEAFGNAkT~~N~NSSRFGK~~~l~F~~~g~i  162 (671)
T cd01381          91 ISGESGAGKTESTKLILQYLAAISGKH--------SWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAI  162 (671)
T ss_pred             EEcCCCCCeehHHHHHHHHHHHhcCCC--------CcHHHHHHHHHHHHHHhhccccCCCCCccccceeEEEEECCCCcE
Confidence            479999999999999999999886421        4599999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       163 ~G  164 (671)
T cd01381         163 EG  164 (671)
T ss_pred             EE
Confidence            76

Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydr

>COG5022 Myosin heavy chain [Cytoskeleton]

Probab=99.92  E-value=1.2e-25  Score=190.00  Aligned_cols=76  Identities=34%  Similarity=0.510  Sum_probs=68.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||.+|.||+||+......    +.....++++|+++  ||||||||+|.+||||||||||++|.|+..|.|
T Consensus       157 ISGESGAGKTe~aK~ImqYlasv~~s~----~~~~~~iE~~ILaTNPILEAFGNAkTvRNdNSSRFGKyikI~Fd~~g~I  232 (1463)
T COG5022         157 ISGESGAGKTENAKRIMQYLASVTSSS----TVEISSIEKQILATNPILEAFGNAKTVRNDNSSRFGKYIKIEFDENGEI  232 (1463)
T ss_pred             EecCCCCCchHHHHHHHHHHHHhccCC----cchHHHHHHHHHhcchHHHHhccccccccCCcccccceEEEEECCCCce
Confidence            579999999999999999998876542    23457899999999  999999999999999999999999999999999


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       233 ~G  234 (1463)
T COG5022         233 CG  234 (1463)
T ss_pred             ec
Confidence            86

>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata

Probab=99.92  E-value=2.5e-25  Score=179.15  Aligned_cols=71  Identities=35%  Similarity=0.551  Sum_probs=65.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+.+         ..++++|+++  ||||||||+|.+|+||||||||++|+|+.+|.|
T Consensus        97 isGESGaGKTe~~K~i~~yLa~~~~~---------~~i~~~il~snpiLEaFGNAkT~~N~NSSRFGK~~~l~f~~~g~i  167 (677)
T cd01383          97 ISGESGAGKTETAKIAMQYLASLGGG---------SGIEYEILQTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKI  167 (677)
T ss_pred             EecCCCCCcchHHHHHHHHHHhhCCC---------CcHHHHHHHHHHHHHHhhccccCCCCCcCccceeEEEEECCCCcE
Confidence            57999999999999999999987543         3589999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       168 ~g  169 (677)
T cd01383         168 SG  169 (677)
T ss_pred             EE
Confidence            76

This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates f

>cd01379 MYSc_type_III Myosin motor domain, type III myosins

Probab=99.92  E-value=3.2e-25  Score=177.99  Aligned_cols=73  Identities=30%  Similarity=0.459  Sum_probs=66.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++++||+..+.+.       ...++++|+++  ||||||||+|.+|+||||||||++|+|+.+|+|
T Consensus        91 isGESGsGKTet~K~l~~yL~~~~~~~-------~~~i~~~il~snpiLEAFGNAkT~~N~NSSRFGK~i~l~f~~~g~i  163 (653)
T cd01379          91 ISGESGSGKTESAHLLVQQLTVLGKAN-------NRTLQEKILQVNSLVEAFGNARTGINDNSSRFGKYLEMKFTRSGAV  163 (653)
T ss_pred             EecCCCCCchHHHHHHHHHHHHhcCCC-------CccHHHHHHHHHHHHHHhhccCcCCCCCcccceeEEEEEECCCCcE
Confidence            479999999999999999998775431       15699999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       164 ~G  165 (653)
T cd01379         164 VG  165 (653)
T ss_pred             EE
Confidence            76

Myosin III has been shown to play a role in the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the

>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins

Probab=99.91  E-value=4.7e-25  Score=178.37  Aligned_cols=72  Identities=40%  Similarity=0.521  Sum_probs=65.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+......        ..++++|+++  ||||||||+|.+|+||||||||++|+|+.+|+|
T Consensus        96 isGESGaGKTes~K~il~yLa~~~~~~--------~~i~~~il~snpiLEAFGNAkT~~N~NSSRFGK~~~l~f~~~g~i  167 (717)
T cd01382          96 VSGESGAGKTENTKFVLRYLTESYGSG--------QDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKNSV  167 (717)
T ss_pred             EecCCCCChhHHHHHHHHHHHhhccCC--------ccHHHHHHHHHHHHHHhhccccCCCCCcccceeEEEEEECCCCCE
Confidence            479999999999999999998765321        5699999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       168 ~G  169 (717)
T cd01382         168 VG  169 (717)
T ss_pred             eE
Confidence            76

Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of

>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport

Probab=99.91  E-value=4.7e-25  Score=177.51  Aligned_cols=76  Identities=30%  Similarity=0.416  Sum_probs=67.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+.....    ....++++|+++  ||||||||+|.+|+||||||||++|+|+.+|.|
T Consensus        93 isGESGaGKTe~~K~il~yLa~~~~~~~~----~~~~i~~~il~~npiLEAFGNAkT~~N~NSSRFGK~~~l~f~~~g~i  168 (674)
T cd01384          93 VSGESGAGKTETTKMLMRYLAYMGGRAGV----EGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDDYGRI  168 (674)
T ss_pred             EECCCCCCchhHHHHHHHHHHhhcCCCCc----ccccHHHHHHHHHHHHHHhhCCCCCCCCCcchhheeEEEEECCCCcE
Confidence            46999999999999999999988643211    125799999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       169 ~G  170 (674)
T cd01384         169 SG  170 (674)
T ss_pred             EE
Confidence            76

This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new act

>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins

Probab=99.91  E-value=7.6e-25  Score=178.30  Aligned_cols=74  Identities=22%  Similarity=0.260  Sum_probs=63.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+....     . ....++|+++  ||||||||+|.+|+||||||||++|+|+..|.|
T Consensus        91 iSGESGAGKTe~tK~i~~yla~~~~~~~-----~-~~~~e~i~~~npiLEAFGNAkT~rNdNSSRFGK~i~l~F~~~g~i  164 (767)
T cd01386          91 FLGRSGAGKTTSCKHALEYLALAAGSVD-----G-RVSVEKVRALFTILEAFGNVSTALNGNATRFTQILSLDFDQTGQI  164 (767)
T ss_pred             EecCCCCCcHHHHHHHHHHHHhccCCCC-----c-ccHHHHHHhhchHHHHhhccCcCCCCCcCcceeEEEEEECCCCcE
Confidence            5799999999999999999998764311     0 1224578888  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       165 ~G  166 (767)
T cd01386         165 AS  166 (767)
T ss_pred             eE
Confidence            76

This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the

>cd00124 MYSc Myosin motor domain

Probab=99.91  E-value=1.1e-24  Score=174.79  Aligned_cols=73  Identities=37%  Similarity=0.514  Sum_probs=66.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+...       ...++++|+.+  ||||||||+|.+|+||||||||++|+|+.+|+|
T Consensus        91 isGESGaGKTe~~k~il~yl~~~~~~~-------~~~i~~~i~~~n~iLEaFGNAkT~~N~NSSRfGk~~~l~f~~~g~i  163 (679)
T cd00124          91 ISGESGAGKTENTKLIMKYLASLAGSN-------DTGIEEKILAANPILEAFGNAKTVRNNNSSRFGKFIELQFDETGKI  163 (679)
T ss_pred             EecCCCCCchHHHHHHHHHHHhccCCC-------cchHHHHHHHHhHHHHHhcccccCCCCCcccceeEEEEEECCCCcE
Confidence            579999999999999999999887542       25699999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       164 ~g  165 (679)
T cd00124         164 SG  165 (679)
T ss_pred             eE
Confidence            76

This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the fila

>cd01378 MYSc_type_I Myosin motor domain, type I myosins

Probab=99.91  E-value=1.1e-24  Score=175.16  Aligned_cols=75  Identities=32%  Similarity=0.457  Sum_probs=66.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+....     ....++++|+++  ||||||||+|.+|+||||||||++|+|+..|.+
T Consensus        91 isGESGaGKTe~~K~il~yL~~~~~~~~-----~~~~i~~~i~~~npiLEAFGNAkT~~N~NSSRFgk~~~l~f~~~g~i  165 (674)
T cd01378          91 ISGESGAGKTEAAKKIMQYIAAVSGGGQ-----KVERVKDVILQSNPLLEAFGNAKTLRNNNSSRFGKYMEIQFDFKGDP  165 (674)
T ss_pred             EEcCCCCCcchHHHHHHHHHHhcCCCCC-----ccccHHHHHHHHHHHHHHhhccccCCCCCcchhheeEEEEECCCCCE
Confidence            4799999999999999999998865421     135699999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       166 ~g  167 (674)
T cd01378         166 VG  167 (674)
T ss_pred             ee
Confidence            76

Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 picon

>smart00242 MYSc Myosin

Probab=99.90  E-value=2.1e-24  Score=173.46  Aligned_cols=75  Identities=33%  Similarity=0.476  Sum_probs=67.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++++||+..+.+..     ....++++|+++  ||||||||+|.+|+||||||||++|+|+.+|+|
T Consensus        97 isGESGaGKTe~~k~il~yl~~~~~~~~-----~~~~i~~~i~~~n~iLEAFGNAkT~~N~NSSRfgk~~~l~f~~~g~i  171 (677)
T smart00242       97 ISGESGAGKTENTKKIMQYLAAVSGSNT-----SVGSVEDQILESNPILEAFGNAKTVRNNNSSRFGKFIEIHFDAKGKI  171 (677)
T ss_pred             EecCCCCcchHHHHHHHHHHHhhcCCCC-----ccccHHHHHHHHHHHHHHhhccccCCCCCccchheeEEEEECCCCcE
Confidence            4799999999999999999998875421     136799999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       172 ~g  173 (677)
T smart00242      172 VG  173 (677)
T ss_pred             eE
Confidence            76

Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.

>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins

Probab=99.90  E-value=3.8e-24  Score=172.23  Aligned_cols=72  Identities=36%  Similarity=0.561  Sum_probs=64.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+.+.       ...++++|+++  ||||||||+|.+|+||||||||++|+|+ +|.|
T Consensus        92 isGESGaGKTe~~k~il~yl~~~~~~~-------~~~i~~~il~snpiLEAFGNAkT~~N~NSSRfGk~~~l~f~-~g~i  163 (677)
T cd01387          92 ISGESGSGKTEATKLILRYLAAMNQGG-------SAVITEQILEATPLLEAFGNAKTVRNDNSSRFGKFVEIFLE-GGVI  163 (677)
T ss_pred             EEcCCCCCeehHHHHHHHHHHhhcCCC-------cchHHHHHHHHHHHHHHHhCcCCCCCCCccccceEEEEEec-CCcE
Confidence            469999999999999999999886542       14699999999  9999999999999999999999999995 6887


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       164 ~G  165 (677)
T cd01387         164 VG  165 (677)
T ss_pred             eE
Confidence            65

In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus

>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril

Probab=99.89  E-value=9.1e-24  Score=168.54  Aligned_cols=77  Identities=34%  Similarity=0.501  Sum_probs=68.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+.....   .....++++|+++  ||||||||+|.+|+||||||||++|+|+.+|.+
T Consensus        90 isGeSGsGKTe~~k~il~~L~~~~~~~~~---~~~~~i~~~i~~~~~iLeaFGnAkT~~N~nSSRfgk~~~l~f~~~~~~  166 (689)
T PF00063_consen   90 ISGESGSGKTETSKLILRYLASLSSSSSS---SKSSSIEKKILAANPILEAFGNAKTPRNDNSSRFGKFIELQFDDSGQI  166 (689)
T ss_dssp             EEESTTSSHHHHHHHHHHHHHHHSSSSSS---TCTTHHHHHHHHHHHHHHHHHEEEESSETTEESSEEEEEEEEETTSSE
T ss_pred             eccccccccccchHHHHHHHhhhcccccc---cccccccceEEeccchhhhhcccccccCCcccccceEEEEEecccccc
Confidence            47999999999999999999998765321   2236799999998  999999999999999999999999999999988


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       167 ~g  168 (689)
T PF00063_consen  167 VG  168 (689)
T ss_dssp             EE
T ss_pred             cc
Confidence            75

Myosin is a major component of thick filaments and exists as a hexamer of 2 heavy chains [], 2 alkali light chains, and 2 regulatory light chains. The heavy chain can be subdivided into the N-terminal globular head and the C-terminal coiled-coil rod-like tail, although some forms have a globular region in their C-terminal. There are many cell-specific isoforms of myosin heavy chains, coded for by a multi-gene family []. Myosin interacts with actin to convert chemical energy, in the form of ATP, to mechanical energy []. The 3-D structure of the head portion of myosin has been determined [] and a model for actin-myosin complex has been constructed []. The globular head is well conserved, some highly-conserved regions possibly relating to functional and structural domains []. The rod-like tail starts with an invariant proline residue, and contains many repeats of a 28 residue region, interrupted at 4 regularly-spaced points known as skip residues. Although the sequence of the tail is not well conserved, the chemical character is, hydrophobic, charged and skip residues occuring in a highly ordered and repeated fashion [].; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 1LKX_A 2V26_A 2BKI_A 3L9I_A 2BKH_A 2X51_A 2VB6_A 2VAS_A 1OE9_A 1W8J_A ....

>KOG0163|consensus

Probab=99.88  E-value=2.5e-23  Score=170.00  Aligned_cols=72  Identities=42%  Similarity=0.619  Sum_probs=65.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      +.|||||||||.+|++|+||+.. .+.       ...++++|+.+  ||||||||||++|+||||||||++|||+..|.+
T Consensus       149 VSGESGAGKTEstK~vLrYLces-~gs-------ag~Iq~rileaNPiLEAFGNAKT~RNNNSSRFGKFveiHf~dk~~V  220 (1259)
T KOG0163|consen  149 VSGESGAGKTESTKAVLRYLCES-WGS-------AGPIQTRILEANPILEAFGNAKTLRNNNSSRFGKFVEIHFDDKGQV  220 (1259)
T ss_pred             EecCCCCCcchhHHHHHHHHHhc-cCC-------CCcHHHHHhccChHHHHhccchhhccCChhhccceEEEEEcCCCce
Confidence            36999999999999999998764 332       26799999999  999999999999999999999999999999988


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       221 vG  222 (1259)
T KOG0163|consen  221 VG  222 (1259)
T ss_pred             ec
Confidence            76

>KOG0164|consensus

Probab=99.88  E-value=3.4e-23  Score=168.13  Aligned_cols=77  Identities=29%  Similarity=0.451  Sum_probs=66.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|+||+|+++..+..-   ......+..+++++  ||||||||||.+||||||||||+.|+||-.|--
T Consensus        99 ISGESGAGKTEASK~iMqYiAAvtn~~q---q~eierVKn~LLqSN~VLEAFGNAKT~RNdNSSRFGKYMDInFDfKGdP  175 (1001)
T KOG0164|consen   99 ISGESGAGKTEASKIIMQYIAAVTNASQ---QGEIERVKNVLLQSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDP  175 (1001)
T ss_pred             EecCCCCCccHHHHHHHHHHHHhcCccc---cchHHHHHHHHHhcchHHHHhcccccccCCchhhhhcceeeeccccCCc
Confidence            6799999999999999999998876531   12246788999999  999999999999999999999999999988765


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       176 vG  177 (1001)
T KOG0164|consen  176 VG  177 (1001)
T ss_pred             cc
Confidence            44

>KOG0161|consensus

Probab=99.84  E-value=1.9e-21  Score=168.64  Aligned_cols=79  Identities=34%  Similarity=0.492  Sum_probs=68.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||.+|-|++||+........ +.+....++.+|+++  +|||||||+|.+|+|||||||||+|+|+.+|+|
T Consensus       173 iTGESGAGKTeNTKkVIqyla~va~~~~~-~~~~~~~le~qi~q~npvLeaFGNa~tvrn~NssRFgkfirI~F~~~G~i  251 (1930)
T KOG0161|consen  173 ITGESGAGKTENTKKVIQYLASVASSSTK-KVKIEGTLEDQILQANPVLEAFGNAKTVRNDNSSRFGKFIRIHFDATGKI  251 (1930)
T ss_pred             eecCCCCCcchhHHHHHHHHHHHhhcccc-CCCCCCChHHHHHHhCchHHHhcChhhhcCCCCcccceeEEEecCCCCcc
Confidence            57999999999999999999887765321 112126899999999  999999999999999999999999999999999


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       252 ~~  253 (1930)
T KOG0161|consen  252 AG  253 (1930)
T ss_pred             ch
Confidence            76

>KOG0162|consensus

Probab=99.83  E-value=3.1e-21  Score=157.30  Aligned_cols=74  Identities=30%  Similarity=0.472  Sum_probs=65.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||.+|.||+|..+.|.+.     .....+.+.||++  +||+||||+|++|+||||||||+||+|+..|.-
T Consensus       109 ISGESGAGKT~aAK~IM~YIs~vS~~g-----~kvq~vkdiiL~sNPLLEaFG~akTvRNnNSSR~GKY~Ei~Fs~ggeP  183 (1106)
T KOG0162|consen  109 ISGESGAGKTVAAKRIMQYISRVSGGG-----EKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYLEIQFSRGGEP  183 (1106)
T ss_pred             EecCCCCCchHHHHHHHHHHHHhccCC-----cchhhhhhHhhccchHHHHhcchhhhccCCcccccceEEEEecCCCCc
Confidence            579999999999999999999988542     1247799999999  999999999999999999999999999987654


Q ss_pred             c
Q psy17057         79 H   79 (80)
Q Consensus        79 ~   79 (80)
                      .
T Consensus       184 ~  184 (1106)
T KOG0162|consen  184 D  184 (1106)
T ss_pred             C
Confidence            3

>KOG0160|consensus

Probab=99.79  E-value=2e-20  Score=153.89  Aligned_cols=74  Identities=30%  Similarity=0.434  Sum_probs=67.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      +.||||||||+++|++|+||+.....      .....+|++++.+  ++|+||||+|.+|+||||||||++|+|+..|+|
T Consensus        99 vsGESGAgkT~~aK~~m~yla~v~~~------~~~~~vE~~vL~snpi~EafgNakT~rndnsSrFgK~iei~Fd~~~~I  172 (862)
T KOG0160|consen   99 VSGESGAGKTETAKYLMEYLASVGGS------VEGRSIENKVLASNPILEAFGNAKTTRNDNSSRFGKVIEITFDQQGRI  172 (862)
T ss_pred             eeCCCCCchhHHHHHHHHHHHHHhcc------chhhHHHHHHHhcCCcchhhccchhhhcccHHHhhhHHHHhhhhhccc
Confidence            47999999999999999999888653      1237899999998  999999999999999999999999999999999


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       173 ~G  174 (862)
T KOG0160|consen  173 SG  174 (862)
T ss_pred             cc
Confidence            86

>KOG4229|consensus

Probab=99.58  E-value=1.1e-15  Score=128.17  Aligned_cols=73  Identities=38%  Similarity=0.594  Sum_probs=66.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.||||+||||.++++++||+.++.+.       ..++++.|+.+  +||+||||+|.+|+||||||||++++|..+|.+
T Consensus       153 isGesgsGktest~l~~~~Ls~Lsq~~-------~~~~e~~il~a~~llEafgnA~t~~ndnssrfgk~i~~~~~~~g~i  225 (1062)
T KOG4229|consen  153 ISGESGSGKTESTKLLWQFLSILSQGN-------NSPVEQLILSANPLLEAFGNAKTPRNDNSSRFGKYIKVNFRKTGII  225 (1062)
T ss_pred             EecccCCCCchhhHHHHHHHHHHhcCC-------CCchhhhhhcchHHHHHhcccCCcccCchhhhhheEEeccccCCCC
Confidence            469999999999999999999998531       26789999998  999999999999999999999999999999988


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       226 ~G  227 (1062)
T KOG4229|consen  226 EG  227 (1062)
T ss_pred             Cc
Confidence            76

>cd01363 Motor_domain Myosin and Kinesin motor domain

Probab=97.06  E-value=0.00022  Score=49.08  Aligned_cols=30  Identities=27%  Similarity=0.204  Sum_probs=25.3

Q ss_pred             HHHHhc-CccccCCCCCCCccceEEEEeCCC
Q psy17057         46 WFQAFG-NAKTAHNNNSSRFGKFIQVNYKEN   75 (80)
Q Consensus        46 ileafG-nAkT~~n~nSSrfGk~~~l~f~~~   75 (80)
                      ..+++. ++.|..|++|||+..+++|++...
T Consensus        64 ~g~~~R~~~~t~~N~~SSRsH~i~~i~v~~~   94 (186)
T cd01363          64 KGNANRTTAATAMNEHSSRSHSVFRIHFGGK   94 (186)
T ss_pred             hccccccccccCCCCccCcccEEEEEEEEEe
Confidence            444677 899999999999999999998643

These ATPases belong to the P-loop NTPase family and provide the driving force in myosin and kinesin mediated processes.

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []

Probab=94.82  E-value=0.019  Score=39.40  Aligned_cols=21  Identities=24%  Similarity=0.298  Sum_probs=19.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      ++|+||.|||++++.+.++|-
T Consensus         8 l~GpsGvGKT~la~~la~~l~   28 (171)
T PF07724_consen    8 LAGPSGVGKTELAKALAELLF   28 (171)
T ss_dssp             EESSTTSSHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHhc
Confidence            479999999999999999887

The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of ATPase AAA-2 domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. Some of these ATPases function as a chaperone subunit of a proteasome-like degradation complex. This ATPase family includes some proteins not detected by IPR003959 from INTERPRO.; GO: 0005524 ATP binding; PDB: 1R6B_X 1KSF_X 3PXI_C 1KYI_T 1G3I_S 1OFH_B 1OFI_A 1G41_A 1IM2_A 1HQY_E ....

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A

Probab=94.29  E-value=0.027  Score=35.00  Aligned_cols=20  Identities=15%  Similarity=0.157  Sum_probs=17.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||.+++.+...+
T Consensus         4 I~G~~gsGKST~a~~La~~~   23 (121)
T PF13207_consen    4 ISGPPGSGKSTLAKELAERL   23 (121)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            57999999999999998864

...

>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]

Probab=94.01  E-value=0.024  Score=43.21  Aligned_cols=21  Identities=14%  Similarity=0.237  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.||||+|||.+.+-||..|-
T Consensus        36 iVGESGsGKS~~~~aim~llp   56 (316)
T COG0444          36 IVGESGSGKSVLAKAIMGLLP   56 (316)
T ss_pred             EEcCCCCCHHHHHHHHHhccC
Confidence            469999999999999999763

>PF12846 AAA_10: AAA-like domain

Probab=93.94  E-value=0.046  Score=38.16  Aligned_cols=26  Identities=23%  Similarity=0.167  Sum_probs=22.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccC
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFG   26 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~   26 (80)
                      |.|+||+|||.+.+.++..++.....
T Consensus         6 i~G~tGsGKT~~~~~l~~~~~~~g~~   31 (304)
T PF12846_consen    6 ILGKTGSGKTTLLKNLLEQLIRRGPR   31 (304)
T ss_pred             EECCCCCcHHHHHHHHHHHHHHcCCC
Confidence            57999999999999999888776654

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway

Probab=93.64  E-value=0.055  Score=38.33  Aligned_cols=21  Identities=29%  Similarity=0.275  Sum_probs=18.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.+|||||-+++.+...|.
T Consensus         4 I~G~sGSGKTTla~~L~~~l~   24 (220)
T cd02025           4 IAGSVAVGKSTTARVLQALLS   24 (220)
T ss_pred             eeCCCCCCHHHHHHHHHHHHh
Confidence            689999999999999988774

The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2

Probab=93.40  E-value=0.046  Score=37.38  Aligned_cols=22  Identities=23%  Similarity=0.256  Sum_probs=19.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|.||||||-+++.+...|-.
T Consensus         4 I~G~sgSGKTTla~~L~~~L~~   25 (194)
T PF00485_consen    4 IAGPSGSGKTTLAKRLAQILNK   25 (194)
T ss_dssp             EEESTTSSHHHHHHHHHHHHTT
T ss_pred             EECCCCCCHHHHHHHHHHHhCc
Confidence            6899999999999999888853

7.1.19 from EC catalyses the ATP-dependent phosphorylation of ribulose-5-phosphate to ribulose-1,5-phosphate, a key step in the pentose phosphate pathway where carbon dioxide is assimilated by autotrophic organisms []. In general, plant enzymes are light-activated by the thioredoxin/ferredoxin system, while those from photosynthetic bacteria are regulated by a system that has an absolute requirement for NADH. Thioredoxin/ferredoxin regulation is mediated by the reversible oxidation/reduction of sulphydryl and disulphide groups. Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway. It catalyzes the following reaction: ATP + Uridine = ADP + UMP Pantothenate kinase (2.7.1.33 from EC) catalyzes the rate-limiting step in the biosynthesis of coenzyme A, the conversion of pantothenate to D-4'-phosphopantothenate in the presence of ATP. ; GO: 0005524 ATP binding, 0016301 kinase activity, 0008152 metabolic process; PDB: 2ZSE_A 2ZS7_A 3AF0_A 3AVP_A 2ZS9_A 2ZS8_A 3AEZ_A 2ZSB_A 2ZSD_A 2GEV_A ....

>cd01131 PilT Pilus retraction ATPase PilT

Probab=93.20  E-value=0.061  Score=37.24  Aligned_cols=22  Identities=14%  Similarity=0.111  Sum_probs=19.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|+||+|||-+.+.++.++..
T Consensus         6 I~GptGSGKTTll~~ll~~~~~   27 (198)
T cd01131           6 VTGPTGSGKSTTLAAMIDYINK   27 (198)
T ss_pred             EECCCCCCHHHHHHHHHHHhhh
Confidence            5899999999999988888753

PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.

>PRK05480 uridine/cytidine kinase; Provisional

Probab=93.09  E-value=0.065  Score=36.84  Aligned_cols=20  Identities=25%  Similarity=0.262  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||+|||-+++.+.+.+
T Consensus        11 I~G~sGsGKTTl~~~l~~~l   30 (209)
T PRK05480         11 IAGGSGSGKTTVASTIYEEL   30 (209)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            58999999999999999887

>PTZ00301 uridine kinase; Provisional

Probab=92.85  E-value=0.076  Score=37.70  Aligned_cols=20  Identities=15%  Similarity=0.298  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |||.||||||-.++.+.+.|
T Consensus         8 IaG~SgSGKTTla~~l~~~l   27 (210)
T PTZ00301          8 ISGASGSGKSSLSTNIVSEL   27 (210)
T ss_pred             EECCCcCCHHHHHHHHHHHH
Confidence            69999999999998887665

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2

Probab=92.73  E-value=0.077  Score=36.09  Aligned_cols=20  Identities=25%  Similarity=0.272  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.+|+|||.+.+.+...+
T Consensus         4 i~G~~GsGKSTl~~~l~~~l   23 (198)
T cd02023           4 IAGGSGSGKTTVAEEIIEQL   23 (198)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            57999999999999998876

7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN

Probab=92.63  E-value=0.077  Score=35.40  Aligned_cols=20  Identities=15%  Similarity=0.052  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||||||.+.+.+...+
T Consensus         6 i~G~sGsGKttl~~~l~~~~   25 (179)
T TIGR02322         6 VVGPSGAGKDTLLDYARARL   25 (179)
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            57999999999999887764

Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C

Probab=92.51  E-value=0.079  Score=32.61  Aligned_cols=20  Identities=20%  Similarity=0.120  Sum_probs=17.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||.+++.+.+.+
T Consensus         3 i~G~~GsGKtTia~~L~~~~   22 (129)
T PF13238_consen    3 ISGIPGSGKTTIAKELAERL   22 (129)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            47999999999999998885

...

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor

Probab=92.39  E-value=0.095  Score=33.21  Aligned_cols=20  Identities=15%  Similarity=0.189  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.+|+|||.+++.+...+
T Consensus         4 i~G~~GsGKst~a~~la~~~   23 (147)
T cd02020           4 IDGPAGSGKSTVAKLLAKKL   23 (147)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            57999999999999887754

>smart00382 AAA ATPases associated with a variety of cellular activities

Probab=92.28  E-value=0.074  Score=31.83  Aligned_cols=23  Identities=17%  Similarity=0.088  Sum_probs=19.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|++|+|||.+.+.++..+...
T Consensus         7 l~G~~G~GKTtl~~~l~~~~~~~   29 (148)
T smart00382        7 IVGPPGSGKTTLARALARELGPP   29 (148)
T ss_pred             EECCCCCcHHHHHHHHHhccCCC
Confidence            46999999999999998877554

AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.

>cd01120 RecA-like_NTPases RecA-like NTPases

Probab=92.27  E-value=0.12  Score=32.56  Aligned_cols=22  Identities=27%  Similarity=0.286  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|+|||.+...++..+..
T Consensus         4 i~G~~G~GKT~l~~~i~~~~~~   25 (165)
T cd01120           4 VFGPTGSGKTTLALQLALNIAT   25 (165)
T ss_pred             EeCCCCCCHHHHHHHHHHHHHh
Confidence            4699999999999999887754

This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.

>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies

Probab=91.97  E-value=0.1  Score=35.65  Aligned_cols=22  Identities=32%  Similarity=0.360  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|.||+|||.+.+-++..|+.
T Consensus        43 i~G~tgsGKS~~l~~ll~~l~~   64 (205)
T PF01580_consen   43 IAGATGSGKSTLLRTLLLSLAL   64 (205)
T ss_dssp             EE--TTSSHHHHHHHHHHHHHT
T ss_pred             EEcCCCCCccHHHHHHHHHHHH
Confidence            5799999999999999888877

The domain contains a putative ATP binding P-loop motif. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification []. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer []. ; GO: 0000166 nucleotide binding, 0003677 DNA binding, 0005524 ATP binding, 0007049 cell cycle, 0007059 chromosome segregation, 0051301 cell division, 0016021 integral to membrane; PDB: 2IUS_E 2IUU_A 2IUT_A.

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold

Probab=91.82  E-value=0.13  Score=31.25  Aligned_cols=21  Identities=19%  Similarity=0.199  Sum_probs=18.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +-|++|+|||.+.+.+...+.
T Consensus        24 i~G~~G~GKT~l~~~i~~~~~   44 (151)
T cd00009          24 LYGPPGTGKTTLARAIANELF   44 (151)
T ss_pred             EECCCCCCHHHHHHHHHHHhh
Confidence            359999999999999998774

The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport

Probab=91.45  E-value=0.18  Score=31.15  Aligned_cols=19  Identities=21%  Similarity=0.176  Sum_probs=17.6

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|++|.|||.+.+.+.+++
T Consensus         4 ~G~~G~GKT~l~~~la~~l   22 (132)
T PF00004_consen    4 HGPPGTGKTTLARALAQYL   22 (132)
T ss_dssp             ESSTTSSHHHHHHHHHHHT
T ss_pred             ECcCCCCeeHHHHHHHhhc
Confidence            4999999999999999986

Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2

Probab=91.33  E-value=0.15  Score=34.91  Aligned_cols=21  Identities=29%  Similarity=0.246  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.||+|||-.++.+...|.
T Consensus         4 i~G~sgsGKttla~~l~~~l~   24 (179)
T cd02028           4 IAGPSGSGKTTFAKKLSNQLR   24 (179)
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            589999999999999988874

7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).

>cd00046 DEXDc DEAD-like helicases superfamily

Probab=91.26  E-value=0.17  Score=30.39  Aligned_cols=23  Identities=35%  Similarity=0.338  Sum_probs=19.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|++|+|||.+....+..+...
T Consensus         5 i~~~~G~GKT~~~~~~~~~~~~~   27 (144)
T cd00046           5 LAAPTGSGKTLAALLPILELLDS   27 (144)
T ss_pred             EECCCCCchhHHHHHHHHHHHhc
Confidence            46899999999998888877654

A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.

>PRK00300 gmk guanylate kinase; Provisional

Probab=91.20  E-value=0.12  Score=35.10  Aligned_cols=20  Identities=15%  Similarity=0.144  Sum_probs=17.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||+|||.+.+.++..+
T Consensus        10 i~G~sGsGKstl~~~l~~~~   29 (205)
T PRK00300         10 LSGPSGAGKSTLVKALLERD   29 (205)
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            46999999999999998865

>TIGR01587 cas3_core CRISPR-associated helicase Cas3

Probab=91.19  E-value=0.37  Score=35.41  Aligned_cols=21  Identities=24%  Similarity=0.127  Sum_probs=16.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.++||+|||++.-+.+.+.+
T Consensus         4 i~apTGsGKT~~~~~~~l~~~   24 (358)
T TIGR01587         4 IEAPTGYGKTEAALLWALHSI   24 (358)
T ss_pred             EEeCCCCCHHHHHHHHHHHHH
Confidence            358999999999887766554

This model represents the highly conserved core region of an alignment of Cas3, a protein found in association with CRISPR repeat elements in a broad range of bacteria and archaea. Cas3 appears to be a helicase, with regions found by pfam00270 (DEAD/DEAH box helicase) and pfam00271 (Helicase conserved C-terminal domain). Some but not all members have an N-terminal HD domain region (pfam01966) that is not included within this model.

>PRK06696 uridine kinase; Validated

Probab=91.12  E-value=0.16  Score=35.57  Aligned_cols=21  Identities=24%  Similarity=0.189  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.||||||-.++.+...|-
T Consensus        27 I~G~sgsGKSTlA~~L~~~l~   47 (223)
T PRK06696         27 IDGITASGKTTFADELAEEIK   47 (223)
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            689999999999999988873

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3

Probab=91.09  E-value=0.14  Score=33.08  Aligned_cols=21  Identities=29%  Similarity=0.278  Sum_probs=17.0

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      .++||+|||.+...++..+..
T Consensus        31 ~~~tGsGKT~~~~~~~~~l~~   51 (184)
T PF04851_consen   31 NAPTGSGKTIIALALILELAR   51 (184)
T ss_dssp             EESTTSSHHHHHHHHHHHHHC
T ss_pred             EECCCCCcChhhhhhhhcccc
Confidence            478999999999976666655

1.21.3 from EC), the Res subunit of type III endonucleases (3.1.21.5 from EC), and the B subunit of excinuclease ABC (uvrB) [, , ].; GO: 0003677 DNA binding, 0005524 ATP binding, 0016787 hydrolase activity; PDB: 2Y3T_B 2W74_B 2FWR_A 2FZ4_A 3UWX_B 3H1T_A 3B6E_A 2FDC_A 1D9Z_A 1T5L_B ....

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein

Probab=91.04  E-value=0.14  Score=37.48  Aligned_cols=22  Identities=27%  Similarity=0.326  Sum_probs=19.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|+||+|||..-+.++.++.+
T Consensus        18 iIG~sGSGKT~li~~lL~~~~~   39 (241)
T PF04665_consen   18 IIGKSGSGKTTLIKSLLYYLRH   39 (241)
T ss_pred             EECCCCCCHHHHHHHHHHhhcc
Confidence            5799999999999999987744

This is thought to be an ATPase involved in viral DNA packaging [].

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars

Probab=90.97  E-value=0.19  Score=29.32  Aligned_cols=20  Identities=15%  Similarity=0.152  Sum_probs=17.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||...+.+...|
T Consensus         4 i~G~~gsGKst~~~~l~~~l   23 (69)
T cd02019           4 ITGGSGSGKSTVAKKLAEQL   23 (69)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            47999999999999988876

Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)

Probab=90.70  E-value=0.16  Score=37.08  Aligned_cols=22  Identities=27%  Similarity=0.144  Sum_probs=19.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|+||+|||.+.+.++.++..
T Consensus        85 isG~tGSGKTT~l~all~~i~~  106 (264)
T cd01129          85 VTGPTGSGKTTTLYSALSELNT  106 (264)
T ss_pred             EECCCCCcHHHHHHHHHhhhCC
Confidence            5899999999999998888743

It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB

Probab=90.60  E-value=0.17  Score=38.64  Aligned_cols=22  Identities=18%  Similarity=0.279  Sum_probs=19.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|+||||||-+-+.++.++..
T Consensus       139 I~GpTGSGKTTtL~aLl~~i~~  160 (358)
T TIGR02524       139 ITGATGSGKSTLLAAIIRELAE  160 (358)
T ss_pred             EECCCCCCHHHHHHHHHHHHhh
Confidence            5799999999999999998754

Members of this protein family are the DotB component of Dot/Icm secretion systems, as found in obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the liturature now seems to favor calling this the Dot/Icm system. This family is most closely related to TraJ proteins of plasmid transfer, rather than to proteins of other type IV secretion systems.

>TIGR00235 udk uridine kinase

Probab=90.44  E-value=0.2  Score=34.58  Aligned_cols=21  Identities=19%  Similarity=0.127  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.||||||-..+.+...+-
T Consensus        11 I~G~sGsGKSTl~~~l~~~l~   31 (207)
T TIGR00235        11 IGGGSGSGKTTVARKIYEQLG   31 (207)
T ss_pred             EECCCCCCHHHHHHHHHHHhc
Confidence            579999999999999887653

Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]

Probab=90.23  E-value=0.14  Score=36.55  Aligned_cols=23  Identities=26%  Similarity=0.239  Sum_probs=19.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      |+|++|+|||.+.+.++.++-..
T Consensus       132 i~G~tGSGKTT~l~all~~i~~~  154 (270)
T PF00437_consen  132 ISGPTGSGKTTLLNALLEEIPPE  154 (270)
T ss_dssp             EEESTTSSHHHHHHHHHHHCHTT
T ss_pred             EECCCccccchHHHHHhhhcccc
Confidence            57999999999999998876444

These proteins are probably located in the cytoplasm and, on the basis of the presence of a conserved P-loop region IPR001687 from INTERPRO, bind ATP.; GO: 0005524 ATP binding, 0006810 transport, 0005622 intracellular; PDB: 1NLZ_C 2PT7_B 1OPX_A 1NLY_A 1G6O_B 2OAQ_2 2OAP_1 2JNQ_A 2JMZ_A 2GZA_B ....

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB

Probab=90.12  E-value=0.2  Score=37.25  Aligned_cols=21  Identities=24%  Similarity=0.262  Sum_probs=18.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.+|+|||.+.+.++.++.
T Consensus       137 I~G~tGSGKTTll~al~~~i~  157 (299)
T TIGR02782       137 VVGGTGSGKTTLANALLAEIA  157 (299)
T ss_pred             EECCCCCCHHHHHHHHHHHhh
Confidence            589999999999999988764

The TrbB protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbB is a homolog of the vir system VirB11 ATPase, and the Flp pilus sytem ATPase TadA.

>TIGR02173 cyt_kin_arch cytidylate kinase, putative

Probab=90.07  E-value=0.2  Score=32.65  Aligned_cols=20  Identities=20%  Similarity=0.230  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|||||.+++.+...|
T Consensus         5 i~G~~GSGKstia~~la~~l   24 (171)
T TIGR02173         5 ISGPPGSGKTTVAKILAEKL   24 (171)
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            47999999999999887644

Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by TIGR00017.

>PRK08233 hypothetical protein; Provisional

Probab=90.06  E-value=0.18  Score=33.16  Aligned_cols=21  Identities=19%  Similarity=0.056  Sum_probs=18.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.+|+|||-.++.+..+|.
T Consensus         8 I~G~~GsGKtTla~~L~~~l~   28 (182)
T PRK08233          8 IAAVSGGGKTTLTERLTHKLK   28 (182)
T ss_pred             EECCCCCCHHHHHHHHHhhCC
Confidence            579999999999999888773

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]

Probab=89.84  E-value=0.24  Score=36.04  Aligned_cols=21  Identities=24%  Similarity=0.102  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |||-||||||-.++.+...|-
T Consensus        13 IaG~SgSGKTTva~~l~~~~~   33 (218)
T COG0572          13 IAGGSGSGKTTVAKELSEQLG   33 (218)
T ss_pred             EeCCCCCCHHHHHHHHHHHhC
Confidence            699999999999999988765

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases

Probab=89.66  E-value=0.2  Score=34.17  Aligned_cols=20  Identities=25%  Similarity=0.331  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++|++|||||-+.+.++..+
T Consensus        30 I~G~tGSGKTTll~aL~~~i   49 (186)
T cd01130          30 ISGGTGSGKTTLLNALLAFI   49 (186)
T ss_pred             EECCCCCCHHHHHHHHHhhc
Confidence            47999999999999887654

The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB. This alignment contains the C-terminal domain, which is the ATPase.

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ

Probab=89.65  E-value=0.23  Score=38.27  Aligned_cols=22  Identities=14%  Similarity=0.107  Sum_probs=19.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|+||+|||.+.+-++.|+..
T Consensus       154 I~G~TGSGKTT~l~al~~~i~~  175 (372)
T TIGR02525       154 ICGETGSGKSTLAASIYQHCGE  175 (372)
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            5899999999999999998854

Members of this protein family are predicted ATPases associated with plasmid transfer loci in bacteria. This family is most similar to the DotB ATPase of a type-IV secretion-like system of obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii (TIGR02524).

>TIGR01420 pilT_fam pilus retraction protein PilT

Probab=89.63  E-value=0.22  Score=37.37  Aligned_cols=21  Identities=14%  Similarity=0.089  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      ++|+||||||-+-+.++.++-
T Consensus       127 i~G~tGSGKTT~l~al~~~i~  147 (343)
T TIGR01420       127 VTGPTGSGKSTTLASMIDYIN  147 (343)
T ss_pred             EECCCCCCHHHHHHHHHHhhC
Confidence            579999999999999888764

This model represents the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction. Members of this family may be found in some species that type IV pili but have related structures for DNA uptake and natural transformation.

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis

Probab=89.58  E-value=0.19  Score=32.68  Aligned_cols=17  Identities=24%  Similarity=0.382  Sum_probs=15.0

Q ss_pred             CCCCcCCchHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVL   17 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l   17 (80)
                      +.|+||+|||.+.++++
T Consensus        20 I~GpSGsGKSTLl~~l~   36 (107)
T cd00820          20 ITGDSGIGKTELALELI   36 (107)
T ss_pred             EEcCCCCCHHHHHHHhh
Confidence            46999999999999875

It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural

>PRK06762 hypothetical protein; Provisional

Probab=89.45  E-value=0.27  Score=32.32  Aligned_cols=20  Identities=20%  Similarity=0.160  Sum_probs=17.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||..++.+.+++
T Consensus         7 i~G~~GsGKST~A~~L~~~l   26 (166)
T PRK06762          7 IRGNSGSGKTTIAKQLQERL   26 (166)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999999988876

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs

Probab=89.39  E-value=0.31  Score=32.19  Aligned_cols=22  Identities=32%  Similarity=0.384  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|++|+|||.++..++...+.
T Consensus         4 i~G~~G~GKT~l~~~~~~~~~~   25 (187)
T cd01124           4 LSGGPGTGKTTFALQFLYAGLA   25 (187)
T ss_pred             EEcCCCCCHHHHHHHHHHHHHH
Confidence            5799999999988877776554

A related protein is found in archaea.

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B

Probab=89.14  E-value=0.24  Score=30.83  Aligned_cols=22  Identities=18%  Similarity=0.090  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +-|++|+|||.+.+.+++-+..
T Consensus         9 i~G~~G~GKT~~~~~~~~~~~~   30 (131)
T PF13401_consen    9 ISGPPGSGKTTLIKRLARQLNA   30 (131)
T ss_dssp             EEE-TTSSHHHHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHHhHH
Confidence            3599999999999999887654

>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown

Probab=89.09  E-value=0.37  Score=33.36  Aligned_cols=20  Identities=35%  Similarity=0.252  Sum_probs=18.7

Q ss_pred             CCCcCCchHHHHHHHHHHHh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~   21 (80)
                      -|.||+|||.+.+.++..+.
T Consensus        29 ~G~TGsGKS~~~~~ll~~l~   48 (229)
T PF01935_consen   29 FGTTGSGKSNTVKVLLEELL   48 (229)
T ss_pred             ECCCCCCHHHHHHHHHHHHH
Confidence            48999999999999999988

It contains several conserved aspartates and histidines that could be metal ligands.

>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria

Probab=89.04  E-value=0.25  Score=33.77  Aligned_cols=19  Identities=16%  Similarity=0.251  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|+||+|||+.+...++.
T Consensus        19 i~G~sG~GKStlal~L~~~   37 (149)
T cd01918          19 ITGPSGIGKSELALELIKR   37 (149)
T ss_pred             EEcCCCCCHHHHHHHHHHc
Confidence            4699999999999766664

It catalyzes both the ATP-dependent phosphorylation of Ser-46 of HPr and its dephosphorylation by phosphorolysis. The latter reaction uses inorganic phosphate as substrate and produces pyrophosphate. Phosphoenolpyruvate carboxykinase (PEPCK) and the C-terminal catalytic domain of HprK/P are structurally similar with conserved active site residues suggesting these two phosphotransferases have related functions. The HprK/P N-terminal domain is structurally similar to the N-terminal domains of the MurE and MurF amino acid ligases.

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+)

Probab=89.00  E-value=0.27  Score=34.43  Aligned_cols=20  Identities=25%  Similarity=0.361  Sum_probs=18.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||+|||-.++.+...+
T Consensus         4 i~G~sgsGKTtla~~l~~~~   23 (187)
T cd02024           4 ISGVTNSGKTTLAKLLQRIL   23 (187)
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            68999999999999998876

This enzyme catalyzes the phosphorylation of nicotinamide riboside (NR) to form nicotinamide mononucleotide (NMN). It defines the NR salvage pathway of NAD+ biosynthesis in addition to the pathways through nicotinic acid mononucleotide (NaMN). This enzyme can also phosphorylate the anticancer drug tiazofurin, which is an analog of nicotinamide riboside.

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]

Probab=88.91  E-value=0.17  Score=41.10  Aligned_cols=23  Identities=17%  Similarity=0.307  Sum_probs=19.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      |-||||||||.+...++.+|-..
T Consensus        40 IvGESGsGKSt~a~~i~gll~~~   62 (539)
T COG1123          40 IVGESGSGKSTLALALMGLLPEG   62 (539)
T ss_pred             EEcCCCCCHHHHHHHHhccCCCC
Confidence            45999999999999999877443

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]

Probab=88.86  E-value=0.23  Score=39.68  Aligned_cols=61  Identities=18%  Similarity=0.258  Sum_probs=35.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH-HHHH--hcCccc-cCCCCCCCccceEE
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA-WFQA--FGNAKT-AHNNNSSRFGKFIQ   69 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s-ilea--fGnAkT-~~n~nSSrfGk~~~   69 (80)
                      |.||||.||-..++.|=.    .|.    +..++.-.|....+.. ++|+  ||..|= ..-.+.+|.|+|-.
T Consensus       169 I~GESGtGKElvAr~IH~----~S~----R~~~PFVavNcaAip~~l~ESELFGhekGAFTGA~~~r~G~fE~  233 (464)
T COG2204         169 ITGESGTGKELVARAIHQ----ASP----RAKGPFIAVNCAAIPENLLESELFGHEKGAFTGAITRRIGRFEQ  233 (464)
T ss_pred             EECCCCCcHHHHHHHHHh----hCc----ccCCCceeeecccCCHHHHHHHhhcccccCcCCcccccCcceeE
Confidence            569999999999987722    122    1122222233322223 5664  998873 33455788898854

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2

Probab=88.83  E-value=0.23  Score=32.55  Aligned_cols=20  Identities=15%  Similarity=0.180  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||+|||...+.+++.+
T Consensus         4 i~GpsGsGKstl~~~L~~~~   23 (137)
T cd00071           4 LSGPSGVGKSTLLKRLLEEF   23 (137)
T ss_pred             EECCCCCCHHHHHHHHHhcC
Confidence            46999999999999988864

7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.

>PRK04182 cytidylate kinase; Provisional

Probab=88.80  E-value=0.28  Score=32.12  Aligned_cols=20  Identities=20%  Similarity=0.207  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|||||.+.+.+...|
T Consensus         5 i~G~~GsGKstia~~la~~l   24 (180)
T PRK04182          5 ISGPPGSGKTTVARLLAEKL   24 (180)
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            57999999999999987643

>PRK00023 cmk cytidylate kinase; Provisional

Probab=88.72  E-value=0.32  Score=34.58  Aligned_cols=20  Identities=15%  Similarity=0.167  Sum_probs=17.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||.+++++.+.|
T Consensus         9 i~g~~gsGksti~~~la~~~   28 (225)
T PRK00023          9 IDGPAGSGKGTVAKILAKKL   28 (225)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            47999999999999998766

>PF05729 NACHT: NACHT domain

Probab=88.57  E-value=0.4  Score=30.50  Aligned_cols=25  Identities=16%  Similarity=0.147  Sum_probs=20.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhcc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDF   25 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~   25 (80)
                      |-|+.|+|||.+.+.++..+.....
T Consensus         5 I~G~~G~GKStll~~~~~~~~~~~~   29 (166)
T PF05729_consen    5 ISGEPGSGKSTLLRKLAQQLAEEEP   29 (166)
T ss_pred             EECCCCCChHHHHHHHHHHHHhcCc
Confidence            4699999999999999888776653

>PRK00131 aroK shikimate kinase; Reviewed

Probab=88.53  E-value=0.34  Score=31.45  Aligned_cols=20  Identities=15%  Similarity=0.102  Sum_probs=17.5

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||.+++.+.+.|
T Consensus         9 l~G~~GsGKstla~~La~~l   28 (175)
T PRK00131          9 LIGFMGAGKSTIGRLLAKRL   28 (175)
T ss_pred             EEcCCCCCHHHHHHHHHHHh
Confidence            46999999999999988765

>PRK13833 conjugal transfer protein TrbB; Provisional

Probab=88.52  E-value=0.32  Score=36.92  Aligned_cols=21  Identities=24%  Similarity=0.346  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.||+|||.+.+-++.++.
T Consensus       149 I~G~tGSGKTTll~aL~~~i~  169 (323)
T PRK13833        149 ISGGTGSGKTTLANAVIAEIV  169 (323)
T ss_pred             EECCCCCCHHHHHHHHHHHHh
Confidence            589999999999999888763

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed

Probab=88.38  E-value=0.34  Score=34.00  Aligned_cols=22  Identities=18%  Similarity=0.227  Sum_probs=18.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|.+|||||-..+.+...|-.
T Consensus        38 i~G~~GsGKTTl~~~L~~~l~~   59 (229)
T PRK09270         38 IAGPPGAGKSTLAEFLEALLQQ   59 (229)
T ss_pred             EECCCCCCHHHHHHHHHHHhhh
Confidence            5799999999999998877643

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B

Probab=88.12  E-value=0.26  Score=31.21  Aligned_cols=20  Identities=15%  Similarity=0.162  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-..+.+.+.+
T Consensus         4 ~~G~pgsGKSt~a~~l~~~~   23 (143)
T PF13671_consen    4 LCGPPGSGKSTLAKRLAKRL   23 (143)
T ss_dssp             EEESTTSSHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHHHC
Confidence            57999999999999988654

...

>PRK07667 uridine kinase; Provisional

Probab=88.05  E-value=0.39  Score=33.01  Aligned_cols=22  Identities=18%  Similarity=0.164  Sum_probs=19.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|.+|+|||-.+..+...|..
T Consensus        22 I~G~~gsGKStla~~L~~~l~~   43 (193)
T PRK07667         22 IDGLSRSGKTTFVANLKENMKQ   43 (193)
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            6899999999999999888743

>PRK13900 type IV secretion system ATPase VirB11; Provisional

Probab=87.98  E-value=0.29  Score=37.00  Aligned_cols=20  Identities=30%  Similarity=0.408  Sum_probs=17.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++|+||+|||.+.+.++.++
T Consensus       165 i~G~tgSGKTTll~aL~~~i  184 (332)
T PRK13900        165 ISGGTSTGKTTFTNAALREI  184 (332)
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            58999999999999888776

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []

Probab=87.97  E-value=0.46  Score=30.25  Aligned_cols=19  Identities=21%  Similarity=0.214  Sum_probs=17.0

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|++|.|||...+.+...+
T Consensus         5 ~G~~G~GKt~l~~~la~~~   23 (139)
T PF07728_consen    5 VGPPGTGKTTLARELAALL   23 (139)
T ss_dssp             EESSSSSHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHh
Confidence            5999999999999998766

The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of this ATPase AAA domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. This ATPase domain includes some proteins not detected by the IPR003959 from INTERPRO model.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NBX_X 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.

>PRK13851 type IV secretion system protein VirB11; Provisional

Probab=87.89  E-value=0.24  Score=37.80  Aligned_cols=20  Identities=20%  Similarity=0.335  Sum_probs=17.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||||||.+.+.++.++
T Consensus       167 I~G~tGSGKTTll~aLl~~i  186 (344)
T PRK13851        167 LCGPTGSGKTTMSKTLISAI  186 (344)
T ss_pred             EECCCCccHHHHHHHHHccc
Confidence            58999999999999988765

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)

Probab=87.68  E-value=0.64  Score=29.05  Aligned_cols=24  Identities=17%  Similarity=0.069  Sum_probs=20.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~   24 (80)
                      |-|++|.|||-.++.+++.|....
T Consensus         3 i~G~~G~GKS~l~~~l~~~l~~~~   26 (107)
T PF00910_consen    3 IYGPPGIGKSTLAKELAKDLLKHI   26 (107)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHHh
Confidence            359999999999999988887543

All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below: Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein. The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity

>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]

Probab=87.59  E-value=0.3  Score=39.42  Aligned_cols=21  Identities=24%  Similarity=0.226  Sum_probs=18.8

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      -||||||||+++.-||+-|..
T Consensus        42 VGESGSGKSvTa~sim~LLp~   62 (534)
T COG4172          42 VGESGSGKSVTALSILGLLPS   62 (534)
T ss_pred             EecCCCCccHHHHHHHHhcCC
Confidence            499999999999999997755

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases

Probab=87.43  E-value=0.49  Score=32.54  Aligned_cols=24  Identities=17%  Similarity=0.163  Sum_probs=20.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~   24 (80)
                      |.|.+|||||.+++.+-+.|-...
T Consensus         7 ltGlsGsGKtTlA~~L~~~L~~~g   30 (156)
T PF01583_consen    7 LTGLSGSGKTTLARALERRLFARG   30 (156)
T ss_dssp             EESSTTSSHHHHHHHHHHHHHHTT
T ss_pred             EECCCCCCHHHHHHHHHHHHHHcC
Confidence            469999999999999999886543

Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This domain contains an ATP binding P-loop motif [].; GO: 0005524 ATP binding, 0016301 kinase activity, 0016772 transferase activity, transferring phosphorus-containing groups, 0000103 sulfate assimilation; PDB: 1M7H_B 1M7G_B 3CR7_B 1D6J_A 2OFW_G 1X6V_B 1XNJ_A 1XJQ_B 2PEY_A 2PEZ_B ....

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family

Probab=87.33  E-value=0.39  Score=31.47  Aligned_cols=20  Identities=15%  Similarity=0.149  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|.+|+|||.+.+.+...|
T Consensus         3 l~G~~GsGKSTla~~l~~~l   22 (163)
T TIGR01313         3 LMGVAGSGKSTIASALAHRL   22 (163)
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            46999999999999887765

This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]

Probab=87.21  E-value=0.29  Score=36.62  Aligned_cols=18  Identities=17%  Similarity=0.253  Sum_probs=16.3

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.||||+|||-+.+.+++
T Consensus        44 lVGESG~GKSTlgr~i~~   61 (268)
T COG4608          44 LVGESGCGKSTLGRLILG   61 (268)
T ss_pred             EEecCCCCHHHHHHHHHc
Confidence            359999999999999987

>PRK10436 hypothetical protein; Provisional

Probab=87.18  E-value=0.39  Score=38.05  Aligned_cols=22  Identities=27%  Similarity=0.152  Sum_probs=19.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|+||||||-+-|-+|.++..
T Consensus       223 vtGpTGSGKTTtL~a~l~~~~~  244 (462)
T PRK10436        223 VTGPTGSGKTVTLYSALQTLNT  244 (462)
T ss_pred             EECCCCCChHHHHHHHHHhhCC
Confidence            5799999999999998888743

>PRK06547 hypothetical protein; Provisional

Probab=87.16  E-value=0.45  Score=32.60  Aligned_cols=20  Identities=15%  Similarity=0.097  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-.+..+...+
T Consensus        20 i~G~~GsGKTt~a~~l~~~~   39 (172)
T PRK06547         20 IDGRSGSGKTTLAGALAART   39 (172)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            57999999999999887753

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB

Probab=86.94  E-value=0.41  Score=38.52  Aligned_cols=21  Identities=29%  Similarity=0.197  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      ++|+||||||.+-|-++.++-
T Consensus       321 v~G~tGSGKTTtl~a~l~~~~  341 (564)
T TIGR02538       321 VTGPTGSGKTVSLYTALNILN  341 (564)
T ss_pred             EECCCCCCHHHHHHHHHHhhC
Confidence            579999999999999988873

This model describes a protein of type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly and is closely related to GspE (TIGR02533) of type II secretion, also called the main terminal branch of the general secretion pathway. Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems.

>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []

Probab=86.91  E-value=0.37  Score=33.10  Aligned_cols=20  Identities=20%  Similarity=0.235  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |||..|||||.+...++..+
T Consensus        20 ~aG~~GsGKSt~~~~~~~~~   39 (199)
T PF06414_consen   20 IAGQPGSGKSTLARQLLEEF   39 (199)
T ss_dssp             EES-TTSTTHHHHHHHHHHT
T ss_pred             EeCCCCCCHHHHHHHhhhhc
Confidence            58999999999999998865

It has subsequently been found in a number of other proteins, such as polynucleotide kinase and 2',3'-cyclic-nucleotide 3'-phosphodiesterase. It appears to function as a kinase domain [, ].; GO: 0005524 ATP binding, 0016301 kinase activity; PDB: 2P5T_H 1GVN_B 3Q8X_D.

>TIGR03263 guanyl_kin guanylate kinase

Probab=86.88  E-value=0.29  Score=32.45  Aligned_cols=20  Identities=15%  Similarity=0.117  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|+|||-..+.+...+
T Consensus         6 l~G~~GsGKsTl~~~L~~~~   25 (180)
T TIGR03263         6 ISGPSGVGKSTLVKALLEED   25 (180)
T ss_pred             EECCCCCCHHHHHHHHHccC
Confidence            46999999999999998754

Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)

Probab=86.74  E-value=0.51  Score=31.19  Aligned_cols=21  Identities=14%  Similarity=0.154  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|.+|+|||..++.+..++.
T Consensus         4 i~G~~GsGKSTla~~L~~~l~   24 (149)
T cd02027           4 LTGLSGSGKSTIARALEEKLF   24 (149)
T ss_pred             EEcCCCCCHHHHHHHHHHHHH
Confidence            469999999999999998874

The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A

Probab=86.73  E-value=0.6  Score=30.46  Aligned_cols=23  Identities=22%  Similarity=0.225  Sum_probs=18.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +-|++|+|||-...-++.++...
T Consensus        29 l~G~~G~GKT~ll~~~~~~~~~~   51 (185)
T PF13191_consen   29 LTGESGSGKTSLLRALLDRLAER   51 (185)
T ss_dssp             E-B-TTSSHHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHHhc
Confidence            46999999999999888887665

>PRK14737 gmk guanylate kinase; Provisional

Probab=86.63  E-value=0.43  Score=33.02  Aligned_cols=20  Identities=10%  Similarity=0.013  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+||+.+.+.++..+
T Consensus         9 l~GpsG~GK~tl~~~l~~~~   28 (186)
T PRK14737          9 ISSVAGGGKSTIIQALLEEH   28 (186)
T ss_pred             EECCCCCCHHHHHHHHHhcC
Confidence            47999999999999987754

>PF07475 Hpr_kinase_C: HPr Serine kinase C-terminal domain; InterPro: IPR011104 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []

Probab=86.21  E-value=0.39  Score=33.76  Aligned_cols=18  Identities=17%  Similarity=0.301  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|+||+|||+++.-+++
T Consensus        23 i~G~SG~GKS~lAl~Li~   40 (171)
T PF07475_consen   23 ITGPSGIGKSELALELIK   40 (171)
T ss_dssp             EEESTTSSHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            479999999999987776

Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. This entry represents the C-terminal kinase domain of Hpr Serine/threonine kinase PtsK. This kinase is the sensor in a multicomponent phosphorelay system in control of carbon catabolic repression in bacteria []. This kinase in unusual in that it recognises the tertiary structure of its target and is a member of a novel family unrelated to any previously described protein phosphorylating enzymes []. X-ray analysis of the full-length crystalline enzyme from Staphylococcus xylosus at a resolution of 1.95 A shows the enzyme to consist of two clearly separated domains that are assembled in a hexameric structure resembling a three-bladed propeller [].; GO: 0000155 two-component sensor activity, 0004672 protein kinase activity, 0005524 ATP binding, 0000160 two-component signal transduction system (phosphorelay), 0006109 regulation of carbohydrate metabolic process; PDB: 2QMH_C 1KKM_B 1KKL_C 1JB1_A 3TQF_B 1KNX_B 1KO7_A.

>PRK03846 adenylylsulfate kinase; Provisional

Probab=86.20  E-value=0.56  Score=32.14  Aligned_cols=22  Identities=14%  Similarity=0.057  Sum_probs=18.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|.+|+|||.+.+.+...|..
T Consensus        29 i~G~~GsGKSTla~~l~~~l~~   50 (198)
T PRK03846         29 FTGLSGSGKSTVAGALEEALHE   50 (198)
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            4699999999999999887743

>PRK00889 adenylylsulfate kinase; Provisional

Probab=86.12  E-value=0.59  Score=31.10  Aligned_cols=21  Identities=19%  Similarity=0.104  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|.+|+|||.+.+.+...|.
T Consensus         9 ~~G~~GsGKST~a~~la~~l~   29 (175)
T PRK00889          9 FTGLSGAGKTTIARALAEKLR   29 (175)
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            469999999999999998874

>TIGR00455 apsK adenylylsulfate kinase (apsK)

Probab=85.87  E-value=0.61  Score=31.33  Aligned_cols=21  Identities=14%  Similarity=0.077  Sum_probs=18.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|.+|+|||...+.+...+.
T Consensus        23 i~G~~GsGKstla~~l~~~l~   43 (184)
T TIGR00455        23 LTGLSGSGKSTIANALEKKLE   43 (184)
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            579999999999999988764

Important residue (active site in E.coli) is residue 100 of the seed alignment.

>PRK05541 adenylylsulfate kinase; Provisional

Probab=85.87  E-value=0.61  Score=31.06  Aligned_cols=21  Identities=19%  Similarity=0.127  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|.+|+|||-..+.+...|.
T Consensus        12 i~G~~GsGKst~a~~l~~~l~   32 (176)
T PRK05541         12 ITGLAGSGKTTIAKALYERLK   32 (176)
T ss_pred             EEcCCCCCHHHHHHHHHHHHH
Confidence            469999999999999988875

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]

Probab=85.86  E-value=0.61  Score=33.16  Aligned_cols=20  Identities=20%  Similarity=0.099  Sum_probs=18.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|++|+|||-.++.+..||
T Consensus         5 IsG~pGsG~TTva~~lAe~~   24 (179)
T COG1102           5 ISGLPGSGKTTVARELAEHL   24 (179)
T ss_pred             eccCCCCChhHHHHHHHHHh
Confidence            68999999999999998876

>TIGR00150 HI0065_YjeE ATPase, YjeE family

Probab=85.85  E-value=0.52  Score=31.55  Aligned_cols=21  Identities=24%  Similarity=0.096  Sum_probs=18.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.|+.|+|||-..+.+++.|-
T Consensus        27 l~G~lGaGKTtl~~~l~~~lg   47 (133)
T TIGR00150        27 LKGDLGAGKTTLVQGLLQGLG   47 (133)
T ss_pred             EEcCCCCCHHHHHHHHHHHcC
Confidence            359999999999999999873

Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]

Probab=85.78  E-value=0.55  Score=37.95  Aligned_cols=24  Identities=25%  Similarity=0.178  Sum_probs=20.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~   24 (80)
                      ++|+||||||.+-|-+|.++-...
T Consensus       263 vTGPTGSGKTTTLY~~L~~ln~~~  286 (500)
T COG2804         263 VTGPTGSGKTTTLYAALSELNTPE  286 (500)
T ss_pred             EeCCCCCCHHHHHHHHHHHhcCCC
Confidence            379999999999999999875543

>TIGR02533 type_II_gspE general secretory pathway protein E

Probab=85.66  E-value=0.4  Score=38.04  Aligned_cols=21  Identities=29%  Similarity=0.172  Sum_probs=18.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      ++|+||+|||-+-+.++.++-
T Consensus       247 itGptGSGKTTtL~a~L~~l~  267 (486)
T TIGR02533       247 VTGPTGSGKTTTLYAALSRLN  267 (486)
T ss_pred             EEcCCCCCHHHHHHHHHhccC
Confidence            579999999999998888764

This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis.

>PRK07261 topology modulation protein; Provisional

Probab=85.63  E-value=0.58  Score=31.66  Aligned_cols=20  Identities=10%  Similarity=0.051  Sum_probs=16.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-.++.+...+
T Consensus         5 i~G~~GsGKSTla~~l~~~~   24 (171)
T PRK07261          5 IIGYSGSGKSTLARKLSQHY   24 (171)
T ss_pred             EEcCCCCCHHHHHHHHHHHh
Confidence            46999999999999887654

>TIGR00554 panK_bact pantothenate kinase, bacterial type

Probab=85.44  E-value=0.66  Score=34.69  Aligned_cols=20  Identities=25%  Similarity=0.318  Sum_probs=16.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |||.+|||||-+++++..-|
T Consensus        67 IaG~~GSGKSTlar~L~~ll   86 (290)
T TIGR00554        67 IAGSVAVGKSTTARILQALL   86 (290)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            68999999999998776544

Shown to be a homodimer in E. coli. This enzyme catalyzes the rate-limiting step in the biosynthesis of coenzyme A. It is very well conserved from E. coli to B. subtilis, but differs considerably from known eukaryotic forms, described in a separate model.

>TIGR02237 recomb_radB DNA repair and recombination protein RadB

Probab=85.36  E-value=0.7  Score=31.47  Aligned_cols=23  Identities=13%  Similarity=0.187  Sum_probs=18.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|++|+|||.....++...+..
T Consensus        17 i~G~~GsGKT~l~~~~~~~~~~~   39 (209)
T TIGR02237        17 IYGPPGSGKTNICMILAVNAARQ   39 (209)
T ss_pred             EECCCCCCHHHHHHHHHHHHHhC
Confidence            47999999999998777665543

This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239) and DMC1 (TIGR02238), and archaeal RadA (TIGR02236).

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes

Probab=85.35  E-value=0.7  Score=30.60  Aligned_cols=23  Identities=22%  Similarity=0.140  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|++|+|||.+...+...+...
T Consensus         5 ~~G~~G~GKTt~~~~la~~~~~~   27 (173)
T cd03115           5 LVGLQGVGKTTTAAKLALYLKKK   27 (173)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHC
Confidence            46999999999988887776554

SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants

Probab=85.08  E-value=0.68  Score=29.59  Aligned_cols=20  Identities=20%  Similarity=0.162  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||.+++.+...|
T Consensus         4 l~G~~GsGKstla~~la~~l   23 (154)
T cd00464           4 LIGMMGAGKTTVGRLLAKAL   23 (154)
T ss_pred             EEcCCCCCHHHHHHHHHHHh
Confidence            46999999999999987664

Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)

Probab=85.01  E-value=0.78  Score=29.56  Aligned_cols=23  Identities=17%  Similarity=0.176  Sum_probs=20.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|+.|+|||-++..+.+++...
T Consensus         4 ~~GkgG~GKTt~a~~la~~l~~~   26 (116)
T cd02034           4 ITGKGGVGKTTIAALLARYLAEK   26 (116)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHC
Confidence            47999999999999999988654

CODH from Rhodospirillum rubrum catalyzes the reversible oxidation of CO to CO2. CODH contains a nickel-iron-sulfur cluster (C-center) and an iron-sulfur cluster (B-center). CO oxidation occurs at the C-center. Three accessory proteins encoded by cooCTJ genes are involved in nickel incorporation into a nickel site. CooC functions as a nickel insertase that mobilizes nickel to apoCODH using energy released from ATP hydrolysis. CooC is a homodimer and has NTPase activities. Mutation at the P-loop abolishs its function.

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily

Probab=84.88  E-value=0.58  Score=32.80  Aligned_cols=21  Identities=24%  Similarity=0.143  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +-|++|+|||-+.+.++..+-
T Consensus        48 l~G~~G~GKTtl~~~l~~~l~   68 (269)
T TIGR03015        48 ITGEVGAGKTTLIRNLLKRLD   68 (269)
T ss_pred             EEcCCCCCHHHHHHHHHHhcC
Confidence            359999999999998877653

Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.

>TIGR00017 cmk cytidylate kinase

Probab=84.75  E-value=0.68  Score=32.84  Aligned_cols=20  Identities=20%  Similarity=0.184  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|++|+|||.+.+.+...|
T Consensus         7 i~G~~GsGKst~~~~la~~~   26 (217)
T TIGR00017         7 IDGPSGAGKSTVAKAVAEKL   26 (217)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            47999999999999997654

This family consists of cytidylate kinase, which catalyzes the phosphorylation of cytidine 5-monophosphate (dCMP) to cytidine 5 -diphosphate (dCDP) in the presence of ATP or GTP. UMP and dCMP can also act as acceptors.

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]

Probab=84.71  E-value=0.68  Score=39.26  Aligned_cols=21  Identities=24%  Similarity=0.164  Sum_probs=19.1

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +|+||.||||++|-+..+|..
T Consensus       527 ~GPTGVGKTELAkaLA~~Lfg  547 (786)
T COG0542         527 LGPTGVGKTELAKALAEALFG  547 (786)
T ss_pred             eCCCcccHHHHHHHHHHHhcC
Confidence            799999999999999888864

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]

Probab=84.63  E-value=0.43  Score=37.58  Aligned_cols=21  Identities=14%  Similarity=0.213  Sum_probs=18.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +-|+||||||-+.+++++++-
T Consensus       360 iVG~sGsGKSTl~~LL~r~~~  380 (567)
T COG1132         360 IVGPSGSGKSTLIKLLLRLYD  380 (567)
T ss_pred             EECCCCCCHHHHHHHHhccCC
Confidence            359999999999999999763

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional

Probab=84.52  E-value=0.72  Score=32.13  Aligned_cols=22  Identities=18%  Similarity=0.093  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|.+|+|||-...-++..|..
T Consensus        11 ivG~sgsGKTTLi~~li~~l~~   32 (173)
T PRK10751         11 IAAWSGTGKTTLLKKLIPALCA   32 (173)
T ss_pred             EECCCCChHHHHHHHHHHHHhh
Confidence            4799999999998888888754

>smart00487 DEXDc DEAD-like helicases superfamily

Probab=84.48  E-value=0.72  Score=29.36  Aligned_cols=20  Identities=35%  Similarity=0.195  Sum_probs=13.9

Q ss_pred             CCCCcCCchHH-HHHHHHHHH
Q psy17057          1 MAGSTMRDKTP-FKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte-~~k~~l~~l   20 (80)
                      +.|++|+|||. +..+++.++
T Consensus        29 i~~~~GsGKT~~~~~~~~~~~   49 (201)
T smart00487       29 LAAPTGSGKTLAALLPALEAL   49 (201)
T ss_pred             EECCCCCchhHHHHHHHHHHh
Confidence            35899999999 444444444

>PF13555 AAA_29: P-loop containing region of AAA domain

Probab=84.48  E-value=0.86  Score=26.94  Aligned_cols=20  Identities=20%  Similarity=0.258  Sum_probs=14.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|++|+|||-+---+.--|
T Consensus        28 i~G~nGsGKSTllDAi~~~L   47 (62)
T PF13555_consen   28 ITGPNGSGKSTLLDAIQTVL   47 (62)
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            46999999998876554433

>cd00984 DnaB_C DnaB helicase C terminal domain

Probab=84.31  E-value=0.8  Score=31.73  Aligned_cols=23  Identities=22%  Similarity=0.248  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      ++|.+|+|||.+...++..++..
T Consensus        18 I~G~~G~GKT~~~~~~~~~~~~~   40 (242)
T cd00984          18 IAARPSMGKTAFALNIAENIAKK   40 (242)
T ss_pred             EEeCCCCCHHHHHHHHHHHHHHh
Confidence            58999999999988777666554

The hexameric helicase DnaB unwinds the DNA duplex at the chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily

Probab=84.24  E-value=0.81  Score=30.19  Aligned_cols=20  Identities=10%  Similarity=-0.017  Sum_probs=16.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-..+.+...+
T Consensus         8 i~G~~GsGKsTl~~~l~~~~   27 (188)
T TIGR01360         8 IVGGPGSGKGTQCEKIVEKY   27 (188)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999998887654

Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.

>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes

Probab=84.21  E-value=0.75  Score=34.59  Aligned_cols=22  Identities=18%  Similarity=0.188  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |||-||||||-...-+...|-.
T Consensus         4 ItG~SGSGKTTv~~~l~~~l~~   25 (277)
T cd02029           4 VTGSSGAGTTTVKRAFEHIFAR   25 (277)
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            5899999999999988777643

PRK catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.

>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family

Probab=84.18  E-value=0.71  Score=37.56  Aligned_cols=23  Identities=22%  Similarity=0.163  Sum_probs=19.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      |.|.||+|||...++++..+...
T Consensus       439 I~G~tGsGKS~~~~~l~~~~~~~  461 (785)
T TIGR00929       439 IFGPTGSGKTTLLNFLLAQMQKY  461 (785)
T ss_pred             EECCCCCCHHHHHHHHHHHhhcc
Confidence            57999999999999988766543

Type IV secretion systems are found in Gram-negative pathogens. They export proteins, DNA, or complexes in different systems and are related to plasmid conjugation systems. This model represents related ATPases that include VirB4 in Agrobacterium tumefaciens (DNA export) CagE in Helicobacter pylori (protein export) and plasmid TraB (conjugation).

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family

Probab=84.17  E-value=0.81  Score=31.64  Aligned_cols=21  Identities=29%  Similarity=0.186  Sum_probs=16.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      ++|++|+|||.+...++...+
T Consensus        25 i~G~~G~GKT~l~~~~~~~~~   45 (229)
T TIGR03881        25 VTGEPGTGKTIFCLHFAYKGL   45 (229)
T ss_pred             EECCCCCChHHHHHHHHHHHH
Confidence            479999999998887665444

Members of this protein family are archaeal single-domain KaiC_related proteins, homologous to the Cyanobacterial circadian clock cycle protein KaiC, an autokinase/autophosphorylase that has two copies of the domain.

>TIGR02746 TraC-F-type type-IV secretion system protein TraC

Probab=83.89  E-value=0.77  Score=37.61  Aligned_cols=22  Identities=18%  Similarity=0.206  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|+||+|||.+.+.++..+..
T Consensus       435 I~G~tGsGKS~~~~~l~~~~~~  456 (797)
T TIGR02746       435 VVGGSGAGKSFFMQELIVDNLS  456 (797)
T ss_pred             EEcCCCCCHHHHHHHHHHHHHh
Confidence            4699999999999998876554

The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase.

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional

Probab=83.77  E-value=0.62  Score=34.75  Aligned_cols=20  Identities=15%  Similarity=0.297  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+|||.+.+.++..+
T Consensus        38 lvG~sGsGKSTL~~~l~Gll   57 (326)
T PRK11022         38 IVGESGSGKSVSSLAIMGLI   57 (326)
T ss_pred             EECCCCChHHHHHHHHHcCC
Confidence            36999999999999998754

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]

Probab=83.71  E-value=0.74  Score=37.52  Aligned_cols=19  Identities=16%  Similarity=0.249  Sum_probs=16.7

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -||||||||-+.+.++..+
T Consensus       323 VGeSGsGKSTlar~i~gL~  341 (539)
T COG1123         323 VGESGSGKSTLARILAGLL  341 (539)
T ss_pred             ECCCCCCHHHHHHHHhCCC
Confidence            5999999999999997754

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family

Probab=83.49  E-value=0.86  Score=32.89  Aligned_cols=22  Identities=9%  Similarity=0.045  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|++|+|||..+..++.+.+.
T Consensus        41 I~G~pGtGKT~l~~qf~~~~a~   62 (259)
T TIGR03878        41 ITGVSDTGKSLMVEQFAVTQAS   62 (259)
T ss_pred             EEcCCCCCHHHHHHHHHHHHHh
Confidence            5899999999988876665443

This KaiC domain-containing protein family occurs sporadically across a broad taxonomic range (Euryarchaeota, Aquificae, Dictyoglomi, Epsilonproteobacteria, and Firmicutes), but exclusively in thermophiles.

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional

Probab=83.24  E-value=0.67  Score=34.69  Aligned_cols=20  Identities=15%  Similarity=0.290  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+|||-+.+.++..+
T Consensus        47 ivG~sGsGKSTL~~~l~Gl~   66 (330)
T PRK09473         47 IVGESGSGKSQTAFALMGLL   66 (330)
T ss_pred             EECCCCchHHHHHHHHHcCC
Confidence            46999999999999997654

>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes

Probab=82.90  E-value=0.84  Score=33.50  Aligned_cols=20  Identities=20%  Similarity=0.247  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.+|||||-..+.+...|
T Consensus         4 I~G~sGsGKSTl~~~L~~ll   23 (273)
T cd02026           4 VAGDSGCGKSTFLRRLTSLF   23 (273)
T ss_pred             EECCCCCCHHHHHHHHHHhh
Confidence            57999999999999887655

This enzyme catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.

>PRK13894 conjugal transfer ATPase TrbB; Provisional

Probab=82.86  E-value=0.86  Score=34.33  Aligned_cols=21  Identities=19%  Similarity=0.248  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.||+|||-+.+.++.++.
T Consensus       153 I~G~tGSGKTTll~aL~~~~~  173 (319)
T PRK13894        153 VIGGTGSGKTTLVNAIINEMV  173 (319)
T ss_pred             EECCCCCCHHHHHHHHHHhhh
Confidence            579999999999998887753

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases

Probab=82.81  E-value=1.1  Score=28.71  Aligned_cols=21  Identities=24%  Similarity=0.123  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.+.||+|||.+..+.+...+
T Consensus        19 i~aptGsGKT~~~~~~~l~~~   39 (169)
T PF00270_consen   19 ISAPTGSGKTLAYILPALNRL   39 (169)
T ss_dssp             EECSTTSSHHHHHHHHHHHHH
T ss_pred             EECCCCCccHHHHHHHHHhhh
Confidence            358999999999886655433

Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression. ; GO: 0003676 nucleic acid binding, 0005524 ATP binding, 0008026 ATP-dependent helicase activity; PDB: 3RRM_A 3RRN_A 3PEW_A 2KBE_A 3PEY_A 3FHO_A 2ZJA_A 2ZJ8_A 2ZJ5_A 2ZJ2_A ....

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment

Probab=82.72  E-value=0.77  Score=30.80  Aligned_cols=18  Identities=11%  Similarity=0.122  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||..-+++.-
T Consensus        31 i~G~nGsGKSTLl~~l~G   48 (178)
T cd03229          31 LLGPSGSGKSTLLRCIAG   48 (178)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998854

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional

Probab=82.72  E-value=0.75  Score=34.39  Aligned_cols=20  Identities=10%  Similarity=0.235  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||+|||...+.++..+
T Consensus        46 IvG~sGsGKSTLl~~l~gl~   65 (327)
T PRK11308         46 VVGESGCGKSTLARLLTMIE   65 (327)
T ss_pred             EECCCCCcHHHHHHHHHcCC
Confidence            46999999999999987643

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain

Probab=82.61  E-value=1.2  Score=25.37  Aligned_cols=21  Identities=19%  Similarity=0.124  Sum_probs=18.3

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      .|+.|+|||.+...+...|..
T Consensus         5 ~g~~G~Gktt~~~~l~~~l~~   25 (99)
T cd01983           5 TGKGGVGKTTLAANLAAALAK   25 (99)
T ss_pred             ECCCCCCHHHHHHHHHHHHHH
Confidence            577899999999999998865

Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional

Probab=82.53  E-value=0.77  Score=34.20  Aligned_cols=20  Identities=15%  Similarity=0.134  Sum_probs=16.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||+|||-..+.|+.-+
T Consensus        38 ivG~sGsGKSTLl~~i~Gl~   57 (330)
T PRK15093         38 LVGESGSGKSLIAKAICGVT   57 (330)
T ss_pred             EECCCCCCHHHHHHHHHccC
Confidence            46999999999999987644

>PLN02796 D-glycerate 3-kinase

Probab=82.51  E-value=0.91  Score=35.04  Aligned_cols=21  Identities=10%  Similarity=0.184  Sum_probs=18.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.+|+|||-+.+.+...|.
T Consensus       105 I~G~sGSGKSTLa~~L~~lL~  125 (347)
T PLN02796        105 ISAPQGCGKTTLVFALVYLFN  125 (347)
T ss_pred             EECCCCCcHHHHHHHHHHHhc
Confidence            579999999999998887764

>cd01394 radB RadB

Probab=82.40  E-value=1.1  Score=30.82  Aligned_cols=22  Identities=14%  Similarity=0.096  Sum_probs=18.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|+|||.....++..++.
T Consensus        24 i~G~~GsGKT~l~~~~a~~~~~   45 (218)
T cd01394          24 VYGPPGTGKTNIAIQLAVETAG   45 (218)
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            4799999999999888776653

The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.

>PRK09361 radB DNA repair and recombination protein RadB; Provisional

Probab=82.39  E-value=1.1  Score=30.97  Aligned_cols=22  Identities=18%  Similarity=0.123  Sum_probs=17.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|+|||.....++...+.
T Consensus        28 i~G~~GsGKT~l~~~la~~~~~   49 (225)
T PRK09361         28 IYGPPGSGKTNICLQLAVEAAK   49 (225)
T ss_pred             EECCCCCCHHHHHHHHHHHHHH
Confidence            4799999999998877766544

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins

Probab=82.33  E-value=1.7  Score=29.25  Aligned_cols=23  Identities=17%  Similarity=0.047  Sum_probs=20.5

Q ss_pred             CCCcCCchHHHHHHHHHHHhhhc
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~~~   24 (80)
                      -|.||.||+-++++|.++|....
T Consensus        59 HG~tGtGKn~v~~liA~~ly~~G   81 (127)
T PF06309_consen   59 HGWTGTGKNFVSRLIAEHLYKSG   81 (127)
T ss_pred             ecCCCCcHHHHHHHHHHHHHhcc
Confidence            58999999999999999987654

Torsion dystonia is an autosomal dominant movement disorder characterised by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of AAA ATPase, central region containing proteins () proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)

Probab=82.08  E-value=1.1  Score=30.07  Aligned_cols=20  Identities=20%  Similarity=0.305  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-+++.+...+
T Consensus         7 l~G~~gsGKst~a~~l~~~~   26 (175)
T cd00227           7 LNGGSSAGKSSIARALQSVL   26 (175)
T ss_pred             EECCCCCCHHHHHHHHHHhh
Confidence            46999999999999887653

Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate

Probab=81.94  E-value=0.91  Score=29.22  Aligned_cols=19  Identities=11%  Similarity=0.038  Sum_probs=16.5

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |.|.+|+|||-+++.+...
T Consensus         4 l~G~~GsGKST~a~~l~~~   22 (150)
T cd02021           4 VMGVSGSGKSTVGKALAER   22 (150)
T ss_pred             EEcCCCCCHHHHHHHHHhh
Confidence            4699999999999988774

The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical

Probab=81.90  E-value=1  Score=31.14  Aligned_cols=20  Identities=25%  Similarity=0.243  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++|++|+|||.....++...
T Consensus        24 i~G~~GsGKT~l~~q~l~~~   43 (226)
T PF06745_consen   24 ISGPPGSGKTTLALQFLYNG   43 (226)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EEeCCCCCcHHHHHHHHHHh
Confidence            47999999999987665433

More than one copy is sometimes found in each protein in this entry. These include KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria []. The circadian clock protein KaiC, is encoded in the kaiABC operon that controls circadian rhythms and may be universal in Cyanobacteria. Each member contains two copies of this domain, which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor. RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease. The RadA/Sms family are probable ATP-dependent proteases involved in both DNA repair and degradation of proteins, peptides, glycopeptides. They are classified in as non-peptidase homologues and unassigned peptidases in MEROPS peptidase family S16 (lon protease family, clan SJ). RadA/Sms is involved in recombination and recombinational repair, most likely involving the stabilisation or processing of branched DNA molecules or blocked replication forks because of its genetic redundancy with RecG and RuvABC [].; PDB: 2W0M_A 2ZTS_C 4DUG_B 3K0E_B 3K09_B 3S1A_E 3JZM_E 2GBL_B 3DVL_A 1TF7_C ....

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11

Probab=81.87  E-value=0.66  Score=34.31  Aligned_cols=20  Identities=25%  Similarity=0.295  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++|.+|+|||-..+.++.++
T Consensus       149 i~G~tGsGKTTll~al~~~~  168 (308)
T TIGR02788       149 ISGGTGSGKTTFLKSLVDEI  168 (308)
T ss_pred             EECCCCCCHHHHHHHHHccC
Confidence            57999999999999887765

The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.

>PRK08118 topology modulation protein; Reviewed

Probab=81.81  E-value=1.1  Score=30.33  Aligned_cols=20  Identities=20%  Similarity=0.097  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|.+|+|||-.++.+...+
T Consensus         6 I~G~~GsGKSTlak~L~~~l   25 (167)
T PRK08118          6 LIGSGGSGKSTLARQLGEKL   25 (167)
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            45999999999999887764

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit

Probab=81.66  E-value=0.89  Score=30.62  Aligned_cols=18  Identities=17%  Similarity=0.130  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-.-+++.-
T Consensus        23 i~G~nGsGKSTLl~~i~G   40 (190)
T TIGR01166        23 LLGANGAGKSTLLLHLNG   40 (190)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999998754

This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA

Probab=81.58  E-value=1  Score=37.11  Aligned_cols=20  Identities=25%  Similarity=0.192  Sum_probs=18.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||.|||++++.+-+.|
T Consensus       489 f~Gp~GvGKT~lA~~la~~l  508 (731)
T TIGR02639       489 FTGPTGVGKTELAKQLAEAL  508 (731)
T ss_pred             EECCCCccHHHHHHHHHHHh
Confidence            36999999999999998877

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively

Probab=81.52  E-value=0.88  Score=31.33  Aligned_cols=19  Identities=11%  Similarity=0.190  Sum_probs=16.0

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        35 i~G~nGsGKSTLl~~l~Gl   53 (220)
T cd03293          35 LVGPSGCGKSTLLRIIAGL   53 (220)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response

Probab=81.21  E-value=1.2  Score=30.58  Aligned_cols=21  Identities=19%  Similarity=0.099  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|++|+|||.....++...+
T Consensus        24 I~G~~GsGKT~l~~~ia~~~~   44 (226)
T cd01393          24 IFGEFGSGKTQLCLQLAVEAQ   44 (226)
T ss_pred             EeCCCCCChhHHHHHHHHHhh
Confidence            579999999999988876543

RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57. Archaea have the RecA-like homologs radA and radB.

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda

Probab=81.10  E-value=1.5  Score=29.85  Aligned_cols=20  Identities=10%  Similarity=-0.054  Sum_probs=17.5

Q ss_pred             CCCcCCchHHHHHHHHHHHh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~   21 (80)
                      -|++|+|||-+.+.+.+++.
T Consensus        44 ~G~~G~GKT~la~~~~~~~~   63 (226)
T TIGR03420        44 WGESGSGKSHLLQAACAAAE   63 (226)
T ss_pred             ECCCCCCHHHHHHHHHHHHH
Confidence            59999999999999888764

Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.

>PRK10865 protein disaggregation chaperone; Provisional

Probab=81.00  E-value=1.1  Score=37.84  Aligned_cols=22  Identities=18%  Similarity=0.150  Sum_probs=19.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|+|||++++.+..++..
T Consensus       603 f~Gp~G~GKT~lA~aLa~~l~~  624 (857)
T PRK10865        603 FLGPTGVGKTELCKALANFMFD  624 (857)
T ss_pred             EECCCCCCHHHHHHHHHHHhhc
Confidence            3699999999999999888753

>PRK05439 pantothenate kinase; Provisional

Probab=80.90  E-value=1.3  Score=33.59  Aligned_cols=21  Identities=24%  Similarity=0.249  Sum_probs=17.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |||.+|+|||-++..+...|.
T Consensus        91 IaG~~gsGKSTla~~L~~~l~  111 (311)
T PRK05439         91 IAGSVAVGKSTTARLLQALLS  111 (311)
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            689999999999998877553

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup

Probab=80.89  E-value=0.99  Score=30.86  Aligned_cols=19  Identities=16%  Similarity=0.162  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|||||-.-+++.-.
T Consensus        31 i~G~nGsGKSTLl~~l~G~   49 (213)
T cd03259          31 LLGPSGCGKTTLLRLIAGL   49 (213)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4699999999999988653

This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]

Probab=80.83  E-value=1.4  Score=33.91  Aligned_cols=25  Identities=24%  Similarity=0.106  Sum_probs=21.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhcc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDF   25 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~   25 (80)
                      +-|++|.|||.+.+++++-+-..+.
T Consensus        47 iyG~~GTGKT~~~~~v~~~l~~~~~   71 (366)
T COG1474          47 IYGPTGTGKTATVKFVMEELEESSA   71 (366)
T ss_pred             EECCCCCCHhHHHHHHHHHHHhhhc
Confidence            3599999999999999998866644

>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed

Probab=80.78  E-value=1  Score=33.89  Aligned_cols=20  Identities=25%  Similarity=0.340  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||+|||..+.-+.+.+
T Consensus         9 i~GptgsGKt~la~~la~~~   28 (307)
T PRK00091          9 IVGPTASGKTALAIELAKRL   28 (307)
T ss_pred             EECCCCcCHHHHHHHHHHhC
Confidence            57999999999999887765

>PRK15453 phosphoribulokinase; Provisional

Probab=80.58  E-value=1.2  Score=33.64  Aligned_cols=21  Identities=19%  Similarity=0.169  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |||-||||||-.+..+..-+-
T Consensus        10 ItG~SGsGKTTva~~l~~if~   30 (290)
T PRK15453         10 VTGSSGAGTTTVKRAFEKIFR   30 (290)
T ss_pred             EECCCCCCHHHHHHHHHHHHh
Confidence            589999999999887765443

>PHA02530 pseT polynucleotide kinase; Provisional

Probab=80.58  E-value=1  Score=32.29  Aligned_cols=20  Identities=10%  Similarity=-0.022  Sum_probs=17.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-.++.+.+++
T Consensus         7 l~G~pGSGKSTla~~L~~~~   26 (300)
T PHA02530          7 TVGVPGSGKSTWAREFAAKN   26 (300)
T ss_pred             EEcCCCCCHHHHHHHHHHHC
Confidence            46999999999999988776

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota

Probab=80.52  E-value=1  Score=30.64  Aligned_cols=19  Identities=11%  Similarity=0.125  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-.-+++.-.
T Consensus        32 l~G~nGsGKSTLl~~l~G~   50 (211)
T cd03225          32 IVGPNGSGKSTLLRLLNGL   50 (211)
T ss_pred             EECCCCCCHHHHHHHHhcC
Confidence            4699999999999988654

The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.

>TIGR02673 FtsE cell division ATP-binding protein FtsE

Probab=80.51  E-value=1  Score=30.78  Aligned_cols=19  Identities=16%  Similarity=0.191  Sum_probs=16.1

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|||||-.-+++.-.
T Consensus        33 l~G~nGsGKSTLl~~i~Gl   51 (214)
T TIGR02673        33 LTGPSGAGKTTLLKLLYGA   51 (214)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            3699999999999988654

This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.

>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion

Probab=80.47  E-value=0.7  Score=32.47  Aligned_cols=13  Identities=15%  Similarity=0.342  Sum_probs=11.6

Q ss_pred             CCCCcCCchHHHH
Q psy17057          1 MAGSTMRDKTPFK   13 (80)
Q Consensus         1 ~aG~sg~gKte~~   13 (80)
                      +.|+||||||...
T Consensus        26 l~G~sGsGKSTL~   38 (226)
T cd03270          26 ITGVSGSGKSSLA   38 (226)
T ss_pred             EEcCCCCCHHHHH
Confidence            4699999999995

Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids

Probab=80.46  E-value=0.99  Score=30.91  Aligned_cols=18  Identities=17%  Similarity=0.180  Sum_probs=15.1

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||..-+++.-
T Consensus        31 i~G~nGsGKSTLl~~l~G   48 (222)
T cd03224          31 LLGRNGAGKTTLLKTIMG   48 (222)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            469999999999987754

The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.

>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional

Probab=80.46  E-value=1  Score=33.82  Aligned_cols=20  Identities=15%  Similarity=0.315  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+|||-..+.|+..+
T Consensus        52 lvG~sGsGKSTLlk~i~Gl~   71 (331)
T PRK15079         52 VVGESGCGKSTFARAIIGLV   71 (331)
T ss_pred             EECCCCCCHHHHHHHHHCCC
Confidence            46999999999999997643

>PLN02348 phosphoribulokinase

Probab=80.41  E-value=1.2  Score=34.94  Aligned_cols=21  Identities=19%  Similarity=0.124  Sum_probs=18.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |||.||||||-+++.+...|-
T Consensus        54 IaG~SGSGKSTfA~~L~~~Lg   74 (395)
T PLN02348         54 LAADSGCGKSTFMRRLTSVFG   74 (395)
T ss_pred             EECCCCCCHHHHHHHHHHHHh
Confidence            689999999999999988773

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]

Probab=80.40  E-value=0.99  Score=33.65  Aligned_cols=20  Identities=10%  Similarity=0.144  Sum_probs=16.5

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-||||+|||-..+.++-+.
T Consensus        38 ivGeSGsGKSTL~r~l~Gl~   57 (252)
T COG1124          38 IVGESGSGKSTLARLLAGLE   57 (252)
T ss_pred             EEcCCCCCHHHHHHHHhccc
Confidence            46999999999999886643

>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB

Probab=80.39  E-value=1.4  Score=29.70  Aligned_cols=23  Identities=17%  Similarity=0.167  Sum_probs=19.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|.+|+|||-....++..|...
T Consensus         4 i~G~~gsGKTtl~~~l~~~l~~~   26 (155)
T TIGR00176         4 IVGPKNSGKTTLIERLVKALKAR   26 (155)
T ss_pred             EECCCCCCHHHHHHHHHHHHHhc
Confidence            46999999999999998887644

This molybdenum cofactor biosynthesis enzyme is similar to the urease accessory protein UreG and to the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocenters of their respective target enzymes.

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit

Probab=80.25  E-value=0.71  Score=35.96  Aligned_cols=20  Identities=15%  Similarity=0.291  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|+||+|||-..++++..+
T Consensus       366 IvG~SGsGKSTLl~lL~g~~  385 (529)
T TIGR02868       366 ILGPSGSGKSTLLMLLTGLL  385 (529)
T ss_pred             EECCCCCCHHHHHHHHhcCC
Confidence            46999999999999998754

The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.

>PRK13891 conjugal transfer protein TrbE; Provisional

Probab=80.18  E-value=1.2  Score=37.49  Aligned_cols=22  Identities=23%  Similarity=0.160  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|+||+|||...++++..+..
T Consensus       493 I~G~tGsGKS~l~~~L~~~~~k  514 (852)
T PRK13891        493 MFGPTGAGKSTHLGIIAAQLRR  514 (852)
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            4699999999999998876543

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B

Probab=80.18  E-value=1.1  Score=30.85  Aligned_cols=19  Identities=16%  Similarity=0.088  Sum_probs=16.2

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||.....++..
T Consensus        24 i~G~~GsGKT~l~~~l~~~   42 (235)
T cd01123          24 IFGEFGSGKTQLCHQLAVT   42 (235)
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            4799999999999887654

This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .

---

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Length	Definition	E-value
Query	80
4dbp_A	814	Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal		4e-07
2aka_A	776	Structure Of The Nucleotide-Free Myosin Ii Motor Do		4e-07
2xel_A	776	Molecular Mechanism Of Pentachloropseudilin Mediate		4e-07
2xo8_A	776	Crystal Structure Of Myosin-2 In Complex With Tribr		4e-07
3mnq_A	788	Crystal Structure Of Myosin-2 Motor Domain In Compl		4e-07
2jhr_A	788	Crystal Structure Of Myosin-2 Motor Domain In Compl		4e-07
1w9l_A	770	Myosin Ii Dictyostelium Discoideum Motor Domain S45		4e-07
1jwy_A	776	Crystal Structure Of The Dynamin A Gtpase Domain Co		4e-07
1w9j_A	770	Myosin Ii Dictyostelium Discoideum Motor Domain S45		4e-07
1w9k_A	770	Dictyostelium Discoideum Myosin Ii Motor Domain S45		4e-07
4dbq_A	788	Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos		4e-07
1yv3_A	762	The Structural Basis Of Blebbistatin Inhibition And		4e-07
2y9e_X	758	Structural Basis For The Allosteric Interference Of		4e-07
2y0r_X	758	Structural Basis For The Allosteric Interference Of		4e-07
4dbr_A	786	Myosin Vi D179y (md) Pre-powerstroke State Length =		4e-07
1w9i_A	770	Myosin Ii Dictyostelium Discoideum Motor Domain S45		4e-07
1mmd_A	762	Truncated Head Of Myosin From Dictyostelium Discoid		4e-07
2x9h_A	695	Crystal Structure Of Myosin-2 Motor Domain In Compl		4e-07
1fmv_A	761	Crystal Structure Of The Apo Motor Domain Of Dictyo		4e-07
1d0x_A	761	Dictyostelium Myosin S1dc (Motor Domain Fragment) C		4e-07
3mkd_A	692	Crystal Structure Of Myosin-2 Dictyostelium Discoid		4e-07
1mmg_A	762	X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga		4e-07
1mma_A	762	X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga		4e-07
1mmn_A	762	X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga		4e-07
1lvk_A	762	X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N		4e-07
2os8_A	840	Rigor-Like Structures Of Muscle Myosins Reveal Key		6e-07
1i84_S	1184	Cryo-Em Structure Of The Heavy Meromyosin Subfragme		6e-07
2bki_A	858	Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St		6e-07
3dtp_B	973	Tarantula Heavy Meromyosin Obtained By Flexible Doc		7e-07
3dtp_A	971	Tarantula Heavy Meromyosin Obtained By Flexible Doc		7e-07
2bkh_A	814	Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc		7e-07
3l9i_A	814	Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant		7e-07
2vas_A	788	Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo		8e-07
3j04_A	909	Em Structure Of The Heavy Meromyosin Subfragment Of		8e-07
2x51_A	789	M6 Delta Insert1 Length = 789		8e-07
4anj_A	1052	Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St		8e-07
3myh_X	762	Insights Into The Importance Of Hydrogen Bonding In		8e-07
4e7s_A	798	Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat		8e-07
4e7z_A	798	Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F		8e-07
2v26_A	784	Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L		8e-07
2ycu_A	995	Crystal Structure Of Human Non Muscle Myosin 2c In		9e-07
1br1_A	820	Smooth Muscle Myosin Motor Domain-Essential Light C		1e-06
1br2_A	791	Smooth Muscle Myosin Motor Domain Complexed With Mg		1e-06
1dfk_A	830	Nucleotide-Free Scallop Myosin S1-Near Rigor State		1e-06
1qvi_A	840	Crystal Structure Of Scallop Myosin S1 In The Pre-P		1e-06
1dfl_A	831	Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra		1e-06
1kk7_A	837	Scallop Myosin In The Near Rigor Conformation Lengt		1e-06
1b7t_A	835	Myosin Digested By Papain Length = 835		1e-06
2ec6_A	838	Placopecten Striated Muscle Myosin Ii Length = 838		1e-06
3i5g_A	839	Crystal Structure Of Rigor-Like Squid Myosin S1 Len		1e-06
1g8x_A	1010	Structure Of A Genetically Engineered Molecular Mot		1e-06
2w4g_M	840	Isometrically Contracting Insect Asynchronous Fligh		1e-05
4db1_A	783	Cardiac Human Myosin S1dc, Beta Isoform Complexed W		1e-05
4a7f_C	697	Structure Of The Actin-Tropomyosin-Myosin Complex (		2e-04
1lkx_A	697	Motor Domain Of Myoe, A Class-I Myosin Length = 697		2e-04
2mys_A	843	Myosin Subfragment-1, Alpha Carbon Coordinates Only		2e-04
1m8q_A	840	Molecular Models Of Averaged Rigor Crossbridges Fro		2e-04
1w8j_A	766	Crystal Structure Of Myosin V Motor Domain - Nucleo		5e-04
1oe9_A	795	Crystal Structure Of Myosin V Motor With Essential		5e-04
2dfs_A	1080	3-D Structure Of Myosin-V Inhibited State Length =		5e-04

>pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814

Iteration: 1
 Score = 50.1 bits (118), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 13/93 (13%)
Query: 1   MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFF------------DMFSTVI-VSAWF 47
           +A    RD    KL   +++  E       +TKF             D++  ++  +   
Sbjct: 129 IADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIYDRIVEANPLL 188
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  NNNSSRFGKF+++++ E   V G
Sbjct: 189 EAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVG 221

>pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776

Iteration: 1
 Score = 50.1 bits (118), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 233 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 266

>pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776

Iteration: 1
 Score = 50.1 bits (118), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 221 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 254

>pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776

Iteration: 1
 Score = 50.1 bits (118), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 221 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 254

>pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788

Iteration: 1
 Score = 50.1 bits (118), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 233 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 266

>pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788

Iteration: 1
 Score = 50.1 bits (118), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 233 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 266

>pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770

Iteration: 1
 Score = 50.1 bits (118), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 222 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 255

>pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776

Iteration: 1
 Score = 50.1 bits (118), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 233 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 266

>pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 222 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 255

>pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 222 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 255

>pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 13/93 (13%)
Query: 1   MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFF------------DMFSTVI-VSAWF 47
           +A    RD    KL   +++  E       +TKF             D++  ++  +   
Sbjct: 129 IADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIYDRIVEANPLL 188
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  NNNSSRFGKF+++++ E   V G
Sbjct: 189 EAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVG 221

>pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 222 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 255

>pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 221 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 254

>pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 221 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 254

>pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 13/93 (13%)
Query: 1   MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFF------------DMFSTVI-VSAWF 47
           +A    RD    KL   +++  E       +TKF             D++  ++  +   
Sbjct: 127 IADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIYDRIVEANPLL 186
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  NNNSSRFGKF+++++ E   V G
Sbjct: 187 EAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVG 219

>pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 222 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 255

>pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 222 LEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISG 255

>pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 221 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 254

>pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 222 LEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISG 255

>pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 222 LEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISG 255

>pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 221 LEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 254

>pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 222 LEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISG 255

>pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 222 LEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISG 255

>pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 222 LEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISG 255

>pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762

Iteration: 1
 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 222 LEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISG 255

>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840

Iteration: 1
 Score = 49.3 bits (116), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++++   G + G
Sbjct: 227 LEAFGNAKTVRNNNSSRFGKFIRIHFGPTGKIAG 260

>pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184

Iteration: 1
 Score = 49.3 bits (116), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  N+NSSRFGKFI++N+   G + G
Sbjct: 230 LEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 263

>pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858

Iteration: 1
 Score = 48.9 bits (115), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 13/93 (13%)
Query: 1   MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFST-------------VIVSAWF 47
           +A    RD    KL   +++  E       +TKF   + T             V  +   
Sbjct: 130 IADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLL 189
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  NNNSSRFGKF+++++ E   V G
Sbjct: 190 EAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVG 222

>pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973

Iteration: 1
 Score = 48.9 bits (115), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  N+NSSRFGKFI++N+   G + G
Sbjct: 230 LEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 263

>pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971

Iteration: 1
 Score = 48.9 bits (115), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  N+NSSRFGKFI++N+   G + G
Sbjct: 230 LEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 263

>pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814

Iteration: 1
 Score = 48.9 bits (115), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 13/93 (13%)
Query: 1   MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFST-------------VIVSAWF 47
           +A    RD    KL   +++  E       +TKF   + T             V  +   
Sbjct: 129 IADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLL 188
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  NNNSSRFGKF+++++ E   V G
Sbjct: 189 EAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVG 221

>pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814

Iteration: 1
 Score = 48.9 bits (115), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 13/93 (13%)
Query: 1   MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFST-------------VIVSAWF 47
           +A    RD    KL   +++  E       +TKF   + T             V  +   
Sbjct: 129 IADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLL 188
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  NNNSSRFGKF+++++ E   V G
Sbjct: 189 EAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVG 221

>pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788

Iteration: 1
 Score = 48.9 bits (115), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 13/93 (13%)
Query: 1   MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFST-------------VIVSAWF 47
           +A    RD    KL   +++  E       +TKF   + T             V  +   
Sbjct: 129 IADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLL 188
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  NNNSSRFGKF+++++ E   V G
Sbjct: 189 EAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVG 221

>pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909

Iteration: 1
 Score = 48.9 bits (115), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  N+NSSRFGKFI++N+   G + G
Sbjct: 230 LEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 263

>pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789

Iteration: 1
 Score = 48.9 bits (115), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 13/93 (13%)
Query: 1   MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFST-------------VIVSAWF 47
           +A    RD    KL   +++  E       +TKF   + T             V  +   
Sbjct: 130 IADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLL 189
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  NNNSSRFGKF+++++ E   V G
Sbjct: 190 EAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVG 222

>pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052

Iteration: 1
 Score = 48.9 bits (115), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 13/93 (13%)
Query: 1   MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFST-------------VIVSAWF 47
           +A    RD    KL   +++  E       +TKF   + T             V  +   
Sbjct: 130 IADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLL 189
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  NNNSSRFGKF+++++ E   V G
Sbjct: 190 EAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVG 222

>pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762

Iteration: 1
 Score = 48.9 bits (115), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 19/34 (55%), Positives = 25/34 (73%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNN+SRFGKFI++ +   G + G
Sbjct: 222 LEAFGNAKTTRNNNASRFGKFIEIQFNSAGFISG 255

>pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798

Iteration: 1
 Score = 48.5 bits (114), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 13/93 (13%)
Query: 1   MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFST-------------VIVSAWF 47
           +A    RD    KL   +++  E       +TKF   + T             V  +   
Sbjct: 139 IADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLL 198
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  NNNSSRFGKF+++++ E   V G
Sbjct: 199 EAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVG 231

>pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798

Iteration: 1
 Score = 48.5 bits (114), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 13/93 (13%)
Query: 1   MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFST-------------VIVSAWF 47
           +A    RD    KL   +++  E       +TKF   + T             V  +   
Sbjct: 139 IADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLL 198
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  NNNSSRFGKF+++++ E   V G
Sbjct: 199 EAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVG 231

>pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784

Iteration: 1
 Score = 48.5 bits (114), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 13/93 (13%)
Query: 1   MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFST-------------VIVSAWF 47
           +A    RD    KL   +++  E       +TKF   + T             V  +   
Sbjct: 126 IADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLL 185
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           +AFGNAKT  NNNSSRFGKF+++++ E   V G
Sbjct: 186 EAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVG 218

>pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995

Iteration: 1
 Score = 48.5 bits (114), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  N+NSSRFGKFI++N+   G + G
Sbjct: 200 LEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVG 233

>pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820

Iteration: 1
 Score = 48.5 bits (114), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  N+NSSRFGKFI++N+   G + G
Sbjct: 230 LEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 263

>pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791

Iteration: 1
 Score = 48.5 bits (114), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/34 (58%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  N+NSSRFGKFI++N+   G + G
Sbjct: 230 LEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 263

>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830

Iteration: 1
 Score = 48.1 bits (113), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/34 (55%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +A+GNAKT  NNNSSRFGKFI++++   G + G
Sbjct: 221 LEAYGNAKTTRNNNSSRFGKFIRIHFGPTGKIAG 254

>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840

Iteration: 1
 Score = 48.1 bits (113), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/34 (55%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +A+GNAKT  NNNSSRFGKFI++++   G + G
Sbjct: 226 LEAYGNAKTTRNNNSSRFGKFIRIHFGPTGKIAG 259

>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831

Iteration: 1
 Score = 48.1 bits (113), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/34 (55%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +A+GNAKT  NNNSSRFGKFI++++   G + G
Sbjct: 222 LEAYGNAKTTRNNNSSRFGKFIRIHFGPTGKIAG 255

>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837

Iteration: 1
 Score = 48.1 bits (113), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/34 (55%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +A+GNAKT  NNNSSRFGKFI++++   G + G
Sbjct: 226 LEAYGNAKTTRNNNSSRFGKFIRIHFGPTGKIAG 259

>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835

Iteration: 1
 Score = 48.1 bits (113), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/34 (55%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +A+GNAKT  NNNSSRFGKFI++++   G + G
Sbjct: 226 LEAYGNAKTTRNNNSSRFGKFIRIHFGPTGKIAG 259

>pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838

Iteration: 1
 Score = 48.1 bits (113), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/34 (55%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +A+GNAKT  NNNSSRFGKFI++++   G + G
Sbjct: 228 LEAYGNAKTTRNNNSSRFGKFIRIHFGPTGKIAG 261

>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839

Iteration: 1
 Score = 47.8 bits (112), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/34 (55%), Positives = 26/34 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +A+GNAKT  NNNSSRFGKFI++++   G + G
Sbjct: 231 LEAYGNAKTTRNNNSSRFGKFIRIHFGTQGKIAG 264

>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010

Iteration: 1
 Score = 47.8 bits (112), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/34 (55%), Positives = 24/34 (70%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSS FGKFI++ +   G + G
Sbjct: 222 LEAFGNAKTTRNNNSSEFGKFIEIQFNNAGFISG 255

>pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783

Iteration: 1
 Score = 44.7 bits (104), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 24/30 (80%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENG 76
            +AFGNAKT  N+NSSRFGKFI++++   G
Sbjct: 227 LEAFGNAKTVRNDNSSRFGKFIRIHFGATG 256

>pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697

Iteration: 1
 Score = 41.2 bits (95), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 23/30 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENG 76
            +AFGNAKT  N+NSSRFGK++++ +   G
Sbjct: 143 LEAFGNAKTLRNDNSSRFGKYMEMQFNAVG 172

>pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697

Iteration: 1
 Score = 41.2 bits (95), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 23/30 (76%)
Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENG 76
            +AFGNAKT  N+NSSRFGK++++ +   G
Sbjct: 143 LEAFGNAKTLRNDNSSRFGKYMEMQFNAVG 172

>pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843

Iteration: 1
 Score = 40.8 bits (94), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 2/37 (5%)
Query: 42  IVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENG 76
           I+SA    +AFGNA T  N+NSSRFG FI++++   G
Sbjct: 222 IISANPLLEAFGNAXTVRNDNSSRFGXFIRIHFGATG 258

>pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840

Iteration: 1
 Score = 40.8 bits (94), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 2/37 (5%)
Query: 42  IVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENG 76
           I+SA    +AFGNA T  N+NSSRFG FI++++   G
Sbjct: 219 IISANPLLEAFGNAXTVRNDNSSRFGXFIRIHFGATG 255

>pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766

Iteration: 1
 Score = 39.3 bits (90), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 24/33 (72%)
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           ++ GNAKT  N+NSSRFGK+I++ + +   + G
Sbjct: 204 ESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIG 236

>pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795

Iteration: 1
 Score = 39.3 bits (90), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 24/33 (72%)
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           ++ GNAKT  N+NSSRFGK+I++ + +   + G
Sbjct: 204 ESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIG 236

>pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080

Iteration: 1
 Score = 39.3 bits (90), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 24/33 (72%)
Query: 48  QAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           ++ GNAKT  N+NSSRFGK+I++ + +   + G
Sbjct: 204 ESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIG 236

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Length	Definition	E-value
Query	80
2dfs_A	1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	2e-14
2ycu_A	995	Non muscle myosin 2C, alpha-actinin; motor protein	5e-14
2v26_A	784	Myosin VI; calmodulin-binding, nucleotide-binding,	1e-13
1g8x_A	1010	Myosin II heavy chain fused to alpha-actinin 3; mo	2e-13
1w7j_A	795	Myosin VA; motor protein, unconventional myosin, m	2e-13
1kk8_A	837	Myosin heavy chain, striated muscle; actin-detache	2e-13
1w9i_A	770	Myosin II heavy chain; molecular motor, ATPase, mo	5e-13
1lkx_A	697	Myosin IE heavy chain; myosin motor domain, lever	7e-13
4db1_A	783	Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb	8e-13
1i84_S	1184	Smooth muscle myosin heavy chain; muscle protein,	7e-12

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080

 Score = 65.5 bits (160), Expect = 2e-14
 Identities = 15/32 (46%), Positives = 23/32 (71%)

Query: 49  AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           + GNAKT  N+NSSRFGK+I++ + +   + G
Sbjct: 205 SIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIG 236

>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995

 Score = 63.9 bits (156), Expect = 5e-14
 Identities = 20/32 (62%), Positives = 25/32 (78%)

Query: 49  AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           AFGNAKT  N+NSSRFGKFI++N+   G + G
Sbjct: 202 AFGNAKTVKNDNSSRFGKFIRINFDVAGYIVG 233

>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784

 Score = 63.0 bits (154), Expect = 1e-13
 Identities = 20/32 (62%), Positives = 25/32 (78%)

Query: 49  AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           AFGNAKT  NNNSSRFGKF+++++ E   V G
Sbjct: 187 AFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVG 218

>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010

 Score = 62.8 bits (153), Expect = 2e-13
 Identities = 19/32 (59%), Positives = 23/32 (71%)

Query: 49  AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           AFGNAKT  NNNSS FGKFI++ +   G + G
Sbjct: 224 AFGNAKTTRNNNSSEFGKFIEIQFNNAGFISG 255

>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795

 Score = 62.3 bits (152), Expect = 2e-13
 Identities = 15/32 (46%), Positives = 23/32 (71%)

Query: 49  AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           + GNAKT  N+NSSRFGK+I++ + +   + G
Sbjct: 205 SIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIG 236

>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837

 Score = 62.0 bits (151), Expect = 2e-13
 Identities = 19/32 (59%), Positives = 25/32 (78%)

Query: 49  AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           A+GNAKT  NNNSSRFGKFI++++   G + G
Sbjct: 228 AYGNAKTTRNNNSSRFGKFIRIHFGPTGKIAG 259

>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770

 Score = 61.1 bits (149), Expect = 5e-13
 Identities = 20/32 (62%), Positives = 24/32 (75%)

Query: 49  AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 224 AFGNAKTTRNNNSSRFGKFIEIQFNSAGFISG 255

>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697

 Score = 60.6 bits (148), Expect = 7e-13
 Identities = 17/32 (53%), Positives = 23/32 (71%)

Query: 49  AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           AFGNAKT  N+NSSRFGK++++ +   G   G
Sbjct: 145 AFGNAKTLRNDNSSRFGKYMEMQFNAVGSPIG 176

>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783

 Score = 60.7 bits (148), Expect = 8e-13
 Identities = 18/32 (56%), Positives = 24/32 (75%)

Query: 49  AFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
           AFGNAKT  N+NSSRFGKFI++++   G +  
Sbjct: 229 AFGNAKTVRNDNSSRFGKFIRIHFGATGKLAS 260

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184

 Score = 57.9 bits (140), Expect = 7e-12
 Identities = 19/32 (59%), Positives = 25/32 (78%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV 78
            +AFGNAKT  N+NSSRFGKFI++N+   G +
Sbjct: 230 LEAFGNAKTVKNDNSSRFGKFIRINFDVTGYI 261

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Length	Definition	Probability
Query	80
1lkx_A	697	Myosin IE heavy chain; myosin motor domain, lever	99.93
1kk8_A	837	Myosin heavy chain, striated muscle; actin-detache	99.93
1w7j_A	795	Myosin VA; motor protein, unconventional myosin, m	99.93
4db1_A	783	Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb	99.93
1w9i_A	770	Myosin II heavy chain; molecular motor, ATPase, mo	99.93
2v26_A	784	Myosin VI; calmodulin-binding, nucleotide-binding,	99.93
1g8x_A	1010	Myosin II heavy chain fused to alpha-actinin 3; mo	99.93
4anj_A	1052	Unconventional myosin-VI, green fluorescent prote;	99.92
1i84_S	1184	Smooth muscle myosin heavy chain; muscle protein,	99.92
2dfs_A	1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	99.92
2ycu_A	995	Non muscle myosin 2C, alpha-actinin; motor protein	99.92
1kgd_A	180	CASK, peripheral plasma membrane CASK; maguk, guan	91.97
3c8u_A	208	Fructokinase; YP_612366.1, putative fructose trans	91.93
1odf_A	290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	90.97
1lvg_A	198	Guanylate kinase, GMP kinase; transferase; HET: AD	90.62
2f1r_A	171	Molybdopterin-guanine dinucleotide biosynthesis pr	90.01
3a00_A	186	Guanylate kinase, GMP kinase; domain movement, dim	89.74
2qor_A	204	Guanylate kinase; phosphotransferase, purine metab	89.64
2w0m_A	235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	89.6
3asz_A	211	Uridine kinase; cytidine phosphorylation, transfer	89.56
1jbk_A	195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	89.51
3tr0_A	205	Guanylate kinase, GMP kinase; purines, pyrimidines	89.29
3uie_A	200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	89.09
2eyu_A	261	Twitching motility protein PILT; pilus retraction	88.89
1cke_A	227	CK, MSSA, protein (cytidine monophosphate kinase);	88.39
3aez_A	312	Pantothenate kinase; transferase, homodimer, COA b	88.23
2j41_A	207	Guanylate kinase; GMP, GMK, transferase, ATP-bindi	88.23
1z6g_A	218	Guanylate kinase; structural genomics, SGC, struct	88.12
3ake_A	208	Cytidylate kinase; CMP kinase, CMP complex, open c	88.11
3tau_A	208	Guanylate kinase, GMP kinase; structural genomics,	87.94
2p65_A	187	Hypothetical protein PF08_0063; CLPB, malaria, str	87.76
4e22_A	252	Cytidylate kinase; P-loop, CMP/ATP binding, transf	87.51
1rz3_A	201	Hypothetical protein rbstp0775; MCSG, structural g	87.44
2jeo_A	245	Uridine-cytidine kinase 1; UCK, transferase, ATP-b	87.29
1ex7_A	186	Guanylate kinase; substrate-induced FIT, domain mo	87.24
1znw_A	207	Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans	87.21
4fcw_A	311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	87.18
3vaa_A	199	Shikimate kinase, SK; structural genomics, center	87.11
1kht_A	192	Adenylate kinase; phosphotransferase, signaling pr	87.07
3ec2_A	180	DNA replication protein DNAC; helicase loader, rep	87.01
1ofh_A	310	ATP-dependent HSL protease ATP-binding subunit HSL	86.99
1qhx_A	178	CPT, protein (chloramphenicol phosphotransferase);	86.78
3t61_A	202	Gluconokinase; PSI-biology, structural genomics, p	86.69
2ehv_A	251	Hypothetical protein PH0186; KAIC, RECA ATPase, un	86.68
3trf_A	185	Shikimate kinase, SK; amino acid biosynthesis, tra	86.65
2w58_A	202	DNAI, primosome component (helicase loader); ATP-b	86.63
4a74_A	231	DNA repair and recombination protein RADA; hydrola	86.52
3kb2_A	173	SPBC2 prophage-derived uncharacterized protein YOR	86.47
1via_A	175	Shikimate kinase; structural genomics, transferase	86.39
3jvv_A	356	Twitching mobility protein; hexameric P-loop ATPas	86.25
3lw7_A	179	Adenylate kinase related protein (ADKA-like); AMP,	86.22
2chg_A	226	Replication factor C small subunit; DNA-binding pr	86.19
2iyv_A	184	Shikimate kinase, SK; transferase, aromatic amino	86.15
1knq_A	175	Gluconate kinase; ALFA/beta structure, transferase	86.13
2ewv_A	372	Twitching motility protein PILT; pilus retraction	86.12
3bos_A	242	Putative DNA replication factor; P-loop containing	85.9
2cvh_A	220	DNA repair and recombination protein RADB; filamen	85.81
4ag6_A	392	VIRB4 ATPase, type IV secretory pathway VIRB4 comp	85.75
1e6c_A	173	Shikimate kinase; phosphoryl transfer, ADP, shikim	85.75
2dr3_A	247	UPF0273 protein PH0284; RECA superfamily ATPase, h	85.68
2r62_A	268	Cell division protease FTSH homolog; ATPase domain	85.55
3b6e_A	216	Interferon-induced helicase C domain-containing P;	85.54
4eun_A	200	Thermoresistant glucokinase; putative sugar kinase	85.54
2ze6_A	253	Isopentenyl transferase; crown GALL tumor, cytokin	85.46
1uf9_A	203	TT1252 protein; P-loop, nucleotide binding domain,	85.44
1xjc_A	169	MOBB protein homolog; structural genomics, midwest	85.38
3iij_A	180	Coilin-interacting nuclear ATPase protein; alpha a	85.25
3ney_A	197	55 kDa erythrocyte membrane protein; structural ge	85.14
1n0w_A	243	DNA repair protein RAD51 homolog 1; DNA repair, ho	85.13
1kag_A	173	SKI, shikimate kinase I; transferase, structural g	85.12
1ye8_A	178	Protein THEP1, hypothetical UPF0334 kinase-like pr	85.08
1np6_A	174	Molybdopterin-guanine dinucleotide biosynthesis pr	85.07
3n70_A	145	Transport activator; sigma-54, ntpase, PSI, MCSG,	85.04
2ius_A	512	DNA translocase FTSK; nucleotide-binding, chromoso	84.94
1sq5_A	308	Pantothenate kinase; P-loop, transferase; HET: PAU	84.65
1p9r_A	418	General secretion pathway protein E; bacterial typ	84.63
3syl_A	309	Protein CBBX; photosynthesis, rubisco activase, AA	84.56
1njg_A	250	DNA polymerase III subunit gamma; rossman-like fol	84.52
2gza_A	361	Type IV secretion system protein VIRB11; ATPase, h	84.48
1rif_A	282	DAR protein, DNA helicase UVSW; bacteriophage, REC	84.4
2rhm_A	193	Putative kinase; P-loop containing nucleoside trip	84.37
2pt5_A	168	Shikimate kinase, SK; aromatic amino acid biosynth	84.34
1cr0_A	296	DNA primase/helicase; RECA-type protein fold, tran	84.22
1s96_A	219	Guanylate kinase, GMP kinase; E.coli, dimer, SAD,	84.21
3tqc_A	321	Pantothenate kinase; biosynthesis of cofactors, pr	84.1
2bdt_A	189	BH3686; alpha-beta protein, structural genomics, P	84.09
3tqf_A	181	HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co	83.84
2qt1_A	207	Nicotinamide riboside kinase 1; non-protein kinase	83.84
3d3q_A	340	TRNA delta(2)-isopentenylpyrophosphate transferase	83.65
1lv7_A	257	FTSH; alpha/beta domain, four helix bundle, hydrol	83.58
2zts_A	251	Putative uncharacterized protein PH0186; KAIC like	83.53
2bbw_A	246	Adenylate kinase 4, AK4; nucleotide kinase, nucleo	83.52
2jaq_A	205	Deoxyguanosine kinase; transferase, deoxyribonucle	83.52
2bjv_A	265	PSP operon transcriptional activator; AAA, transcr	83.21
1zuh_A	168	Shikimate kinase; alpha-beta protein, transferase;	83.18
1gvn_B	287	Zeta; postsegregational killing system, plasmid; 1	83.1
2fwr_A	472	DNA repair protein RAD25; DNA unwinding, XPB, DNA	83.06
1nks_A	194	Adenylate kinase; thermophilic, transferase; HET:	83.05
2iut_A	574	DNA translocase FTSK; nucleotide-binding, chromoso	82.9
3hws_A	363	ATP-dependent CLP protease ATP-binding subunit CL;	82.82
2oca_A	510	DAR protein, ATP-dependent DNA helicase UVSW; ATP-	82.81
1tev_A	196	UMP-CMP kinase; ploop, NMP binding region, LID reg	82.77
1htw_A	158	HI0065; nucleotide-binding fold, structural genomi	82.73
2qz4_A	262	Paraplegin; AAA+, SPG7, protease, ADP, structural	82.67
1qf9_A	194	UMP/CMP kinase, protein (uridylmonophosphate/cytid	82.64
1gtv_A	214	TMK, thymidylate kinase; transferase, transferase	82.58
2kjq_A	149	DNAA-related protein; solution structure, NESG, st	82.32
3llm_A	235	ATP-dependent RNA helicase A; alpha-beta-alpha, st	82.28
2bwj_A	199	Adenylate kinase 5; phosphoryl transfer reaction,	82.18
1d2n_A	272	N-ethylmaleimide-sensitive fusion protein; hexamer	82.07
3r20_A	233	Cytidylate kinase; structural genomics, seattle st	82.04
4gl2_A	699	Interferon-induced helicase C domain-containing P;	81.63
1a7j_A	290	Phosphoribulokinase; transferase, calvin cycle; 2.	81.53
1ixz_A	254	ATP-dependent metalloprotease FTSH; AAA domain fol	81.53
1zp6_A	191	Hypothetical protein ATU3015; alpha-beta protein.,	81.38
1uj2_A	252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	81.31
1ly1_A	181	Polynucleotide kinase; PNK, phosphatase, transfera	81.26
3lnc_A	231	Guanylate kinase, GMP kinase; ALS collaborative cr	81.18
2yvu_A	186	Probable adenylyl-sulfate kinase; transferase, str	81.13
3b9p_A	297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	80.53
3uk6_A	368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	80.44
3t15_A	293	Ribulose bisphosphate carboxylase/oxygenase activ	80.37
1sxj_E	354	Activator 1 40 kDa subunit; clamp loader, processi	80.35
1jjv_A	206	Dephospho-COA kinase; P-loop nucleotide-binding fo	80.32
3fb4_A	216	Adenylate kinase; psychrophIle, phosphotransferase	80.21
1knx_A	312	Probable HPR(Ser) kinase/phosphatase; HPR kinase,	80.12
2pbr_A	195	DTMP kinase, thymidylate kinase; transferase, nucl	80.06

>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9

Probab=99.93  E-value=5.9e-27  Score=187.78  Aligned_cols=76  Identities=29%  Similarity=0.451  Sum_probs=67.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+...    ......++++|+++  ||||||||||.+||||||||||++|+|+.+|.|
T Consensus        99 isGESGAGKTe~tK~i~~yla~~~~~~----~~~~~~i~~~il~snpiLEAFGNAkT~rNdNSSRFGKfi~i~F~~~g~i  174 (697)
T 1lkx_A           99 ISGESGAGKTEASKKIMQFLTFVSSNQ----SPNGERISKMLLDSNPLLEAFGNAKTLRNDNSSRFGKYMEMQFNAVGSP  174 (697)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHHHSCSS----CHHHHHHHHHHHHHHHHHHHHHBBCCSSCSSCBCSEEEEEEEECTTCCE
T ss_pred             ecCCCCCCchhhHHHHHHHHHhhcCCC----CCccccHHHHHHhcchHHHHhcCcccCCCCCcchhheeEEEEECCCCCE
Confidence            479999999999999999999987521    11236899999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       175 ~G  176 (697)
T 1lkx_A          175 IG  176 (697)
T ss_dssp             EE
T ss_pred             ee
Confidence            76

>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ...

Probab=99.93  E-value=4e-27  Score=191.61  Aligned_cols=80  Identities=35%  Similarity=0.534  Sum_probs=68.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccC----ccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCC
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRD----TKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKE   74 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~----~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~   74 (80)
                      |.|||||||||++|++|+||+..+.+...++    ......++++|+++  ||||||||||.+||||||||||++|+|+.
T Consensus       174 iSGESGAGKTe~tK~i~~yla~~~~~~~~~~~~~~~~~~~~ie~~il~snpiLEAFGNAkT~rNdNSSRFGKfi~i~F~~  253 (837)
T 1kk8_A          174 ITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGP  253 (837)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHHHSCCCCCC--------CCCHHHHHHHHHHHHHHHHEECCSSCTTEESSEEEEEEEECT
T ss_pred             EeCCCCCCchhhHHHHHHHHHHhcccCCcccccccccccccHHHHHHHHHHHHHHhcCccCCCCCCCCCceeEEEEEECC
Confidence            4799999999999999999999876532111    11136799999999  99999999999999999999999999999


Q ss_pred             CCeecC
Q psy17057         75 NGMVHG   80 (80)
Q Consensus        75 ~g~l~G   80 (80)
                      +|+|+|
T Consensus       254 ~g~i~G  259 (837)
T 1kk8_A          254 TGKIAG  259 (837)
T ss_dssp             TSSEEE
T ss_pred             CCCEee
Confidence            999876

>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A

Probab=99.93  E-value=6.6e-27  Score=189.53  Aligned_cols=74  Identities=24%  Similarity=0.346  Sum_probs=67.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+.+..      ...++++|+++  ||||||||||.+||||||||||++|+|+.+|+|
T Consensus       161 isGESGAGKTe~tK~i~~yla~~~~~~~------~~~ie~~il~snpiLEAFGNAkT~rNdNSSRFGKfi~i~F~~~g~i  234 (795)
T 1w7j_A          161 VSGESGAGKTVSAKYAMRYFATVSGSAS------EANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRI  234 (795)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHHHTCCSS------SSCHHHHHHHHHHHHHHHHEECCSSCTTEECSEEEEEEEECTTSCE
T ss_pred             EeCCCCCCcchHHHHHHHHHHhhcCCCC------ccchHHHHHHHHHHHHHhcCccCCCCCCccccceEEEEEECCCCCE
Confidence            4799999999999999999998875421      15799999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       235 ~G  236 (795)
T 1w7j_A          235 IG  236 (795)
T ss_dssp             EE
T ss_pred             ee
Confidence            76

>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A*

Probab=99.93  E-value=6.8e-27  Score=189.35  Aligned_cols=80  Identities=30%  Similarity=0.343  Sum_probs=67.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCc---cchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCC
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDT---KFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKEN   75 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~---~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~   75 (80)
                      |.|||||||||++|+||+||+..+........   ....+++++|+++  ||||||||||.+||||||||||++|+|+.+
T Consensus       176 iSGESGAGKTe~tK~im~yla~v~~~~~~~~~~~~~~~~~ve~~il~snpiLEAFGNAkT~rNdNSSRFGK~i~i~F~~~  255 (783)
T 4db1_A          176 ITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGAT  255 (783)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHHHSBCCCC-------CCSCHHHHHHHHHHHHHHHHEECCSSCTTEECSEEEEEEEECTT
T ss_pred             EeCCCCCCCchHHHHHHHhhhhhccCCCccccccccccccHHHHHHHhHHHHHhccCcccCCCCCCCccceeEEEEECCC
Confidence            47999999999999999999987653211110   1125799999999  999999999999999999999999999999


Q ss_pred             CeecC
Q psy17057         76 GMVHG   80 (80)
Q Consensus        76 g~l~G   80 (80)
                      |+|+|
T Consensus       256 g~i~G  260 (783)
T 4db1_A          256 GKLAS  260 (783)
T ss_dssp             SBEEE
T ss_pred             CCEee
Confidence            99876

>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ...

Probab=99.93  E-value=9.3e-27  Score=188.36  Aligned_cols=77  Identities=35%  Similarity=0.479  Sum_probs=67.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|+||+||+..+.+...   +....++++|+++  ||||||||||.+|+||||||||++|+|+.+|+|
T Consensus       177 isGESGAGKTe~tK~i~~yla~~~~~~~~---~~~~~ie~~il~snpiLEAFGNAkT~rNdNSSRFGKfi~i~F~~~g~i  253 (770)
T 1w9i_A          177 ITGESGAGKTENTKKVIQYLASVAGRNQA---NGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFI  253 (770)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHHHHCC---------CHHHHHHHHHHHHHHHHHEECCSSCTTEESSEEEEEEEECTTSCE
T ss_pred             EecCCCCcchHHHHHHHHHHHHhccccCC---cccCcHHHHHHHHHHHHHHhCCCcCCCCCCcCCcceEEEEEECCCCCE
Confidence            47999999999999999999998764321   1136799999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       254 ~G  255 (770)
T 1w9i_A          254 SG  255 (770)
T ss_dssp             EE
T ss_pred             ee
Confidence            76

>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A*

Probab=99.93  E-value=5.9e-27  Score=189.54  Aligned_cols=72  Identities=40%  Similarity=0.510  Sum_probs=62.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|+||+||+..+..        ...++++|+++  ||||||||||.+||||||||||++|+|+.+|+|
T Consensus       145 iSGESGAGKTe~tK~i~~yla~~~~~--------~~~ie~~il~snpiLEAFGNAKT~rNdNSSRFGKfi~i~F~~~g~i  216 (784)
T 2v26_A          145 VSGESGAGKTENTKFVLRYLTESYGT--------GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSV  216 (784)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHHHHC--------------CHHHHTHHHHHHHHEECCSSCTTEECSEEEEEEEECTTSCE
T ss_pred             EcCCCCCCceehHHHHHHHHHhhcCC--------CCcHHHHHHHHHHHHHHhCCCcCCCCCCcchhheEEEEEEecCCcE
Confidence            47999999999999999999976432        14699999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       217 ~G  218 (784)
T 2v26_A          217 VG  218 (784)
T ss_dssp             EE
T ss_pred             ee
Confidence            76

>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1

Probab=99.93  E-value=2.3e-26  Score=189.65  Aligned_cols=77  Identities=34%  Similarity=0.462  Sum_probs=68.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|+||+||+..+.+...+   ....++++|+++  ||||||||||.+||||||||||++|+|+.+|.|
T Consensus       177 isGESGAGKTe~~K~i~~yla~~~~~~~~~---~~~~ie~~il~snpiLEAFGNAkT~rN~NSSRFGK~i~i~F~~~g~i  253 (1010)
T 1g8x_A          177 ITGESGAGKTENTKKVIQYLASVAGRNQAN---GSGVLEQQILQANPILEAFGNAKTTRNNNSSEFGKFIEIQFNNAGFI  253 (1010)
T ss_dssp             EEESTTSSHHHHHHHHHHHHHHHHCCCCTT---TSSHHHHHHHHHHHHHHHHHEECCSSCTTEECSEEEEEEEECTTSCE
T ss_pred             EeCCCCCCcchHHHHHHHHHHHhcccCCCc---ccchHHHHHHHHHHHHHHhCCCcCCCCCCccccceEEEEEECCCCCC
Confidence            479999999999999999999987653211   126899999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       254 ~G  255 (1010)
T 1g8x_A          254 SG  255 (1010)
T ss_dssp             EE
T ss_pred             cc
Confidence            76

>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa}

Probab=99.92  E-value=1.3e-26  Score=192.05  Aligned_cols=72  Identities=40%  Similarity=0.514  Sum_probs=64.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|+||+||+..+...        ..++++|+++  ||||||||+|.+|+||||||||++|+|+..|+|
T Consensus       149 iSGESGAGKTestK~im~yLa~~~~~~--------~~ie~~Il~snpiLEAFGNAKT~rNdNSSRFGK~iel~F~~~G~i  220 (1052)
T 4anj_A          149 VSGESGAGKTENTKFVLRYLTESYGTG--------QDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSV  220 (1052)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHHHHCC-----------CTTHHHHTHHHHHHHHEECCSSCTTEESSEEEEEEEECTTSCE
T ss_pred             EecCCCCCHHHHHHHHHHHHHHhcCCC--------ccHHHHHHHHHHHHHhccCCCCCCCCCcCCceeEEEEEECCCCCE
Confidence            479999999999999999999876532        4589999999  999999999999999999999999999999999


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       221 ~G  222 (1052)
T 4anj_A          221 VG  222 (1052)
T ss_dssp             EE
T ss_pred             EE
Confidence            76

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A

Probab=99.92  E-value=2e-26  Score=190.86  Aligned_cols=80  Identities=34%  Similarity=0.503  Sum_probs=68.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccC-ccc-------hhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEE
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRD-TKF-------FDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQV   70 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~-~~~-------~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l   70 (80)
                      |.|||||||||++|+||+||+..+.+...+. +..       ...|+++|+++  ||||||||||.+||||||||||++|
T Consensus       174 isGeSGaGKTe~~k~~~~yla~~~~~~~~~~~~~~~~~~~~~~~~~~~~il~~npileaFGnAkT~rN~NSSRfgk~~~i  253 (1184)
T 1i84_S          174 CTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFSYGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRI  253 (1184)
T ss_dssp             CCCSTTSSTTHHHHHHHHHHHHHSSCCSCC------CTTCCCCCSHHHHHHHHHHHHTTTTEEEETTEEEEECSCEEEEE
T ss_pred             EecCCCCCccHHHHHHHHHHHHHhcCCCcccccccccccccccchHHHHHHHHHHHHHHhcCCcCCCCccccccceeEEE
Confidence            6899999999999999999999876522111 000       26899999999  9999999999999999999999999


Q ss_pred             EeCCCCeecC
Q psy17057         71 NYKENGMVHG   80 (80)
Q Consensus        71 ~f~~~g~l~G   80 (80)
                      +|+.+|.|+|
T Consensus       254 ~f~~~g~i~g  263 (1184)
T 1i84_S          254 NFDVTGYIVG  263 (1184)
T ss_dssp             EECSSSCEEE
T ss_pred             EECCCCCEee
Confidence            9999999976

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}

Probab=99.92  E-value=1.9e-26  Score=190.96  Aligned_cols=74  Identities=24%  Similarity=0.346  Sum_probs=67.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+.+..      ...++++|+++  ||||||||||.+||||||||||++|+|+.+|.|
T Consensus       161 isGESGAGKTe~~K~i~~yla~~~~~~~------~~~ie~~il~snpiLEAFGNAkT~rN~NSSRFGK~i~i~F~~~g~i  234 (1080)
T 2dfs_A          161 VSGESGAGKTVSAKYAMRYFATVSGSAS------EANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRI  234 (1080)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHHTTTCCT------TTCTHHHHHHHHHHHHHHHEEEETTEEEEECSEEEEEEEECTTCCE
T ss_pred             EcCCCCCCccchHHHHHHHHHhhccCCC------ccchHHHHHHHHHHHHHhcCCcCCCCCCccccceeEEEEECCCCCE
Confidence            4799999999999999999998865421      15799999999  999999999999999999999999999999999


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      +|
T Consensus       235 ~G  236 (1080)
T 2dfs_A          235 IG  236 (1080)
T ss_dssp             EE
T ss_pred             ee
Confidence            76

>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A*

Probab=99.92  E-value=1.4e-26  Score=190.62  Aligned_cols=80  Identities=35%  Similarity=0.491  Sum_probs=67.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCccc-CccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCe
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNR-DTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGM   77 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~-~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~   77 (80)
                      |.|||||||||++|+||+||+..+.+...+ ++.....++++|+++  ||||||||||.+||||||||||++|+|+.+|.
T Consensus       151 isGESGAGKTe~~K~i~~yla~~~~~~~~~~~~~~~~~ie~~il~~npiLEAFGNAkT~rN~NSSRFGK~i~i~F~~~g~  230 (995)
T 2ycu_A          151 CTGESGAGKTENTKKVIQYLAHVASSPKGRKEPGVPGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGY  230 (995)
T ss_dssp             EECBTTSSHHHHHHHHHHHHHHHSCCSSSCSSSCCCC-CCSTTTSHHHHHHHHHEECCSSCTTEESSEEEEEEEECTTSC
T ss_pred             ecCCCCCCchhhHHHHHHHHHHhcccCCccccccccccHHHHHHHHHHHHHHhcCccCCCCCCCCccceEEEEEECCCCC
Confidence            479999999999999999999987653211 111125789999999  99999999999999999999999999999999


Q ss_pred             ecC
Q psy17057         78 VHG   80 (80)
Q Consensus        78 l~G   80 (80)
                      |+|
T Consensus       231 i~G  233 (995)
T 2ycu_A          231 IVG  233 (995)
T ss_dssp             EEE
T ss_pred             Eee
Confidence            876

>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1

Probab=91.97  E-value=0.056  Score=35.05  Aligned_cols=20  Identities=10%  Similarity=0.101  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+|||-+.+.++..+
T Consensus        10 i~GpsGsGKSTL~~~L~~~~   29 (180)
T 1kgd_A           10 LLGAHGVGRRHIKNTLITKH   29 (180)
T ss_dssp             EECCTTSSHHHHHHHHHHHC
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            46999999999999988764

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}

Probab=91.93  E-value=0.067  Score=35.37  Aligned_cols=21  Identities=14%  Similarity=0.186  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|+||||||-+.+.+...+-
T Consensus        27 I~G~sGsGKSTl~~~l~~~~~   47 (208)
T 3c8u_A           27 LSGAPGSGKSTLSNPLAAALS   47 (208)
T ss_dssp             EECCTTSCTHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHh
Confidence            479999999999999988764

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6

Probab=90.97  E-value=0.098  Score=37.28  Aligned_cols=22  Identities=14%  Similarity=0.176  Sum_probs=19.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|.||+|||-+.+.+...|-.
T Consensus        36 I~G~sGsGKSTla~~L~~~l~~   57 (290)
T 1odf_A           36 FSGPQGSGKSFTSIQIYNHLME   57 (290)
T ss_dssp             EECCTTSSHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHhhh
Confidence            5899999999999999888754

>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1

Probab=90.62  E-value=0.12  Score=34.22  Aligned_cols=20  Identities=10%  Similarity=0.130  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|+||||||-+.++++..+
T Consensus         9 lvGpsGaGKSTLl~~L~~~~   28 (198)
T 1lvg_A            9 LSGPSGAGKSTLLKKLFQEH   28 (198)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            35999999999999998865

>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus}

Probab=90.01  E-value=0.075  Score=35.19  Aligned_cols=23  Identities=17%  Similarity=0.281  Sum_probs=19.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      |.|+||+|||-+.++++.++-..
T Consensus         7 IvG~SGsGKSTL~~~L~~~~~~~   29 (171)
T 2f1r_A            7 IVGTSDSGKTTLITRMMPILRER   29 (171)
T ss_dssp             EEESCHHHHHHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHhhhc
Confidence            46999999999999999987543

>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax}

Probab=89.64  E-value=0.12  Score=33.87  Aligned_cols=20  Identities=20%  Similarity=0.150  Sum_probs=17.5

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.||+|||...+.+...+
T Consensus        17 l~G~sGsGKsTl~~~L~~~~   36 (204)
T 2qor_A           17 VCGPSGVGKGTLIKKVLSEF   36 (204)
T ss_dssp             EECCTTSCHHHHHHHHHHHC
T ss_pred             EECCCCCCHHHHHHHHHHhC
Confidence            46999999999999988766

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}

Probab=89.60  E-value=0.19  Score=32.51  Aligned_cols=22  Identities=27%  Similarity=0.291  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|+|||-..+.++..+..
T Consensus        28 i~G~~GsGKTtl~~~l~~~~~~   49 (235)
T 2w0m_A           28 LTGEPGTGKTIFSLHFIAKGLR   49 (235)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHHHHH
Confidence            4699999999999998876654

>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A*

Probab=89.56  E-value=0.14  Score=33.42  Aligned_cols=20  Identities=30%  Similarity=0.366  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|||||-..+++...+
T Consensus        11 i~G~~GsGKSTl~~~l~~~~   30 (211)
T 3asz_A           11 IAGGTASGKTTLAQALARTL   30 (211)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999999998865

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20

Probab=89.51  E-value=0.17  Score=31.21  Aligned_cols=22  Identities=14%  Similarity=0.101  Sum_probs=18.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|.|||.+.+.+.+.+..
T Consensus        48 l~G~~G~GKT~l~~~~~~~~~~   69 (195)
T 1jbk_A           48 LIGEPGVGKTAIVEGLAQRIIN   69 (195)
T ss_dssp             EECCTTSCHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            3599999999999999888754

>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii}

Probab=89.29  E-value=0.14  Score=32.95  Aligned_cols=20  Identities=15%  Similarity=0.200  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|||||-+.+++...+
T Consensus        12 l~Gp~GsGKSTl~~~L~~~~   31 (205)
T 3tr0_A           12 ISAPSGAGKTSLVRALVKAL   31 (205)
T ss_dssp             EECCTTSCHHHHHHHHHHHS
T ss_pred             EECcCCCCHHHHHHHHHhhC
Confidence            35999999999999987754

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*

Probab=89.09  E-value=0.19  Score=32.90  Aligned_cols=21  Identities=14%  Similarity=0.199  Sum_probs=18.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +-|.+|+|||-+.+.+...|-
T Consensus        30 l~G~sGsGKSTl~~~La~~l~   50 (200)
T 3uie_A           30 VTGLSGSGKSTLACALNQMLY   50 (200)
T ss_dssp             EECSTTSSHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            359999999999999988763

>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus}

Probab=88.89  E-value=0.18  Score=35.21  Aligned_cols=22  Identities=14%  Similarity=0.104  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|+||||||-+-+.++.++-.
T Consensus        30 i~Gp~GsGKSTll~~l~g~~~~   51 (261)
T 2eyu_A           30 VTGPTGSGKSTTIASMIDYINQ   51 (261)
T ss_dssp             EECSTTCSHHHHHHHHHHHHHH
T ss_pred             EECCCCccHHHHHHHHHHhCCC
Confidence            4699999999999999987643

>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A*

Probab=88.39  E-value=0.22  Score=32.63  Aligned_cols=20  Identities=15%  Similarity=0.132  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-..+++...+
T Consensus        10 i~G~~GsGKSTl~~~L~~~~   29 (227)
T 1cke_A           10 IDGPSGAGKGTLCKAMAEAL   29 (227)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            36999999999999998754

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A*

Probab=88.23  E-value=0.21  Score=35.86  Aligned_cols=21  Identities=29%  Similarity=0.275  Sum_probs=18.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.+|||||-+.+++...+-
T Consensus        95 I~G~sGsGKSTL~~~L~gll~  115 (312)
T 3aez_A           95 VAGSVAVGKSTTARVLQALLA  115 (312)
T ss_dssp             EECCTTSCHHHHHHHHHHHHH
T ss_pred             EECCCCchHHHHHHHHHhhcc
Confidence            579999999999999887663

>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus}

Probab=88.23  E-value=0.14  Score=32.96  Aligned_cols=20  Identities=10%  Similarity=0.086  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|||||-..+++...+
T Consensus        11 l~G~~GsGKSTl~~~L~~~~   30 (207)
T 2j41_A           11 LSGPSGVGKGTVRKRIFEDP   30 (207)
T ss_dssp             EECSTTSCHHHHHHHHHHCT
T ss_pred             EECCCCCCHHHHHHHHHHhh
Confidence            36999999999999988765

>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum}

Probab=88.12  E-value=0.19  Score=33.76  Aligned_cols=20  Identities=15%  Similarity=0.124  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|+||||||-+.++++..+
T Consensus        28 lvGpsGsGKSTLl~~L~g~~   47 (218)
T 1z6g_A           28 ICGPSGVGKGTLIKKLLNEF   47 (218)
T ss_dssp             EECSTTSSHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            35999999999999998865

>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A*

Probab=88.11  E-value=0.24  Score=31.84  Aligned_cols=20  Identities=20%  Similarity=0.262  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||...+.+...|
T Consensus         7 i~G~~GsGKst~~~~la~~l   26 (208)
T 3ake_A            7 IDGPSASGKSSVARRVAAAL   26 (208)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            47999999999999887654

>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes}

Probab=87.94  E-value=0.15  Score=33.78  Aligned_cols=19  Identities=16%  Similarity=0.083  Sum_probs=16.7

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      .|+||+|||.+.+.++..+
T Consensus        14 ~GpsGsGKsTl~~~L~~~~   32 (208)
T 3tau_A           14 SGPSGVGKGTVREAVFKDP   32 (208)
T ss_dssp             ECCTTSCHHHHHHHHHHST
T ss_pred             ECcCCCCHHHHHHHHHhhC
Confidence            5999999999999887754

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}

Probab=87.76  E-value=0.23  Score=30.78  Aligned_cols=22  Identities=14%  Similarity=0.155  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|.|||.+.+.+.+.+..
T Consensus        48 l~G~~G~GKT~la~~~~~~~~~   69 (187)
T 2p65_A           48 LLGDPGVGKTAIVEGLAIKIVQ   69 (187)
T ss_dssp             EESCGGGCHHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            3599999999999999887744

>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis}

Probab=87.51  E-value=0.22  Score=34.08  Aligned_cols=20  Identities=15%  Similarity=0.102  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|||||.+.+++.+.|
T Consensus        32 I~G~~GsGKSTl~k~La~~L   51 (252)
T 4e22_A           32 VDGPSGAGKGTLCKALAESL   51 (252)
T ss_dssp             EECCTTSSHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            46999999999999998543

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6

Probab=87.44  E-value=0.23  Score=32.64  Aligned_cols=20  Identities=20%  Similarity=0.192  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-+.+.+...+
T Consensus        27 i~G~~GsGKstl~~~l~~~~   46 (201)
T 1rz3_A           27 IDGLSRSGKTTLANQLSQTL   46 (201)
T ss_dssp             EEECTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            46999999999999988766

>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A*

Probab=87.29  E-value=0.27  Score=33.20  Aligned_cols=20  Identities=20%  Similarity=0.300  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|++|||||-..+++...+
T Consensus        30 I~G~~GsGKSTl~k~L~~~l   49 (245)
T 2jeo_A           30 VSGGTASGKSTVCEKIMELL   49 (245)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999999987755

>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A

Probab=87.24  E-value=0.24  Score=33.34  Aligned_cols=19  Identities=11%  Similarity=0.179  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|+||+||+.+.+.++..
T Consensus         6 i~GPSG~GK~Tl~~~L~~~   24 (186)
T 1ex7_A            6 ISGPSGTGKSTLLKKLFAE   24 (186)
T ss_dssp             EECCTTSSHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHh
Confidence            4699999999998877654

>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A

Probab=87.21  E-value=0.31  Score=32.06  Aligned_cols=19  Identities=11%  Similarity=0.100  Sum_probs=16.8

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|++|||||-+.+.+...+
T Consensus        26 ~GpnGsGKSTLl~~l~gl~   44 (207)
T 1znw_A           26 SGPSAVGKSTVVRCLRERI   44 (207)
T ss_dssp             ECSTTSSHHHHHHHHHHHS
T ss_pred             ECCCCCCHHHHHHHHHhhC
Confidence            5999999999999998765

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*

Probab=87.18  E-value=0.29  Score=33.50  Aligned_cols=20  Identities=25%  Similarity=0.218  Sum_probs=17.8

Q ss_pred             CCCcCCchHHHHHHHHHHHh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~   21 (80)
                      .|++|.|||.+++.+...+.
T Consensus        53 ~G~~GtGKt~la~~la~~~~   72 (311)
T 4fcw_A           53 LGPTGVGKTELAKTLAATLF   72 (311)
T ss_dssp             ESCSSSSHHHHHHHHHHHHH
T ss_pred             ECCCCcCHHHHHHHHHHHHc
Confidence            59999999999999988763

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron}

Probab=87.11  E-value=0.29  Score=31.91  Aligned_cols=20  Identities=20%  Similarity=0.122  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-..+.+...|
T Consensus        30 l~G~~GsGKsTl~~~La~~l   49 (199)
T 3vaa_A           30 LTGYMGAGKTTLGKAFARKL   49 (199)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHHc
Confidence            35999999999999998765

>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A

Probab=87.07  E-value=0.3  Score=30.79  Aligned_cols=21  Identities=14%  Similarity=0.022  Sum_probs=17.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.|.+|+|||-..+.+..+|-
T Consensus         8 i~G~~GsGKsT~~~~L~~~l~   28 (192)
T 1kht_A            8 VTGVPGVGSTTSSQLAMDNLR   28 (192)
T ss_dssp             EECCTTSCHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            469999999999999887653

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*

Probab=87.01  E-value=0.37  Score=30.67  Aligned_cols=20  Identities=25%  Similarity=0.277  Sum_probs=17.9

Q ss_pred             CCCcCCchHHHHHHHHHHHh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~   21 (80)
                      -|++|+|||-+.+.+...+.
T Consensus        44 ~G~~G~GKTtL~~~i~~~~~   63 (180)
T 3ec2_A           44 VGSPGVGKTHLAVATLKAIY   63 (180)
T ss_dssp             CCSSSSSHHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHHH
Confidence            59999999999999988775

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*

Probab=86.99  E-value=0.29  Score=33.21  Aligned_cols=20  Identities=25%  Similarity=0.140  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|.|||.+++.+.+.+
T Consensus        55 l~G~~GtGKT~la~~la~~l   74 (310)
T 1ofh_A           55 MIGPTGVGKTEIARRLAKLA   74 (310)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            35999999999999998876

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*

Probab=86.78  E-value=0.25  Score=31.09  Aligned_cols=20  Identities=20%  Similarity=0.248  Sum_probs=16.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|||||-+.+.+...|
T Consensus         8 l~G~~GsGKST~a~~La~~l   27 (178)
T 1qhx_A            8 LNGGSSAGKSGIVRCLQSVL   27 (178)
T ss_dssp             EECCTTSSHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            36999999999999987754

>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti}

Probab=86.69  E-value=0.32  Score=31.54  Aligned_cols=20  Identities=10%  Similarity=0.061  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|||||-..+.+...+
T Consensus        23 l~G~~GsGKSTla~~L~~~l   42 (202)
T 3t61_A           23 VMGVSGSGKSSVGEAIAEAC   42 (202)
T ss_dssp             EECSTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999999987765

>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii}

Probab=86.65  E-value=0.33  Score=30.83  Aligned_cols=20  Identities=15%  Similarity=0.042  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-+.+.+.+.|
T Consensus        10 l~G~~GsGKst~a~~La~~l   29 (185)
T 3trf_A           10 LIGLMGAGKTSVGSQLAKLT   29 (185)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            35999999999999987765

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}

Probab=86.63  E-value=0.32  Score=31.36  Aligned_cols=22  Identities=23%  Similarity=0.078  Sum_probs=18.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +-|++|+|||-+.+.+...+..
T Consensus        59 l~G~~GtGKT~la~~i~~~~~~   80 (202)
T 2w58_A           59 LHGSFGVGKTYLLAAIANELAK   80 (202)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHHHH
Confidence            3599999999999988877643

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*

Probab=86.52  E-value=0.24  Score=32.15  Aligned_cols=20  Identities=15%  Similarity=0.190  Sum_probs=16.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|++|+|||-..+.++..+
T Consensus        30 l~G~nGsGKSTll~~l~g~~   49 (231)
T 4a74_A           30 VFGEFGSGKTQLAHTLAVMV   49 (231)
T ss_dssp             EEESTTSSHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            46999999999999887643

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A*

Probab=86.47  E-value=0.35  Score=29.93  Aligned_cols=20  Identities=15%  Similarity=0.061  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-..+.+...|
T Consensus         6 l~G~~GsGKsT~~~~L~~~l   25 (173)
T 3kb2_A            6 LEGPDCCFKSTVAAKLSKEL   25 (173)
T ss_dssp             EECSSSSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999999887664

>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2

Probab=86.39  E-value=0.34  Score=30.70  Aligned_cols=20  Identities=15%  Similarity=0.074  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-+.+.+...|
T Consensus         9 i~G~~GsGKsTla~~La~~l   28 (175)
T 1via_A            9 FIGFMGSGKSTLARALAKDL   28 (175)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHHc
Confidence            36999999999999887754

>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A*

Probab=86.25  E-value=0.32  Score=35.69  Aligned_cols=23  Identities=22%  Similarity=0.148  Sum_probs=19.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|+||||||-+-+.++.++-..
T Consensus       128 I~GptGSGKTTlL~~l~g~~~~~  150 (356)
T 3jvv_A          128 VTGPTGSGKSTTLAAMLDYLNNT  150 (356)
T ss_dssp             EECSTTSCHHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHhcccCC
Confidence            46999999999999998887543

>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A

Probab=86.22  E-value=0.28  Score=30.02  Aligned_cols=18  Identities=17%  Similarity=0.244  Sum_probs=15.3

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|.+|||||-.++.+ ..
T Consensus         6 l~G~~GsGKsT~a~~L-~~   23 (179)
T 3lw7_A            6 ITGMPGSGKSEFAKLL-KE   23 (179)
T ss_dssp             EECCTTSCHHHHHHHH-HH
T ss_pred             EECCCCCCHHHHHHHH-HH
Confidence            4699999999999988 53

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}

Probab=86.19  E-value=0.36  Score=30.41  Aligned_cols=21  Identities=19%  Similarity=0.224  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.|++|.|||.+.+.+.+.+.
T Consensus        43 l~G~~G~GKT~l~~~l~~~~~   63 (226)
T 2chg_A           43 FSGPPGTGKTATAIALARDLF   63 (226)
T ss_dssp             EECSTTSSHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHh
Confidence            359999999999999988763

>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A*

Probab=86.15  E-value=0.36  Score=30.69  Aligned_cols=20  Identities=15%  Similarity=0.119  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||.+++.+.+.|
T Consensus         7 l~G~~GsGKsT~a~~La~~l   26 (184)
T 2iyv_A            7 LVGLPGSGKSTIGRRLAKAL   26 (184)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            46999999999999887754

>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A*

Probab=86.13  E-value=0.36  Score=30.41  Aligned_cols=20  Identities=20%  Similarity=0.154  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|||||-..+.+...+
T Consensus        13 l~G~~GsGKSTl~~~l~~~~   32 (175)
T 1knq_A           13 LMGVSGSGKSAVASEVAHQL   32 (175)
T ss_dssp             EECSTTSCHHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHhh
Confidence            35999999999999887654

>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A*

Probab=86.12  E-value=0.34  Score=35.52  Aligned_cols=22  Identities=14%  Similarity=0.104  Sum_probs=19.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|+||||||-+-+.++.++-.
T Consensus       141 ivG~~GsGKTTll~~l~~~~~~  162 (372)
T 2ewv_A          141 VTGPTGSGKSTTIASMIDYINQ  162 (372)
T ss_dssp             EECSSSSSHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHhhcCc
Confidence            4699999999999999998754

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A

Probab=85.90  E-value=0.37  Score=31.12  Aligned_cols=22  Identities=9%  Similarity=-0.020  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|+|||.+.+.+...+..
T Consensus        57 l~G~~G~GKT~la~~l~~~~~~   78 (242)
T 3bos_A           57 LWGPVKSGRTHLIHAACARANE   78 (242)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHHH
Confidence            3599999999999999887653

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*

Probab=85.81  E-value=0.3  Score=31.55  Aligned_cols=18  Identities=28%  Similarity=0.246  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|+|||-..+.++.
T Consensus        25 i~G~~GsGKTtl~~~l~~   42 (220)
T 2cvh_A           25 VYGPYASGKTTLALQTGL   42 (220)
T ss_dssp             EECSTTSSHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            479999999999998876

>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A

Probab=85.75  E-value=0.36  Score=34.82  Aligned_cols=22  Identities=14%  Similarity=-0.005  Sum_probs=18.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|.||+|||.+.+.++..+..
T Consensus        40 i~G~~G~GKs~~~~~~~~~~~~   61 (392)
T 4ag6_A           40 ILAKPGAGKSFTAKMLLLREYM   61 (392)
T ss_dssp             EECCTTSSHHHHHHHHHHHHHT
T ss_pred             EEcCCCCCHHHHHHHHHHHHHH
Confidence            4699999999999998876643

>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*

Probab=85.75  E-value=0.39  Score=29.96  Aligned_cols=20  Identities=20%  Similarity=0.084  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||...+.+...|
T Consensus         7 l~G~~GsGKsT~a~~La~~l   26 (173)
T 1e6c_A            7 MVGARGCGMTTVGRELARAL   26 (173)
T ss_dssp             EESCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            36999999999999887754

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}

Probab=85.68  E-value=0.33  Score=31.82  Aligned_cols=22  Identities=27%  Similarity=0.243  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|++|+|||.....++..++.
T Consensus        28 i~G~~GsGKTtl~~~~~~~~~~   49 (247)
T 2dr3_A           28 LSGGPGTGKTIFSQQFLWNGLK   49 (247)
T ss_dssp             EEECTTSSHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            4799999999997776665543

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*

Probab=85.55  E-value=0.57  Score=31.52  Aligned_cols=20  Identities=20%  Similarity=0.071  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|++|.|||-+++.+...+
T Consensus        49 l~G~~GtGKT~la~~la~~~   68 (268)
T 2r62_A           49 LVGPPGTGKTLLAKAVAGEA   68 (268)
T ss_dssp             CBCSSCSSHHHHHHHHHHHH
T ss_pred             EECCCCCcHHHHHHHHHHHh
Confidence            46999999999999987765

>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens}

Probab=85.54  E-value=0.26  Score=31.61  Aligned_cols=22  Identities=18%  Similarity=0.021  Sum_probs=17.9

Q ss_pred             CCCcCCchHHHHHHHHHHHhhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      .++||+|||.+..+++..++..
T Consensus        54 ~~~tGsGKT~~~~~~~~~~~~~   75 (216)
T 3b6e_A           54 CLPTGSGKTRVAVYIAKDHLDK   75 (216)
T ss_dssp             ECSCHHHHHHHHHHHHHHHHHH
T ss_pred             EcCCCCCHHHHHHHHHHHHHhh
Confidence            5799999999998888766543

>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP}

Probab=85.54  E-value=0.39  Score=31.29  Aligned_cols=20  Identities=20%  Similarity=0.013  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|||||-..+.+...+
T Consensus        34 l~G~~GsGKSTl~~~L~~~~   53 (200)
T 4eun_A           34 VMGVSGSGKTTIAHGVADET   53 (200)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHhh
Confidence            35999999999999987755

>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A

Probab=85.46  E-value=0.38  Score=33.04  Aligned_cols=20  Identities=20%  Similarity=0.225  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-.++.+...+
T Consensus         6 I~G~~GSGKSTla~~La~~~   25 (253)
T 2ze6_A            6 IYGPTCSGKTDMAIQIAQET   25 (253)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCcCHHHHHHHHHhcC
Confidence            47999999999999887765

>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1

Probab=85.44  E-value=0.29  Score=31.30  Aligned_cols=18  Identities=11%  Similarity=0.169  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|.+|||||.+.+++.+
T Consensus        13 i~G~~GsGKST~~~~La~   30 (203)
T 1uf9_A           13 ITGNIGSGKSTVAALLRS   30 (203)
T ss_dssp             EEECTTSCHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            469999999999998765

>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10

Probab=85.38  E-value=0.4  Score=31.96  Aligned_cols=23  Identities=17%  Similarity=0.145  Sum_probs=19.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      ++|.+|+|||-....++.+|...
T Consensus         9 i~G~sGsGKTTl~~~L~~~l~~~   31 (169)
T 1xjc_A            9 VVGYKHSGKTTLMEKWVAAAVRE   31 (169)
T ss_dssp             EECCTTSSHHHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHhhHhc
Confidence            47999999999999998887543

>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A

Probab=85.25  E-value=0.42  Score=30.32  Aligned_cols=20  Identities=15%  Similarity=0.062  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-..+.+...|
T Consensus        16 i~G~~GsGKst~~~~l~~~~   35 (180)
T 3iij_A           16 LTGTPGVGKTTLGKELASKS   35 (180)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHHHh
Confidence            46999999999999887765

>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0

Probab=85.14  E-value=0.32  Score=33.12  Aligned_cols=20  Identities=15%  Similarity=0.159  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+|||.+.+.++..+
T Consensus        24 l~GPSGaGKsTL~~~L~~~~   43 (197)
T 3ney_A           24 LIGASGVGRSHIKNALLSQN   43 (197)
T ss_dssp             EECCTTSSHHHHHHHHHHHC
T ss_pred             EECcCCCCHHHHHHHHHhhC
Confidence            36999999999999988764

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11

Probab=85.13  E-value=0.37  Score=31.60  Aligned_cols=19  Identities=21%  Similarity=0.160  Sum_probs=16.5

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|+|||-+.+.++..
T Consensus        29 i~G~~GsGKTtl~~~l~~~   47 (243)
T 1n0w_A           29 MFGEFRTGKTQICHTLAVT   47 (243)
T ss_dssp             EECCTTSSHHHHHHHHHHH
T ss_pred             EECCCCCcHHHHHHHHHHH
Confidence            4799999999999988765

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2

Probab=85.12  E-value=0.37  Score=30.15  Aligned_cols=20  Identities=15%  Similarity=0.132  Sum_probs=16.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-..+++...|
T Consensus         9 l~G~~GsGKSTl~~~La~~l   28 (173)
T 1kag_A            9 LVGPMGAGKSTIGRQLAQQL   28 (173)
T ss_dssp             EECCTTSCHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            35999999999999887654

>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11

Probab=85.08  E-value=0.42  Score=31.38  Aligned_cols=20  Identities=20%  Similarity=0.185  Sum_probs=17.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|++|+|||-..+.+...+
T Consensus         5 l~G~nGsGKTTLl~~l~g~l   24 (178)
T 1ye8_A            5 ITGEPGVGKTTLVKKIVERL   24 (178)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            35999999999999998876

>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A

Probab=85.07  E-value=0.42  Score=31.61  Aligned_cols=23  Identities=17%  Similarity=0.082  Sum_probs=19.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      ++|.+|+|||-..+.++..|...
T Consensus        11 i~G~sGsGKTTl~~~l~~~l~~~   33 (174)
T 1np6_A           11 FAAWSGTGKTTLLKKLIPALCAR   33 (174)
T ss_dssp             EECCTTSCHHHHHHHHHHHHHHT
T ss_pred             EEeCCCCCHHHHHHHHHHhcccc
Confidence            47999999999999988877543

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}

Probab=85.04  E-value=0.33  Score=30.32  Aligned_cols=19  Identities=5%  Similarity=-0.059  Sum_probs=15.9

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +-||+|.|||.+++.+-.+
T Consensus        29 l~G~~GtGKt~lA~~i~~~   47 (145)
T 3n70_A           29 LYGAPGTGRMTGARYLHQF   47 (145)
T ss_dssp             EESSTTSSHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHHh
Confidence            3599999999999988554

>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A*

Probab=84.94  E-value=0.4  Score=37.23  Aligned_cols=22  Identities=23%  Similarity=0.191  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |||.||+|||++-+.++..|+.
T Consensus       172 IaG~TGSGKSt~L~~li~sLl~  193 (512)
T 2ius_A          172 VAGTTGSGASVGVNAMILSMLY  193 (512)
T ss_dssp             EECCTTSSHHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHHHH
Confidence            5899999999999988876653

>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A*

Probab=84.65  E-value=0.37  Score=34.07  Aligned_cols=21  Identities=29%  Similarity=0.275  Sum_probs=17.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|.+|||||-+.+++...+-
T Consensus        85 I~G~~GsGKSTl~~~L~~~l~  105 (308)
T 1sq5_A           85 IAGSVAVGKSTTARVLQALLS  105 (308)
T ss_dssp             EEECTTSSHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHHh
Confidence            479999999999998877653

>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A*

Probab=84.63  E-value=0.42  Score=35.89  Aligned_cols=21  Identities=24%  Similarity=0.112  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.|+||||||-+-+.++.++-
T Consensus       172 I~GpnGSGKTTlL~allg~l~  192 (418)
T 1p9r_A          172 VTGPTGSGKSTTLYAGLQELN  192 (418)
T ss_dssp             EECSTTSCHHHHHHHHHHHHC
T ss_pred             EECCCCCCHHHHHHHHHhhcC
Confidence            469999999999999998774

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*

Probab=84.56  E-value=0.38  Score=32.93  Aligned_cols=22  Identities=23%  Similarity=0.221  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|.|||.+++.+.+.+..
T Consensus        72 l~G~~GtGKT~la~~la~~l~~   93 (309)
T 3syl_A           72 FTGNPGTGKTTVALKMAGLLHR   93 (309)
T ss_dssp             EEECTTSSHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHHh
Confidence            3599999999999998887744

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*

Probab=84.52  E-value=0.48  Score=30.01  Aligned_cols=21  Identities=19%  Similarity=0.124  Sum_probs=17.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.|++|.|||.+.+.+.+.+.
T Consensus        50 l~G~~G~GKT~l~~~~~~~~~   70 (250)
T 1njg_A           50 FSGTRGVGKTSIARLLAKGLN   70 (250)
T ss_dssp             EECSTTSCHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHhc
Confidence            359999999999999887764

>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis}

Probab=84.48  E-value=0.2  Score=36.45  Aligned_cols=20  Identities=25%  Similarity=0.301  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||||||-+.+.++.++
T Consensus       180 ivG~sGsGKSTll~~l~~~~  199 (361)
T 2gza_A          180 VAGETGSGKTTLMKALMQEI  199 (361)
T ss_dssp             EEESSSSCHHHHHHHHHTTS
T ss_pred             EECCCCCCHHHHHHHHHhcC
Confidence            46999999999999998865

>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23

Probab=84.40  E-value=0.56  Score=32.08  Aligned_cols=22  Identities=9%  Similarity=0.090  Sum_probs=17.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++++||+|||.+...++..+..
T Consensus       133 l~~~tGsGKT~~~~~~~~~~~~  154 (282)
T 1rif_A          133 LNLPTSAGRSLIQALLARYYLE  154 (282)
T ss_dssp             ECCCTTSCHHHHHHHHHHHHHH
T ss_pred             EEcCCCCCcHHHHHHHHHHHHH
Confidence            3689999999999877776554

>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus}

Probab=84.37  E-value=0.41  Score=30.32  Aligned_cols=20  Identities=20%  Similarity=0.240  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-..+.+...|
T Consensus        10 l~G~~GsGKST~~~~L~~~l   29 (193)
T 2rhm_A           10 VTGHPATGKTTLSQALATGL   29 (193)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            46899999999999887765

>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus}

Probab=84.34  E-value=0.5  Score=29.39  Aligned_cols=20  Identities=15%  Similarity=0.139  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|||||...+.+...|
T Consensus         5 l~G~~GsGKsT~a~~L~~~l   24 (168)
T 2pt5_A            5 LIGFMCSGKSTVGSLLSRSL   24 (168)
T ss_dssp             EESCTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999999887754

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*

Probab=84.22  E-value=0.41  Score=32.99  Aligned_cols=23  Identities=13%  Similarity=0.005  Sum_probs=19.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      ++|++|+|||-..+.+...+...
T Consensus        40 i~G~~G~GKTTl~~~ia~~~~~~   62 (296)
T 1cr0_A           40 VTSGSGMGKSTFVRQQALQWGTA   62 (296)
T ss_dssp             EEESTTSSHHHHHHHHHHHHHHT
T ss_pred             EEeCCCCCHHHHHHHHHHHHHHH
Confidence            47999999999999988776543

>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A*

Probab=84.21  E-value=0.38  Score=32.73  Aligned_cols=20  Identities=10%  Similarity=0.114  Sum_probs=16.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||||||-..+.++..+
T Consensus        21 l~GpsGsGKSTLlk~L~g~~   40 (219)
T 1s96_A           21 VSAPSGAGKSSLIQALLKTQ   40 (219)
T ss_dssp             EECCTTSCHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHhccC
Confidence            35999999999999887654

>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii}

Probab=84.10  E-value=0.46  Score=34.57  Aligned_cols=21  Identities=29%  Similarity=0.275  Sum_probs=17.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.+|||||-+.+.+...+-
T Consensus        97 I~GpsGSGKSTl~~~L~~ll~  117 (321)
T 3tqc_A           97 IAGSVAVGKSTTSRVLKALLS  117 (321)
T ss_dssp             EECCTTSSHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHhc
Confidence            579999999999998877653

>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25

Probab=84.09  E-value=0.44  Score=30.49  Aligned_cols=18  Identities=11%  Similarity=0.010  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|.+|||||-+.+.+..
T Consensus         7 l~G~~GaGKSTl~~~L~~   24 (189)
T 2bdt_A            7 ITGPAGVGKSTTCKRLAA   24 (189)
T ss_dssp             EECSTTSSHHHHHHHHHH
T ss_pred             EECCCCCcHHHHHHHHhc
Confidence            369999999999999876

>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii}

Probab=83.84  E-value=0.38  Score=33.11  Aligned_cols=18  Identities=17%  Similarity=0.316  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|+||+|||+++.-.++
T Consensus        21 i~G~SGaGKStlal~L~~   38 (181)
T 3tqf_A           21 ITGEANIGKSELSLALID   38 (181)
T ss_dssp             EEESSSSSHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHH
Confidence            469999999999987765

>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A*

Probab=83.84  E-value=0.22  Score=32.49  Aligned_cols=20  Identities=25%  Similarity=0.212  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-..+++...+
T Consensus        26 i~G~~GsGKSTl~~~L~~~~   45 (207)
T 2qt1_A           26 ISGVTNSGKTTLAKNLQKHL   45 (207)
T ss_dssp             EEESTTSSHHHHHHHHHTTS
T ss_pred             EECCCCCCHHHHHHHHHHhc
Confidence            46999999999999987754

>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228}

Probab=83.65  E-value=0.43  Score=35.24  Aligned_cols=20  Identities=25%  Similarity=0.333  Sum_probs=17.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.||+|||..++.+...|
T Consensus        12 I~GptgSGKTtla~~La~~l   31 (340)
T 3d3q_A           12 IVGPTASGKTELSIEVAKKF   31 (340)
T ss_dssp             EECSTTSSHHHHHHHHHHHT
T ss_pred             EECCCcCcHHHHHHHHHHHc
Confidence            58999999999999888765

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20

Probab=83.58  E-value=0.7  Score=31.01  Aligned_cols=19  Identities=16%  Similarity=0.020  Sum_probs=16.6

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|++|+|||-+.+.+...+
T Consensus        51 ~G~~GtGKT~la~~la~~~   69 (257)
T 1lv7_A           51 VGPPGTGKTLLAKAIAGEA   69 (257)
T ss_dssp             ECCTTSCHHHHHHHHHHHH
T ss_pred             ECcCCCCHHHHHHHHHHHc
Confidence            5999999999999887764

>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii}

Probab=83.53  E-value=0.59  Score=30.56  Aligned_cols=20  Identities=25%  Similarity=0.265  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++|++|+|||..+..++...
T Consensus        35 i~G~pG~GKT~l~l~~~~~~   54 (251)
T 2zts_A           35 LTGGTGTGKTTFAAQFIYKG   54 (251)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHHHH
Confidence            58999999999887665543

>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A

Probab=83.52  E-value=0.53  Score=31.63  Aligned_cols=20  Identities=10%  Similarity=0.016  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|.+|||||-..+.+.+.+
T Consensus        32 l~G~~GsGKSTl~k~La~~l   51 (246)
T 2bbw_A           32 ILGPPGSGKGTVCQRIAQNF   51 (246)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            35999999999999998665

>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*

Probab=83.52  E-value=0.55  Score=29.82  Aligned_cols=20  Identities=15%  Similarity=0.140  Sum_probs=17.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-..+.+.++|
T Consensus         5 i~G~~GsGKsT~~~~L~~~l   24 (205)
T 2jaq_A            5 IFGTVGAGKSTISAEISKKL   24 (205)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             EECCCccCHHHHHHHHHHhc
Confidence            46999999999999998876

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*

Probab=83.21  E-value=0.36  Score=32.64  Aligned_cols=20  Identities=10%  Similarity=0.029  Sum_probs=16.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|++|.|||.+++.+...+
T Consensus        34 l~G~~GtGKt~la~~i~~~~   53 (265)
T 2bjv_A           34 IIGERGTGKELIASRLHYLS   53 (265)
T ss_dssp             EECCTTSCHHHHHHHHHHTS
T ss_pred             EECCCCCcHHHHHHHHHHhc
Confidence            35999999999999886654

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A*

Probab=83.18  E-value=0.59  Score=29.28  Aligned_cols=20  Identities=20%  Similarity=0.174  Sum_probs=16.9

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|..|||||...+++...|
T Consensus        12 l~G~~GsGKSTva~~La~~l   31 (168)
T 1zuh_A           12 LIGFMGSGKSSLAQELGLAL   31 (168)
T ss_dssp             EESCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            35899999999999987764

>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B*

Probab=83.10  E-value=0.45  Score=33.48  Aligned_cols=20  Identities=15%  Similarity=0.243  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|||||-+.+.+...+
T Consensus        38 l~G~sGsGKSTla~~L~~~~   57 (287)
T 1gvn_B           38 LGGQPGSGKTSLRSAIFEET   57 (287)
T ss_dssp             EECCTTSCTHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            47999999999999887654

>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A*

Probab=83.06  E-value=0.54  Score=34.22  Aligned_cols=20  Identities=20%  Similarity=0.114  Sum_probs=16.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++++||+|||++.-.++..+
T Consensus       113 l~~~TGsGKT~~~l~~i~~~  132 (472)
T 2fwr_A          113 IVLPTGSGKTHVAMAAINEL  132 (472)
T ss_dssp             EECCTTSCHHHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHHHc
Confidence            46899999999987776654

>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1

Probab=83.05  E-value=0.5  Score=29.69  Aligned_cols=21  Identities=19%  Similarity=0.053  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.|.+|+|||-..+.+.+.|-
T Consensus         6 i~G~~GsGKsT~~~~L~~~l~   26 (194)
T 1nks_A            6 VTGIPGVGKSTVLAKVKEILD   26 (194)
T ss_dssp             EEECTTSCHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            368999999999999988764

>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A*

Probab=82.90  E-value=0.54  Score=37.17  Aligned_cols=22  Identities=32%  Similarity=0.295  Sum_probs=19.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |||-||+|||++-..++..|+.
T Consensus       219 IaG~TGSGKS~~L~tlI~sLl~  240 (574)
T 2iut_A          219 VAGTTGSGKSVGVNAMLLSILF  240 (574)
T ss_dssp             EECCTTSSHHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHHHH
Confidence            5899999999999998887764

>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A

Probab=82.82  E-value=0.49  Score=33.68  Aligned_cols=19  Identities=26%  Similarity=0.204  Sum_probs=16.8

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      .|++|.|||.+++.+-..+
T Consensus        57 ~GppGtGKT~la~~ia~~~   75 (363)
T 3hws_A           57 IGPTGSGKTLLAETLARLL   75 (363)
T ss_dssp             ECCTTSSHHHHHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHHHHHc
Confidence            5999999999999997754

>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4}

Probab=82.81  E-value=0.58  Score=34.43  Aligned_cols=22  Identities=9%  Similarity=0.090  Sum_probs=17.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++++||+|||++.-+++..++.
T Consensus       133 l~~~tGsGKT~~~~~~~~~~~~  154 (510)
T 2oca_A          133 LNLPTSAGRSLIQALLARYYLE  154 (510)
T ss_dssp             EECCSTTTHHHHHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHHHHHh
Confidence            3689999999999877776554

>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1

Probab=82.77  E-value=0.62  Score=29.29  Aligned_cols=20  Identities=10%  Similarity=-0.039  Sum_probs=16.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|||||-.++.+...+
T Consensus         8 l~G~~GsGKsT~a~~L~~~~   27 (196)
T 1tev_A            8 VLGGPGAGKGTQCARIVEKY   27 (196)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999999887654

>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A

Probab=82.73  E-value=0.71  Score=29.92  Aligned_cols=19  Identities=21%  Similarity=0.132  Sum_probs=17.3

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|++|||||-..+.+...+
T Consensus        39 ~G~nGaGKTTLlr~l~g~l   57 (158)
T 1htw_A           39 NGDLGAGKTTLTRGMLQGI   57 (158)
T ss_dssp             ECSTTSSHHHHHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHHHHhC
Confidence            4999999999999998876

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}

Probab=82.67  E-value=0.82  Score=30.31  Aligned_cols=19  Identities=21%  Similarity=0.022  Sum_probs=16.6

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|++|.|||-+++.+...+
T Consensus        45 ~G~~GtGKT~la~~la~~~   63 (262)
T 2qz4_A           45 LGPPGCGKTLLAKAVATEA   63 (262)
T ss_dssp             ESCTTSSHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHh
Confidence            5999999999999887754

>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A*

Probab=82.64  E-value=0.53  Score=29.55  Aligned_cols=20  Identities=10%  Similarity=-0.012  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-..+.+...|
T Consensus        11 l~G~~GsGKsT~~~~L~~~l   30 (194)
T 1qf9_A           11 VLGGPGSGKGTQCANIVRDF   30 (194)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            36899999999999887754

>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A*

Probab=82.58  E-value=0.31  Score=31.48  Aligned_cols=21  Identities=10%  Similarity=-0.026  Sum_probs=18.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|.+|||||-..+.+..+|-
T Consensus         5 i~G~~GsGKsTl~~~L~~~l~   25 (214)
T 1gtv_A            5 IEGVDGAGKRTLVEKLSGAFR   25 (214)
T ss_dssp             EEEEEEEEHHHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHHHH
Confidence            358999999999999998874

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}

Probab=82.32  E-value=0.65  Score=29.52  Aligned_cols=21  Identities=14%  Similarity=0.015  Sum_probs=18.3

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      -|++|+|||-..+.+...+..
T Consensus        42 ~G~~G~GKTtL~~~i~~~~~~   62 (149)
T 2kjq_A           42 WGEEGAGKSHLLQAWVAQALE   62 (149)
T ss_dssp             ESSSTTTTCHHHHHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHHHHHHHh
Confidence            599999999999999887743

>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens}

Probab=82.28  E-value=0.51  Score=31.59  Aligned_cols=17  Identities=24%  Similarity=0.141  Sum_probs=12.5

Q ss_pred             CCCCcCCchHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVL   17 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l   17 (80)
                      +.|+||+|||....+++
T Consensus        81 i~g~TGsGKTt~~~~~~   97 (235)
T 3llm_A           81 IRGATGCGKTTQVPQFI   97 (235)
T ss_dssp             EECCTTSSHHHHHHHHH
T ss_pred             EEeCCCCCcHHhHHHHH
Confidence            35899999996555444

>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens}

Probab=82.18  E-value=0.56  Score=29.82  Aligned_cols=20  Identities=10%  Similarity=-0.054  Sum_probs=17.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-.++.+.++|
T Consensus        17 l~G~~GsGKsT~a~~L~~~l   36 (199)
T 2bwj_A           17 IIGGPGSGKGTQCEKLVEKY   36 (199)
T ss_dssp             EEECTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            35899999999999988765

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*

Probab=82.07  E-value=0.65  Score=31.49  Aligned_cols=19  Identities=16%  Similarity=0.099  Sum_probs=16.6

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      .|++|.|||.+++.+.+.+
T Consensus        70 ~G~~GtGKT~la~~ia~~~   88 (272)
T 1d2n_A           70 EGPPHSGKTALAAKIAEES   88 (272)
T ss_dssp             ECSTTSSHHHHHHHHHHHH
T ss_pred             ECCCCCcHHHHHHHHHHHh
Confidence            5999999999999887764

>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A*

Probab=82.04  E-value=0.64  Score=32.34  Aligned_cols=20  Identities=15%  Similarity=0.129  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-+.+.+...|
T Consensus        14 i~G~~GsGKsTla~~la~~l   33 (233)
T 3r20_A           14 VDGPAGTGKSSVSRGLARAL   33 (233)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            35999999999999987765

>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens}

Probab=81.63  E-value=0.84  Score=34.84  Aligned_cols=23  Identities=17%  Similarity=0.027  Sum_probs=18.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      ++++||+|||.+.-+++..++..
T Consensus        27 l~~~TGsGKTl~~~~~i~~~l~~   49 (699)
T 4gl2_A           27 ICLPTGCGKTRVAVYIAKDHLDK   49 (699)
T ss_dssp             ECCCTTSCHHHHHHHHHHHHHHH
T ss_pred             EEcCCCCcHHHHHHHHHHHHHHh
Confidence            47899999999988887765543

>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6

Probab=81.53  E-value=0.34  Score=34.27  Aligned_cols=20  Identities=15%  Similarity=0.189  Sum_probs=14.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |+|.+|||||-.++.+...|
T Consensus        10 ItG~sGSGKSTva~~L~~~l   29 (290)
T 1a7j_A           10 VTGSSGAGTSTVKHTFDQIF   29 (290)
T ss_dssp             EESCC---CCTHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            57999999999999887755

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*

Probab=81.53  E-value=0.81  Score=30.65  Aligned_cols=19  Identities=21%  Similarity=0.013  Sum_probs=16.2

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|++|+|||-+.+.+...+
T Consensus        55 ~G~~G~GKTtl~~~i~~~~   73 (254)
T 1ixz_A           55 VGPPGVGKTHLARAVAGEA   73 (254)
T ss_dssp             ECCTTSSHHHHHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHHHHHh
Confidence            5999999999999887654

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25

Probab=81.38  E-value=0.49  Score=30.05  Aligned_cols=18  Identities=11%  Similarity=0.115  Sum_probs=15.5

Q ss_pred             CCCcCCchHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~   19 (80)
                      -|.+|||||-+.+.+...
T Consensus        15 ~G~~GsGKSTl~~~La~~   32 (191)
T 1zp6_A           15 SGHPGSGKSTIAEALANL   32 (191)
T ss_dssp             EECTTSCHHHHHHHHHTC
T ss_pred             ECCCCCCHHHHHHHHHhc
Confidence            589999999999988653

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A*

Probab=81.31  E-value=0.63  Score=31.52  Aligned_cols=20  Identities=20%  Similarity=0.335  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|||||-.++.+...|
T Consensus        27 I~G~~GSGKST~a~~L~~~l   46 (252)
T 1uj2_A           27 VSGGTASGKSSVCAKIVQLL   46 (252)
T ss_dssp             EECSTTSSHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            47999999999999887754

>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1

Probab=81.26  E-value=0.65  Score=28.88  Aligned_cols=18  Identities=11%  Similarity=0.139  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|.+|+|||-..+.+..
T Consensus         7 i~G~~GsGKST~a~~L~~   24 (181)
T 1ly1_A            7 TIGCPGSGKSTWAREFIA   24 (181)
T ss_dssp             EECCTTSSHHHHHHHHHH
T ss_pred             EecCCCCCHHHHHHHHHh
Confidence            469999999999998876

>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum}

Probab=81.18  E-value=0.35  Score=32.19  Aligned_cols=20  Identities=15%  Similarity=0.027  Sum_probs=11.2

Q ss_pred             CCCCcCCchHHHHHHHH-HHH
Q psy17057          1 MAGSTMRDKTPFKLVVL-LVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l-~~l   20 (80)
                      +.|++|||||-+.+++. ..+
T Consensus        32 l~Gp~GsGKSTl~~~L~~~~~   52 (231)
T 3lnc_A           32 LSSPSGCGKTTVANKLLEKQK   52 (231)
T ss_dssp             EECSCC----CHHHHHHC---
T ss_pred             EECCCCCCHHHHHHHHHhcCC
Confidence            35999999999999887 543

>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix}

Probab=81.13  E-value=0.77  Score=29.30  Aligned_cols=21  Identities=19%  Similarity=0.134  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.|.+|+|||-..+.+..+|-
T Consensus        18 l~G~~GsGKsT~~~~L~~~l~   38 (186)
T 2yvu_A           18 LTGLPGSGKTTIATRLADLLQ   38 (186)
T ss_dssp             EECCTTSSHHHHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHHHHH
Confidence            358999999999999988764

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}

Probab=80.53  E-value=0.72  Score=31.48  Aligned_cols=19  Identities=21%  Similarity=0.039  Sum_probs=16.7

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      .|++|.|||-+++.+...+
T Consensus        60 ~Gp~GtGKT~la~~la~~~   78 (297)
T 3b9p_A           60 FGPPGNGKTLLARAVATEC   78 (297)
T ss_dssp             ESSSSSCHHHHHHHHHHHT
T ss_pred             ECcCCCCHHHHHHHHHHHh
Confidence            5999999999999887765

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*

Probab=80.44  E-value=0.67  Score=32.45  Aligned_cols=21  Identities=24%  Similarity=0.205  Sum_probs=18.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.|++|.|||.+++.+.+.+.
T Consensus        75 l~GppGtGKT~la~~la~~l~   95 (368)
T 3uk6_A           75 IAGQPGTGKTAIAMGMAQALG   95 (368)
T ss_dssp             EEESTTSSHHHHHHHHHHHHC
T ss_pred             EECCCCCCHHHHHHHHHHHhc
Confidence            369999999999999988774

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A

Probab=80.37  E-value=0.89  Score=31.77  Aligned_cols=19  Identities=16%  Similarity=0.010  Sum_probs=16.9

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|++|.|||.+++.+...+
T Consensus        42 ~GppGtGKT~la~aiA~~l   60 (293)
T 3t15_A           42 WGGKGQGKSFQCELVFRKM   60 (293)
T ss_dssp             EECTTSCHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHh
Confidence            4999999999999988765

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=80.35  E-value=0.64  Score=32.40  Aligned_cols=22  Identities=14%  Similarity=0.157  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|+|||-+.+.+...+..
T Consensus        41 l~Gp~G~GKTtl~~~la~~l~~   62 (354)
T 1sxj_E           41 LYGPNGTGKKTRCMALLESIFG   62 (354)
T ss_dssp             EECSTTSSHHHHHHTHHHHHSC
T ss_pred             EECCCCCCHHHHHHHHHHHHcC
Confidence            3599999999999999887644

>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1

Probab=80.32  E-value=0.62  Score=30.16  Aligned_cols=18  Identities=17%  Similarity=0.117  Sum_probs=15.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|.+|||||-..+++..
T Consensus         7 l~G~~GsGKST~~~~La~   24 (206)
T 1jjv_A            7 LTGGIGSGKTTIANLFTD   24 (206)
T ss_dssp             EECSTTSCHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            469999999999998855

>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus}

Probab=80.21  E-value=0.86  Score=29.62  Aligned_cols=20  Identities=10%  Similarity=-0.014  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|||||-.++.+...+
T Consensus         5 l~G~~GsGKsT~a~~L~~~~   24 (216)
T 3fb4_A            5 LMGLPGAGKGTQAEQIIEKY   24 (216)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999999886654

>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2

Probab=80.12  E-value=0.49  Score=34.66  Aligned_cols=18  Identities=17%  Similarity=0.209  Sum_probs=14.8

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|+||+|||+++...++
T Consensus       152 i~G~sG~GKStlal~l~~  169 (312)
T 1knx_A          152 LTGRSGIGKSECALDLIN  169 (312)
T ss_dssp             EEESSSSSHHHHHHHHHT
T ss_pred             EEcCCCCCHHHHHHHHHH
Confidence            479999999999976544

>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus}

Probab=80.06  E-value=0.89  Score=28.58  Aligned_cols=20  Identities=20%  Similarity=0.064  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|-+|||||-..+.+..+|
T Consensus         5 l~G~~GsGKsT~~~~L~~~l   24 (195)
T 2pbr_A            5 FEGIDGSGKTTQAKKLYEYL   24 (195)
T ss_dssp             EECSTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            36999999999999998876

---

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Length	Definition	E-value
Query	80
d1br2a2	710	c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick	4e-09
d1kk8a2	789	c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain	8e-09
d2mysa2	794	c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain	1e-08
d1d0xa2	712	c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain	6e-08
d1w7ja2	730	c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick	8e-08
d1lkxa_	684	c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli	3e-07

>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]

 Score = 49.0 bits (116), Expect = 4e-09
 Identities = 20/34 (58%), Positives = 26/34 (76%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  N+NSSRFGKFI++N+   G + G
Sbjct: 152 LEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVG 185

>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Bay scallop (Aequipecten irradians) [TaxId: 31199]

 Score = 48.2 bits (114), Expect = 8e-09
 Identities = 19/34 (55%), Positives = 26/34 (76%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +A+GNAKT  NNNSSRFGKFI++++   G + G
Sbjct: 178 LEAYGNAKTTRNNNSSRFGKFIRIHFGPTGKIAG 211

>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]

 Score = 47.4 bits (112), Expect = 1e-08
 Identities = 18/35 (51%), Positives = 25/35 (71%)

Query: 46  WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
             +AFGNAKT  N+NSSRFGKFI++++   G +  
Sbjct: 179 LLEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLAS 213

>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum [TaxId: 44689]

 Score = 45.5 bits (107), Expect = 6e-08
 Identities = 20/34 (58%), Positives = 25/34 (73%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  NNNSSRFGKFI++ +   G + G
Sbjct: 175 LEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISG 208

>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Chicken (Gallus gallus), Va isoform [TaxId: 9031]

 Score = 45.1 bits (106), Expect = 8e-08
 Identities = 14/32 (43%), Positives = 23/32 (71%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV 78
            ++ GNAKT  N+NSSRFGK+I++ + +   +
Sbjct: 141 MESIGNAKTTRNDNSSRFGKYIEIGFDKRYRI 172

>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]

 Score = 43.5 bits (102), Expect = 3e-07
 Identities = 17/34 (50%), Positives = 24/34 (70%)

Query: 47  FQAFGNAKTAHNNNSSRFGKFIQVNYKENGMVHG 80
            +AFGNAKT  N+NSSRFGK++++ +   G   G
Sbjct: 135 LEAFGNAKTLRNDNSSRFGKYMEMQFNAVGSPIG 168

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Length	Definition	Probability
Query	80
d1kk8a2	789	Myosin S1, motor domain {Bay scallop (Aequipecten	99.92
d1d0xa2	712	Myosin S1, motor domain {Dictyostelium discoideum	99.91
d2mysa2	794	Myosin S1, motor domain {Chicken (Gallus gallus),	99.91
d1lkxa_	684	Myosin S1, motor domain {Dictyostelium discoideum,	99.91
d1br2a2	710	Myosin S1, motor domain {Chicken (Gallus gallus),	99.9
d1w7ja2	730	Myosin S1, motor domain {Chicken (Gallus gallus),	99.9
d1rz3a_	198	Hypothetical protein rbstp0775 {Bacillus stearothe	93.59
d1um8a_	364	ClpX {Helicobacter pylori [TaxId: 210]}	93.53
d1uj2a_	213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	93.08
d2i3ba1	189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	93.07
d2bdta1	176	Hypothetical protein BH3686 {Bacillus halodurans [	92.64
d1np6a_	170	Molybdopterin-guanine dinucleotide biosynthesis pr	92.32
d1m8pa3	183	ATP sulfurylase C-terminal domain {Fungus (Penicil	92.19
d1ye8a1	178	Hypothetical kinase-like protein Aq_1292 {Aquifex	92.09
d1ly1a_	152	Polynucleotide kinase, kinase domain {Bacteriophag	92.07
d1kaga_	169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	92.02
d1qhxa_	178	Chloramphenicol phosphotransferase {Streptomyces v	92.0
d1n0wa_	242	DNA repair protein Rad51, catalytic domain {Human	91.48
d1rkba_	173	Adenylate kinase {Human (Homo sapiens), isoenzyme	91.27
d1khta_	190	Adenylate kinase {Archaeon Methanococcus voltae [T	91.25
d1ofha_	309	HslU {Haemophilus influenzae [TaxId: 727]}	91.1
d1iqpa2	231	Replication factor C {Archaeon Pyrococcus furiosus	90.7
d1knqa_	171	Gluconate kinase {Escherichia coli [TaxId: 562]}	90.68
d1lvga_	190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	90.55
d1qvra3	315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	90.39
d1wp9a1	200	putative ATP-dependent RNA helicase PF2015 {Pyroco	90.33
d1gvnb_	273	Plasmid maintenance system epsilon/zeta, toxin zet	90.32
d1r6bx3	315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	90.11
d1zaka1	189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	90.07
d1g41a_	443	HslU {Haemophilus influenzae [TaxId: 727]}	89.97
d1y63a_	174	Probable kinase LmjF30.1890 {Leishmania major [Tax	89.88
d1fnna2	276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	89.75
d1m7ga_	208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	89.68
d1w5sa2	287	CDC6-like protein APE0152, N-terminal domain {Aero	89.64
d1znwa1	182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	89.55
d1xjca_	165	Molybdopterin-guanine dinucleotide biosynthesis pr	89.29
d1x6va3	195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	89.19
d1sxjd2	237	Replication factor C2 {Baker's yeast (Saccharomyce	89.17
d1in4a2	238	Holliday junction helicase RuvB {Thermotoga mariti	88.95
d1v5wa_	258	Meiotic recombination protein DMC1/LIM15 homolog {	88.68
d2i1qa2	258	DNA repair protein Rad51, catalytic domain {Archae	88.64
d1gkya_	186	Guanylate kinase {Baker's yeast (Saccharomyces cer	88.44
d1pzna2	254	DNA repair protein Rad51, catalytic domain {Archae	88.37
d1q3ta_	223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	88.14
d1lw7a2	192	Transcriptional regulator NadR, ribosylnicotinamid	88.12
d1ukza_	196	Uridylate kinase {Baker's yeast (Saccharomyces cer	88.01
d1teva_	194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	87.95
d1s96a_	205	Guanylate kinase {Escherichia coli [TaxId: 562]}	87.57
d1zp6a1	176	Hypothetical protein Atu3015 {Agrobacterium tumefa	87.56
d1uf9a_	191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	87.38
d1p9ra_	401	Extracellular secretion NTPase EpsE {Vibrio choler	87.35
d1viaa_	161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	87.32
d1g2912	240	Maltose transport protein MalK, N-terminal domain	87.28
d1tf7a1	242	Circadian clock protein KaiC {Synechococcus sp. st	87.19
d1yksa1	140	YFV helicase domain {Yellow fever virus [TaxId: 11	86.95
d1sxjc2	227	Replication factor C3 {Baker's yeast (Saccharomyce	86.92
d2cdna1	181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	86.86
d1sq5a_	308	Pantothenate kinase PanK {Escherichia coli [TaxId:	86.67
d1qf9a_	194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	86.65
d1odfa_	286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	86.63
d1sxja2	253	Replication factor C1 {Baker's yeast (Saccharomyce	86.61
d1tf7a2	242	Circadian clock protein KaiC {Synechococcus sp. st	86.57
d1zina1	182	Adenylate kinase {Bacillus stearothermophilus [Tax	86.4
d1b0ua_	258	ATP-binding subunit of the histidine permease {Sal	86.24
d1gkub1	237	Helicase-like "domain" of reverse gyrase {Archaeon	86.1
d2pmka1	241	Haemolysin B ATP-binding protein {Escherichia coli	85.94
d1g6oa_	323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	85.78
d2p6ra3	202	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	85.72
d1gm5a3	264	RecG helicase domain {Thermotoga maritima [TaxId:	85.51
d1e9ra_	433	Bacterial conjugative coupling protein TrwB {Esche	85.48
d3dhwc1	240	Methionine import ATP-binding protein MetN {Escher	85.35
d1bifa1	213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	85.27
d1s3ga1	182	Adenylate kinase {Bacillus globisporus [TaxId: 145	85.19
d1rifa_	282	DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]	84.91
d1e4va1	179	Adenylate kinase {Escherichia coli [TaxId: 562]}	84.78
d1kkma_	176	HPr kinase HprK C-terminal domain {Lactobacillus c	84.43
d1nksa_	194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	84.35
d1ckea_	225	CMP kinase {Escherichia coli [TaxId: 562]}	84.19
d1a5ta2	207	delta prime subunit of DNA polymerase III, N-domai	83.87
d3d31a2	229	Sulfate/molybdate ABC transporter, ATP-binding pro	83.75
d1knxa2	177	HPr kinase HprK C-terminal domain {Mycoplasma pneu	83.45
d1cr2a_	277	Gene 4 protein (g4p, DNA primase), helicase domain	83.28
d1ixsb2	239	Holliday junction helicase RuvB {Thermus thermophi	83.25
d1ko7a2	169	HPr kinase HprK C-terminal domain {Staphylococcus	82.94
d1sxjb2	224	Replication factor C4 {Baker's yeast (Saccharomyce	82.94
d1szpa2	251	DNA repair protein Rad51, catalytic domain {Baker'	82.77
d1mv5a_	242	Multidrug resistance ABC transporter LmrA, C-termi	82.45
d1kgda_	178	Guanylate kinase-like domain of Cask {Human (Homo	82.38
d1e6ca_	170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	82.24
d1l7vc_	231	ABC transporter involved in vitamin B12 uptake, Bt	82.05
d1g6ha_	254	MJ1267 {Archaeon Methanococcus jannaschii [TaxId:	81.58
d1sxje2	252	Replication factor C5 {Baker's yeast (Saccharomyce	81.55
d2iyva1	165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	81.55
d1l2ta_	230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	81.2
d2fz4a1	206	DNA repair protein RAD25 {Archaeoglobus fulgidus [	80.84
d1r0wa_	281	Cystic fibrosis transmembrane conductance regulato	80.82
d1a7ja_	288	Phosphoribulokinase {Rhodobacter sphaeroides [TaxI	80.81
d1a1va1	136	HCV helicase domain {Human hepatitis C virus (HCV)	80.41
d2onka1	240	Molybdate/tungstate import ATP-binding protein Wtp	80.2

>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Bay scallop (Aequipecten irradians) [TaxId: 31199]

Probab=99.92  E-value=6.8e-26  Score=180.88  Aligned_cols=80  Identities=35%  Similarity=0.534  Sum_probs=68.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccC----ccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCC
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRD----TKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKE   74 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~----~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~   74 (80)
                      |.|||||||||++|++|+||+..+.+....+    .+....++++|+++  ||||||||+|.+|+||||||||++|+|++
T Consensus       126 isGESGaGKTe~~K~il~yL~~~~~~~~~~~~~~~~~~~~~i~~~il~~npiLEAFGNAkT~~N~NSSRFGk~~~l~f~~  205 (789)
T d1kk8a2         126 ITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGP  205 (789)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHHHSCCCCCC--------CCCHHHHHHHHHHHHHHHHEECCSSCTTEESSEEEEEEEECT
T ss_pred             EEeCCCCCHHHHHHHHHHHHHHHhcccccccccccccccccHHHHHHHHhHHHHhccccCCCCCCccCCcceeEEEEECC
Confidence            4799999999999999999998876533221    12235799999999  99999999999999999999999999999


Q ss_pred             CCeecC
Q psy17057         75 NGMVHG   80 (80)
Q Consensus        75 ~g~l~G   80 (80)
                      .|.|.|
T Consensus       206 ~g~i~g  211 (789)
T d1kk8a2         206 TGKIAG  211 (789)
T ss_dssp             TSSEEE
T ss_pred             CCCCcc
Confidence            999876

>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum [TaxId: 44689]

Probab=99.91  E-value=7.8e-26  Score=179.18  Aligned_cols=77  Identities=35%  Similarity=0.486  Sum_probs=67.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|+||+||+..+....   .+....++++|+++  ||||||||+|.+|+||||||||++|+|+..|+|
T Consensus       130 isGeSGaGKTe~~k~il~yL~~~s~~~~---~~~~~~i~~~i~~~n~iLEAFGNAkT~~N~NSSRFGk~~~l~f~~~g~i  206 (712)
T d1d0xa2         130 ITGESGAGKTENTKKVIQYLASVAGRNQ---ANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFI  206 (712)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHHHHSCC--------CHHHHHHHHHHHHHHHHHEECCSSCTTEESSEEEEEEEECTTSCE
T ss_pred             EeCCCCCCHHHHHHHHHHHHHHHhCCCc---ccccchHHHHHHhhhhHHHHhcCcCcCCCCCccceeEEEEEEEcCCCcc
Confidence            4799999999999999999998876421   22236799999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       207 ~g  208 (712)
T d1d0xa2         207 SG  208 (712)
T ss_dssp             EE
T ss_pred             cc
Confidence            76

>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]

Probab=99.91  E-value=1.5e-25  Score=178.95  Aligned_cols=80  Identities=33%  Similarity=0.452  Sum_probs=66.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCccc----CccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCC
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNR----DTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKE   74 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~----~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~   74 (80)
                      |.|||||||||++|+||+||+..+......    ..+....++++|+++  ||||||||+|.+|+||||||||++|+|+.
T Consensus       128 isGeSGaGKTe~~K~il~yL~~~~~~~~~~~~~~~~~~~~~i~~~i~~~npiLEAFGNAkT~~N~NSSRFgk~~~l~f~~  207 (794)
T d2mysa2         128 ITGESGAGKTVNTKRVIQYFATIAASGEKKKEEQSGKMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGA  207 (794)
T ss_dssp             EEECTTSCHHHHHHHHHHHHHHHTCCCC-----------CCHHHHHHHHHHHHHHHHEECCSSCSSEECSEEEEEEEECS
T ss_pred             EEcCCCCCHHHHHHHHHHHHHHHcCCCCCccccccccccCcHHHHHHHhhhHHHHhcCCcccccCChhhhheeeeeEECC
Confidence            469999999999999999999876532111    112246799999999  99999999999999999999999999999


Q ss_pred             CCeecC
Q psy17057         75 NGMVHG   80 (80)
Q Consensus        75 ~g~l~G   80 (80)
                      +|+|.|
T Consensus       208 ~g~i~g  213 (794)
T d2mysa2         208 TGKLAS  213 (794)
T ss_dssp             SSSEEE
T ss_pred             CCCEee
Confidence            999876

>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]

Probab=99.91  E-value=3.9e-25  Score=174.18  Aligned_cols=76  Identities=29%  Similarity=0.451  Sum_probs=67.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      +.|||||||||++|+||+||+..+...    ......++++|+++  ||||||||+|.+|+||||||||++|+|+.+|+|
T Consensus        91 isGeSGsGKTe~~k~il~yL~~~s~~~----~~~~~~i~~~i~~~n~iLeaFGNAkT~~N~NSSRfgk~~~l~f~~~g~i  166 (684)
T d1lkxa_          91 ISGESGAGKTEASKKIMQFLTFVSSNQ----SPNGERISKMLLDSNPLLEAFGNAKTLRNDNSSRFGKYMEMQFNAVGSP  166 (684)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHHHSCSS----CHHHHHHHHHHHHHHHHHHHHHBBCCSSCSSCBCSEEEEEEEECTTCCE
T ss_pred             EEcCCCCCHHHHHHHHHHHHHHHcCCC----CCccchHHHHHHhhhhhhhhcccccccCCCCcCceeeEEEEEecCCCcE
Confidence            469999999999999999999887542    12236799999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       167 ~g  168 (684)
T d1lkxa_         167 IG  168 (684)
T ss_dssp             EE
T ss_pred             ee
Confidence            76

>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]

Probab=99.90  E-value=2.5e-25  Score=175.75  Aligned_cols=80  Identities=33%  Similarity=0.468  Sum_probs=65.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccC--------ccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEE
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRD--------TKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQV   70 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~--------~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l   70 (80)
                      |.|||||||||++|+||+||+..+.......        ......++++|+++  ||||||||+|.+|+||||||||++|
T Consensus        96 isGeSGaGKTe~~k~il~yL~~~~~~~~~~~~~~~~~~~~~~~~~i~~~i~~~n~iLeaFGnakT~~N~NSSRfgk~~~l  175 (710)
T d1br2a2          96 CTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFSYGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRI  175 (710)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHHHHC------------------CHHHHHHTTHHHHHHHHHEECCSSCTTEESSEEEEEE
T ss_pred             EEeCCCCCHHHHHHHHHHHHHHHhccCCCccccccccccccccchHHHHHHHHHHHHHHhCCCccCCCCCCCCcceeeee
Confidence            4799999999999999999998765421111        11235799999999  9999999999999999999999999


Q ss_pred             EeCCCCeecC
Q psy17057         71 NYKENGMVHG   80 (80)
Q Consensus        71 ~f~~~g~l~G   80 (80)
                      +|+..|.|.|
T Consensus       176 ~f~~~g~i~g  185 (710)
T d1br2a2         176 NFDVTGYIVG  185 (710)
T ss_dssp             EECTTSCEEE
T ss_pred             EEcCCCcEEE
Confidence            9999999876

>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Chicken (Gallus gallus), Va isoform [TaxId: 9031]

Probab=99.90  E-value=7.7e-25  Score=173.03  Aligned_cols=74  Identities=24%  Similarity=0.346  Sum_probs=66.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhccCCcccCccchhhHHHHHHHH--HHHHhcCccccCCCCCCCccceEEEEeCCCCee
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHEDFGLLNRDTKFFDMFSTVIVSA--WFQAFGNAKTAHNNNSSRFGKFIQVNYKENGMV   78 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~~~~~~~~~~~~~~l~~~i~~s--ileafGnAkT~~n~nSSrfGk~~~l~f~~~g~l   78 (80)
                      |.|||||||||++|++|+||+..+....      ...++++|+++  ||||||||+|.+|+||||||||++|+|+.+|+|
T Consensus        99 isGeSGsGKTe~~k~il~~l~~~s~~~~------~~~~~~~i~~~n~ileaFGnAkT~~N~NSSRfgk~~~l~f~~~g~i  172 (730)
T d1w7ja2          99 VSGESGAGKTVSAKYAMRYFATVSGSAS------EANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRI  172 (730)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHHHTCCSS------SSCHHHHHHHHHHHHHHHHEECCSSCTTEECSEEEEEEEECTTSCE
T ss_pred             EEeCCCCCHHHHHHHHHHHHHHHcCCCc------cccHHHHHHHHHHHHHHhcccccCCCCCcccceeeeeeeecCCCCE
Confidence            4799999999999999999998865321      25699999999  999999999999999999999999999999998


Q ss_pred             cC
Q psy17057         79 HG   80 (80)
Q Consensus        79 ~G   80 (80)
                      .|
T Consensus       173 ~g  174 (730)
T d1w7ja2         173 IG  174 (730)
T ss_dssp             EE
T ss_pred             EE
Confidence            75

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Hypothetical protein rbstp0775
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=93.59  E-value=0.013  Score=35.81  Aligned_cols=22  Identities=18%  Similarity=0.147  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |+|.+|||||-.++.+...|-.
T Consensus        27 I~G~~GSGKSTla~~L~~~l~~   48 (198)
T d1rz3a_          27 IDGLSRSGKTTLANQLSQTLRE   48 (198)
T ss_dssp             EEECTTSSHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHhcc
Confidence            5799999999999999877654

>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpX
species: Helicobacter pylori [TaxId: 210]

Probab=93.53  E-value=0.012  Score=41.76  Aligned_cols=20  Identities=25%  Similarity=0.192  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||.||||++|-+.+++
T Consensus        73 fiGPTGvGKTElAk~LA~~~   92 (364)
T d1um8a_          73 LIGPTGSGKTLMAQTLAKHL   92 (364)
T ss_dssp             EECCTTSSHHHHHHHHHHHT
T ss_pred             eeCCCCccHHHHHHHHHhhc
Confidence            46999999999999887764

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Uridine-cytidine kinase 2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.08  E-value=0.017  Score=36.57  Aligned_cols=21  Identities=19%  Similarity=0.249  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|.+|||||-.++.+...|-
T Consensus         7 I~G~~gSGKSTla~~L~~~l~   27 (213)
T d1uj2a_           7 VSGGTASGKSSVCAKIVQLLG   27 (213)
T ss_dssp             EECSTTSSHHHHHHHHHHHTT
T ss_pred             EECCCCCCHHHHHHHHHHHhc
Confidence            589999999999998888764

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Cancer-related NTPase, C1orf57
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.07  E-value=0.024  Score=33.60  Aligned_cols=23  Identities=22%  Similarity=0.114  Sum_probs=20.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      |.|+.|+|||-+.+.++..|...
T Consensus         6 ItG~~GtGKTtl~~~i~~~l~~~   28 (189)
T d2i3ba1           6 LTGPPGVGKTTLIHKASEVLKSS   28 (189)
T ss_dssp             EESCCSSCHHHHHHHHHHHHHHT
T ss_pred             EECCCCCcHHHHHHHHHHHHHHC
Confidence            47999999999999999988554

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Atu3015-like
domain: Hypothetical protein BH3686
species: Bacillus halodurans [TaxId: 86665]

Probab=92.64  E-value=0.021  Score=33.72  Aligned_cols=20  Identities=15%  Similarity=0.051  Sum_probs=17.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-.++.+.+++
T Consensus         7 i~G~~GsGKTTva~~L~~~~   26 (176)
T d2bdta1           7 ITGPAGVGKSTTCKRLAAQL   26 (176)
T ss_dssp             EECSTTSSHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            47999999999999888865

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Molybdopterin-guanine dinucleotide biosynthesis protein MobB
species: Escherichia coli [TaxId: 562]

Probab=92.32  E-value=0.034  Score=33.02  Aligned_cols=23  Identities=17%  Similarity=0.082  Sum_probs=20.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|.+|||||-...-++++|...
T Consensus         7 itG~~GSGKTTL~~~L~~~l~~~   29 (170)
T d1np6a_           7 FAAWSGTGKTTLLKKLIPALCAR   29 (170)
T ss_dssp             EECCTTSCHHHHHHHHHHHHHHT
T ss_pred             EEcCCCCCHHHHHHHHHHHHHHC
Confidence            47999999999999999988654

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ATP sulfurylase C-terminal domain
domain: ATP sulfurylase C-terminal domain
species: Fungus (Penicillium chrysogenum) [TaxId: 5076]

Probab=92.19  E-value=0.032  Score=33.05  Aligned_cols=21  Identities=14%  Similarity=0.164  Sum_probs=18.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|-+|||||-+++.+.+.|-
T Consensus        11 l~G~~GsGKTTia~~La~~L~   31 (183)
T d1m8pa3          11 LTGYMNSGKDAIARALQVTLN   31 (183)
T ss_dssp             EECSTTSSHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHh
Confidence            359999999999999998873

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Hypothetical kinase-like protein Aq 1292
species: Aquifex aeolicus [TaxId: 63363]

Probab=92.09  E-value=0.033  Score=33.61  Aligned_cols=22  Identities=18%  Similarity=0.111  Sum_probs=18.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|++|+|||-..+.++..|-.
T Consensus         5 I~G~~G~GKSTLl~~i~~~l~~   26 (178)
T d1ye8a1           5 ITGEPGVGKTTLVKKIVERLGK   26 (178)
T ss_dssp             EECCTTSSHHHHHHHHHHHHGG
T ss_pred             EECCCCcHHHHHHHHHHhcCCC
Confidence            4699999999999999987643

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Polynucleotide kinase, kinase domain
species: Bacteriophage T4 [TaxId: 10665]

Probab=92.07  E-value=0.028  Score=33.13  Aligned_cols=18  Identities=11%  Similarity=0.139  Sum_probs=15.1

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|.+|||||-+++-++.
T Consensus         7 i~G~pGsGKTTla~~L~~   24 (152)
T d1ly1a_           7 TIGCPGSGKSTWAREFIA   24 (152)
T ss_dssp             EECCTTSSHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            479999999999886654

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Escherichia coli [TaxId: 562]

Probab=92.02  E-value=0.03  Score=32.49  Aligned_cols=19  Identities=16%  Similarity=0.090  Sum_probs=17.2

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|.+|+|||-+++.+.+.|
T Consensus         8 ~G~~GsGKSTvak~La~~L   26 (169)
T d1kaga_           8 VGPMGAGKSTIGRQLAQQL   26 (169)
T ss_dssp             ECCTTSCHHHHHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHHHHHh
Confidence            5999999999999998876

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Chloramphenicol phosphotransferase
domain: Chloramphenicol phosphotransferase
species: Streptomyces venezuelae [TaxId: 54571]

Probab=92.00  E-value=0.027  Score=33.42  Aligned_cols=20  Identities=20%  Similarity=0.248  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|||||-+++.+.+.|
T Consensus         8 l~G~~GsGKsTva~~L~~~l   27 (178)
T d1qhxa_           8 LNGGSSAGKSGIVRCLQSVL   27 (178)
T ss_dssp             EECCTTSSHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHHHc
Confidence            46999999999999988765

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=91.48  E-value=0.037  Score=33.01  Aligned_cols=21  Identities=19%  Similarity=0.096  Sum_probs=16.2

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |+|++|+|||.....++.+.+
T Consensus        28 i~G~~GsGKT~l~l~la~~~~   48 (242)
T d1n0wa_          28 MFGEFRTGKTQICHTLAVTCQ   48 (242)
T ss_dssp             EECCTTSSHHHHHHHHHHHTT
T ss_pred             EEeCCCCCHHHHHHHHHHHHH
Confidence            589999999987776665543

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]

Probab=91.27  E-value=0.046  Score=32.38  Aligned_cols=20  Identities=15%  Similarity=0.062  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-+++.+.+.|
T Consensus         9 i~G~pGsGKTTia~~La~~l   28 (173)
T d1rkba_           9 LTGTPGVGKTTLGKELASKS   28 (173)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            36999999999998887755

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Archaeon Methanococcus voltae [TaxId: 2188]

Probab=91.25  E-value=0.046  Score=32.50  Aligned_cols=22  Identities=14%  Similarity=0.030  Sum_probs=19.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|.+|+|||-..+.+..+|-.
T Consensus         6 i~G~~GsGKsT~~~~L~~~l~~   27 (190)
T d1khta_           6 VTGVPGVGSTTSSQLAMDNLRK   27 (190)
T ss_dssp             EECCTTSCHHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHHHH
Confidence            5799999999999999888743

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: HslU
species: Haemophilus influenzae [TaxId: 727]

Probab=91.10  E-value=0.044  Score=37.39  Aligned_cols=19  Identities=21%  Similarity=0.072  Sum_probs=17.2

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      .|+||.|||+++|-+.+.+
T Consensus        55 ~GPpG~GKT~lAkalA~~~   73 (309)
T d1ofha_          55 IGPTGVGKTEIARRLAKLA   73 (309)
T ss_dssp             ECCTTSSHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHhhcc
Confidence            5999999999999988865

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C
species: Archaeon Pyrococcus furiosus [TaxId: 2261]

Probab=90.70  E-value=0.054  Score=34.44  Aligned_cols=22  Identities=27%  Similarity=0.214  Sum_probs=18.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      +.|++|.|||.+++.+.+.+..
T Consensus        50 l~Gp~G~GKTtla~~iak~l~~   71 (231)
T d1iqpa2          50 FAGPPGVGKTTAALALARELFG   71 (231)
T ss_dssp             EESCTTSSHHHHHHHHHHHHHG
T ss_pred             EECCCCCcHHHHHHHHHHHHHh
Confidence            3599999999999999987743

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Gluconate kinase
domain: Gluconate kinase
species: Escherichia coli [TaxId: 562]

Probab=90.68  E-value=0.057  Score=32.17  Aligned_cols=20  Identities=20%  Similarity=0.154  Sum_probs=17.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-.++.+.+.|
T Consensus        11 l~G~~GsGKsT~a~~La~~l   30 (171)
T d1knqa_          11 LMGVSGSGKSAVASEVAHQL   30 (171)
T ss_dssp             EECSTTSCHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999999998876

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=90.55  E-value=0.056  Score=34.09  Aligned_cols=20  Identities=10%  Similarity=0.130  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+||+.+.+.++..+
T Consensus         5 l~GPsGsGK~tl~~~L~~~~   24 (190)
T d1lvga_           5 LSGPSGAGKSTLLKKLFQEH   24 (190)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHhC
Confidence            46999999999999887764

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

Probab=90.39  E-value=0.065  Score=36.95  Aligned_cols=21  Identities=24%  Similarity=0.233  Sum_probs=18.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      ++|+||.|||++++.+-+.|.
T Consensus        58 f~Gp~G~GKt~lak~la~~l~   78 (315)
T d1qvra3          58 FLGPTGVGKTELAKTLAATLF   78 (315)
T ss_dssp             EBSCSSSSHHHHHHHHHHHHH
T ss_pred             EECCCcchHHHHHHHHHHHhc
Confidence            379999999999999998873

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase PF2015
species: Pyrococcus furiosus [TaxId: 2261]

Probab=90.33  E-value=0.078  Score=32.73  Aligned_cols=22  Identities=18%  Similarity=0.034  Sum_probs=17.1

Q ss_pred             CCCcCCchHHHHHHHHHHHhhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      ..+||+|||.+.-+++.+.+..
T Consensus        29 ~~pTGsGKT~i~~~~~~~~~~~   50 (200)
T d1wp9a1          29 VLPTGLGKTLIAMMIAEYRLTK   50 (200)
T ss_dssp             ECCTTSCHHHHHHHHHHHHHHH
T ss_pred             EeCCCCcHHHHHHHHHHHHHHh
Confidence            4689999999888777766554

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Plasmid maintenance system epsilon/zeta, toxin zeta subunit
domain: Plasmid maintenance system epsilon/zeta, toxin zeta subunit
species: Streptococcus pyogenes [TaxId: 1314]

Probab=90.32  E-value=0.048  Score=34.76  Aligned_cols=20  Identities=15%  Similarity=0.243  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||.+++.+...+
T Consensus        37 L~GpPGtGKT~la~~la~~~   56 (273)
T d1gvnb_          37 LGGQPGSGKTSLRSAIFEET   56 (273)
T ss_dssp             EECCTTSCTHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            47999999999999887765

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpA, an Hsp100 chaperone, AAA+ modules
species: Escherichia coli [TaxId: 562]

Probab=90.11  E-value=0.061  Score=36.93  Aligned_cols=20  Identities=30%  Similarity=0.260  Sum_probs=18.1

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||.|||++++.+-+.+
T Consensus        57 f~Gp~GvGKT~lak~la~~l   76 (315)
T d1r6bx3          57 FAGPTGVGKTEVTVQLSKAL   76 (315)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCcchhHHHHHHHHhhc
Confidence            36999999999999998876

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Maize (Zea mays) [TaxId: 4577]

Probab=90.07  E-value=0.056  Score=33.48  Aligned_cols=20  Identities=10%  Similarity=0.076  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|||||-.++.+..++
T Consensus         8 i~GppGsGKsT~a~~La~~~   27 (189)
T d1zaka1           8 ISGAPASGKGTQCELIKTKY   27 (189)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            46999999999999887776

>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: HslU
species: Haemophilus influenzae [TaxId: 727]

Probab=89.97  E-value=0.053  Score=39.34  Aligned_cols=20  Identities=25%  Similarity=0.140  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|+||+|||++++-+-+.|
T Consensus        54 liGPTGvGKTlLAr~LAk~l   73 (443)
T d1g41a_          54 MIGPTGVGKTEIARRLAKLA   73 (443)
T ss_dssp             EECCTTSSHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            45999999999999887755

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Probable kinase LmjF30.1890
species: Leishmania major [TaxId: 5664]

Probab=89.88  E-value=0.058  Score=32.13  Aligned_cols=20  Identities=20%  Similarity=0.278  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|.+|+|||-+++.+-..|
T Consensus        10 i~G~~GsGKTT~~~~La~~l   29 (174)
T d1y63a_          10 ITGTPGTGKTSMAEMIAAEL   29 (174)
T ss_dssp             EECSTTSSHHHHHHHHHHHS
T ss_pred             EEeCCCCCHHHHHHHHHHHh
Confidence            46999999999999887755

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CDC6, N-domain
species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]

Probab=89.75  E-value=0.071  Score=33.50  Aligned_cols=21  Identities=14%  Similarity=-0.026  Sum_probs=18.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      +.|++|.|||-+.+.+.+.|-
T Consensus        48 l~GppGtGKT~l~~~l~~~l~   68 (276)
T d1fnna2          48 LLGRPGTGKTVTLRKLWELYK   68 (276)
T ss_dssp             EECCTTSSHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHHh
Confidence            359999999999999988874

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Adenosine-5'phosphosulfate kinase (APS kinase)
domain: Adenosine-5'phosphosulfate kinase (APS kinase)
species: Fungus (Penicillium chrysogenum) [TaxId: 5076]

Probab=89.68  E-value=0.072  Score=34.46  Aligned_cols=22  Identities=14%  Similarity=0.258  Sum_probs=18.5

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|-||||||-+++.+.+.|..
T Consensus        29 ltGlsGsGKTTia~~L~~~l~~   50 (208)
T d1m7ga_          29 LTGLSASGKSTLAVELEHQLVR   50 (208)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHHH
Confidence            4699999999999998877743

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CDC6-like protein APE0152, N-terminal domain
species: Aeropyrum pernix [TaxId: 56636]

Probab=89.64  E-value=0.11  Score=32.70  Aligned_cols=21  Identities=14%  Similarity=0.050  Sum_probs=18.9

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      .|++|.|||-+.+.+++.|..
T Consensus        52 ~GppGtGKT~l~~~l~~~l~~   72 (287)
T d1w5sa2          52 IGRVGIGKTTLAKFTVKRVSE   72 (287)
T ss_dssp             TTCCSSSHHHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHHHh
Confidence            599999999999999998854

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=89.55  E-value=0.066  Score=33.07  Aligned_cols=20  Identities=10%  Similarity=0.142  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||+||+.+.+.++..+
T Consensus         7 l~GpsG~GK~tl~~~L~~~~   26 (182)
T d1znwa1           7 LSGPSAVGKSTVVRCLRERI   26 (182)
T ss_dssp             EECSTTSSHHHHHHHHHHHS
T ss_pred             EECCCCCCHHHHHHHHHhhC
Confidence            46999999999998887653

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Molybdopterin-guanine dinucleotide biosynthesis protein MobB
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=89.29  E-value=0.094  Score=31.76  Aligned_cols=24  Identities=17%  Similarity=0.141  Sum_probs=20.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~   24 (80)
                      |.|.+|||||-...-++.+|....
T Consensus         6 I~G~~gSGKTTli~~l~~~L~~~g   29 (165)
T d1xjca_           6 VVGYKHSGKTTLMEKWVAAAVREG   29 (165)
T ss_dssp             EECCTTSSHHHHHHHHHHHHHHTT
T ss_pred             EEeCCCCCHHHHHHHHHHHHHhCC
Confidence            479999999999999999987654

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Adenosine-5'phosphosulfate kinase (APS kinase)
domain: Adenosine-5'phosphosulfate kinase (APS kinase)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=89.19  E-value=0.054  Score=32.86  Aligned_cols=20  Identities=20%  Similarity=0.225  Sum_probs=17.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|.+|||||-+++.+.++|
T Consensus        24 L~G~pGSGKTTiAk~La~~l   43 (195)
T d1x6va3          24 LTGLSGAGKTTVSMALEEYL   43 (195)
T ss_dssp             EESSCHHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            35999999999999998876

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=89.17  E-value=0.093  Score=32.96  Aligned_cols=23  Identities=22%  Similarity=0.109  Sum_probs=19.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|++|.|||.+.+.+.+.+...
T Consensus        38 l~Gp~G~GKTtl~~~i~~~l~~~   60 (237)
T d1sxjd2          38 FYGPPGTGKTSTILALTKELYGP   60 (237)
T ss_dssp             EECSTTSSHHHHHHHHHHHHHHH
T ss_pred             EECCCCCChHHHHHHHHHHHcCC
Confidence            35999999999999999987543

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Holliday junction helicase RuvB
species: Thermotoga maritima [TaxId: 2336]

Probab=88.95  E-value=0.12  Score=32.77  Aligned_cols=20  Identities=25%  Similarity=0.215  Sum_probs=17.9

Q ss_pred             CCCcCCchHHHHHHHHHHHh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~   21 (80)
                      .|++|.|||-+++++.+++-
T Consensus        41 ~GPpGtGKT~lA~~la~~~~   60 (238)
T d1in4a2          41 AGPPGLGKTTLAHIIASELQ   60 (238)
T ss_dssp             ESSTTSSHHHHHHHHHHHHT
T ss_pred             ECCCCCcHHHHHHHHHhccC
Confidence            59999999999999988763

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Meiotic recombination protein DMC1/LIM15 homolog
species: Human (Homo sapiens) [TaxId: 9606]

Probab=88.68  E-value=0.084  Score=33.00  Aligned_cols=20  Identities=15%  Similarity=0.109  Sum_probs=16.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++|++|+|||.++..++.+.
T Consensus        42 i~G~~GsGKT~lalq~~~~~   61 (258)
T d1v5wa_          42 AFGEFRTGKTQLSHTLCVTA   61 (258)
T ss_dssp             EECCTTCTHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            58999999999988776643

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Archaeon Methanococcus voltae [TaxId: 2188]

Probab=88.64  E-value=0.072  Score=32.85  Aligned_cols=22  Identities=23%  Similarity=0.096  Sum_probs=18.0

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|++|+|||.++..++..++.
T Consensus        39 i~G~~G~GKT~~~l~~a~~~~~   60 (258)
T d2i1qa2          39 FAGVFGSGKTQIMHQSCVNLQN   60 (258)
T ss_dssp             EEESTTSSHHHHHHHHHHHTTC
T ss_pred             EEeCCCCCHHHHHHHHHHHHHh
Confidence            5799999999998888776643

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=88.44  E-value=0.087  Score=32.90  Aligned_cols=20  Identities=10%  Similarity=0.170  Sum_probs=16.6

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|+||+||+.+.+.++..+
T Consensus         6 l~GpsG~GK~tl~~~L~~~~   25 (186)
T d1gkya_           6 ISGPSGTGKSTLLKKLFAEY   25 (186)
T ss_dssp             EECCTTSSHHHHHHHHHHHC
T ss_pred             EECCCCCCHHHHHHHHHHhC
Confidence            36999999999999887653

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Archaeon Pyrococcus furiosus [TaxId: 2261]

Probab=88.37  E-value=0.076  Score=33.39  Aligned_cols=21  Identities=14%  Similarity=0.156  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      ++|++|+|||.....++.+.+
T Consensus        41 i~G~pGsGKT~~~lq~~~~~~   61 (254)
T d1pzna2          41 VFGEFGSGKTQLAHTLAVMVQ   61 (254)
T ss_dssp             EEESTTSSHHHHHHHHHHHTT
T ss_pred             EEcCCCCCHHHHHHHHHHHhh
Confidence            579999999999887766654

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: CMP kinase
species: Streptococcus pneumoniae [TaxId: 1313]

Probab=88.14  E-value=0.11  Score=32.36  Aligned_cols=19  Identities=11%  Similarity=0.181  Sum_probs=17.3

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      .|++|+|||-.++++..+|
T Consensus         9 dGp~GsGKgT~ak~La~~l   27 (223)
T d1q3ta_           9 DGPASSGKSTVAKIIAKDF   27 (223)
T ss_dssp             ECSSCSSHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHh
Confidence            4999999999999998876

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Transcriptional regulator NadR, ribosylnicotinamide kinase domain
species: Haemophilus influenzae [TaxId: 727]

Probab=88.12  E-value=0.094  Score=30.82  Aligned_cols=20  Identities=15%  Similarity=0.169  Sum_probs=17.2

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|+|||-.++.+.+++
T Consensus        12 i~G~~GsGKTTla~~La~~~   31 (192)
T d1lw7a2          12 ILGGESSGKSVLVNKLAAVF   31 (192)
T ss_dssp             EECCTTSHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            45999999999999887765

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Uridylate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=88.01  E-value=0.091  Score=32.54  Aligned_cols=19  Identities=11%  Similarity=-0.123  Sum_probs=17.2

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|.+|||||..++++.+++
T Consensus        14 ~GppGSGKsT~a~~La~~~   32 (196)
T d1ukza_          14 LGGPGAGKGTQCEKLVKDY   32 (196)
T ss_dssp             ECSTTSSHHHHHHHHHHHS
T ss_pred             ECCCCCCHHHHHHHHHHHh
Confidence            5999999999999998876

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: UMP/CMP kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=87.95  E-value=0.11  Score=31.85  Aligned_cols=20  Identities=10%  Similarity=-0.039  Sum_probs=17.5

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|.+|||||..++++..+|
T Consensus         6 i~GppGSGKsT~a~~La~~~   25 (194)
T d1teva_           6 VLGGPGAGKGTQCARIVEKY   25 (194)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            46999999999999998865

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Escherichia coli [TaxId: 562]

Probab=87.57  E-value=0.1  Score=33.65  Aligned_cols=19  Identities=11%  Similarity=0.148  Sum_probs=16.3

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|+||+||+.+.+.++..
T Consensus         7 i~GPSG~GK~tl~~~L~~~   25 (205)
T d1s96a_           7 VSAPSGAGKSSLIQALLKT   25 (205)
T ss_dssp             EECCTTSCHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHhh
Confidence            4699999999999888764

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Atu3015-like
domain: Hypothetical protein Atu3015
species: Agrobacterium tumefaciens [TaxId: 358]

Probab=87.56  E-value=0.046  Score=32.58  Aligned_cols=19  Identities=11%  Similarity=0.158  Sum_probs=15.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|.+|||||-+++.+.+.
T Consensus         9 l~G~~GsGKSTia~~La~~   27 (176)
T d1zp6a1           9 LSGHPGSGKSTIAEALANL   27 (176)
T ss_dssp             EEECTTSCHHHHHHHHHTC
T ss_pred             EECCCCCCHHHHHHHHHHH
Confidence            4689999999999988654

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Dephospho-CoA kinase
species: Thermus thermophilus [TaxId: 274]

Probab=87.38  E-value=0.079  Score=32.70  Aligned_cols=18  Identities=11%  Similarity=0.169  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      ++|.+|||||.+++++-.
T Consensus         8 itG~~gSGKstva~~l~~   25 (191)
T d1uf9a_           8 ITGNIGSGKSTVAALLRS   25 (191)
T ss_dssp             EEECTTSCHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            479999999999997754

>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Extracellular secretion NTPase EpsE
species: Vibrio cholerae [TaxId: 666]

Probab=87.35  E-value=0.12  Score=36.57  Aligned_cols=22  Identities=23%  Similarity=0.104  Sum_probs=19.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ++|+||||||-+-+-++.++-.
T Consensus       163 vtGpTGSGKSTTl~~~l~~~~~  184 (401)
T d1p9ra_         163 VTGPTGSGKSTTLYAGLQELNS  184 (401)
T ss_dssp             EECSTTSCHHHHHHHHHHHHCC
T ss_pred             EEcCCCCCccHHHHHHhhhhcC
Confidence            5899999999999999998743

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Campylobacter jejuni [TaxId: 197]

Probab=87.32  E-value=0.18  Score=30.65  Aligned_cols=19  Identities=16%  Similarity=0.050  Sum_probs=17.1

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|.+|||||-+.+.+-+.|
T Consensus         6 iG~~GsGKsTi~k~La~~l   24 (161)
T d1viaa_           6 IGFMGSGKSTLARALAKDL   24 (161)
T ss_dssp             ECCTTSCHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHh
Confidence            4899999999999998876

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Archaeon Thermococcus litoralis [TaxId: 2265]

Probab=87.28  E-value=0.1  Score=35.22  Aligned_cols=18  Identities=17%  Similarity=0.056  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|+||||||.+.+++.-
T Consensus        34 liG~sGaGKSTll~~i~g   51 (240)
T d1g2912          34 LLGPSGCGKTTTLRMIAG   51 (240)
T ss_dssp             EECSTTSSHHHHHHHHHT
T ss_pred             EECCCCChHHHHHHHHhc
Confidence            469999999999998854

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Circadian clock protein KaiC
species: Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]

Probab=87.19  E-value=0.12  Score=31.77  Aligned_cols=19  Identities=26%  Similarity=0.394  Sum_probs=14.8

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      |+|++|+|||..+..++..
T Consensus        31 I~G~~G~GKT~la~~~~~~   49 (242)
T d1tf7a1          31 VSGTSGTGKTLFSIQFLYN   49 (242)
T ss_dssp             EEESTTSSHHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHHH
Confidence            5799999999998654443

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

Probab=86.95  E-value=0.099  Score=29.74  Aligned_cols=19  Identities=21%  Similarity=-0.193  Sum_probs=13.1

Q ss_pred             CCCcCCchHHHHHHH-HHHH
Q psy17057          2 AGSTMRDKTPFKLVV-LLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~-l~~l   20 (80)
                      ..+||+|||++.-.+ +.++
T Consensus        13 ~~~tGsGKT~~~~~~~~~~~   32 (140)
T d1yksa1          13 DFHPGAGKTRRFLPQILAEC   32 (140)
T ss_dssp             CCCTTSSTTTTHHHHHHHHH
T ss_pred             EcCCCCChhHHHHHHHHHHh
Confidence            468999999877544 3444

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C3
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=86.92  E-value=0.19  Score=31.50  Aligned_cols=20  Identities=15%  Similarity=0.074  Sum_probs=17.9

Q ss_pred             CCCcCCchHHHHHHHHHHHh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~   21 (80)
                      -|++|.|||.+.+.+.+.+.
T Consensus        41 ~Gp~G~GKttl~~~la~~l~   60 (227)
T d1sxjc2          41 YGPPGTGKTSTIVALAREIY   60 (227)
T ss_dssp             ECSSSSSHHHHHHHHHHHHH
T ss_pred             ECCCCCChhHHHHHHHHHhh
Confidence            59999999999999998764

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=86.86  E-value=0.15  Score=31.16  Aligned_cols=20  Identities=15%  Similarity=0.071  Sum_probs=17.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +.|..|||||-.++.+..++
T Consensus         5 i~G~pGsGKsT~a~~La~~~   24 (181)
T d2cdna1           5 LLGPPGAGKGTQAVKLAEKL   24 (181)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            46999999999999998876

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Pantothenate kinase PanK
species: Escherichia coli [TaxId: 562]

Probab=86.67  E-value=0.12  Score=35.97  Aligned_cols=22  Identities=27%  Similarity=0.271  Sum_probs=19.4

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |||.+|||||-+++.+...|..
T Consensus        85 IaG~sgSGKSTla~~L~~lL~~  106 (308)
T d1sq5a_          85 IAGSVAVGKSTTARVLQALLSR  106 (308)
T ss_dssp             EEECTTSSHHHHHHHHHHHHTT
T ss_pred             EeCCCCCCCcHHHHHHHHHHhh
Confidence            6899999999999999887754

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: UMP/CMP kinase
species: Dictyostelium discoideum [TaxId: 44689]

Probab=86.65  E-value=0.13  Score=31.70  Aligned_cols=20  Identities=10%  Similarity=-0.012  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|.+|||||-.++.+..++
T Consensus        11 i~G~pGSGKsT~a~~La~~~   30 (194)
T d1qf9a_          11 VLGGPGSGKGTQCANIVRDF   30 (194)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            35999999999999998875

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Hypothetical protein Ygr205W
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=86.63  E-value=0.15  Score=35.12  Aligned_cols=23  Identities=13%  Similarity=0.186  Sum_probs=19.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      |||.+|+|||-.+..+..+|...
T Consensus        32 i~G~qGSGKSTl~~~l~~~L~~~   54 (286)
T d1odfa_          32 FSGPQGSGKSFTSIQIYNHLMEK   54 (286)
T ss_dssp             EECCTTSSHHHHHHHHHHHHHHH
T ss_pred             eECCCCCCHHHHHHHHHHHHHHH
Confidence            58999999999999998888553

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=86.61  E-value=0.17  Score=32.04  Aligned_cols=19  Identities=26%  Similarity=0.086  Sum_probs=17.3

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      .|++|.|||-+++.+.+++
T Consensus        58 ~GPpG~GKTt~a~~la~~~   76 (253)
T d1sxja2          58 YGPPGIGKTTAAHLVAQEL   76 (253)
T ss_dssp             ECSTTSSHHHHHHHHHHHT
T ss_pred             ECCCCCCHHHHHHHHHHHH
Confidence            5999999999999998875

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Circadian clock protein KaiC
species: Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]

Probab=86.57  E-value=0.14  Score=32.31  Aligned_cols=23  Identities=17%  Similarity=0.008  Sum_probs=19.1

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      +.|++|+|||.+...++..++..
T Consensus        31 i~G~pGsGKT~l~~qia~~~~~~   53 (242)
T d1tf7a2          31 ATGATGTGKTLLVSRFVENACAN   53 (242)
T ss_dssp             EEECTTSSHHHHHHHHHHHHHTT
T ss_pred             EEeCCCCCHHHHHHHHHHHHHHh
Confidence            47999999999999888876543

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=86.40  E-value=0.22  Score=29.94  Aligned_cols=20  Identities=10%  Similarity=0.022  Sum_probs=17.4

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |-|.+|||||-.++++.+++
T Consensus         5 i~G~pGSGKsT~a~~La~~~   24 (182)
T d1zina1           5 LMGLPGAGKGTQAEKIVAAY   24 (182)
T ss_dssp             EECSTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHH
Confidence            35999999999999998876

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: ATP-binding subunit of the histidine permease
species: Salmonella typhimurium [TaxId: 90371]

Probab=86.24  E-value=0.11  Score=35.07  Aligned_cols=18  Identities=22%  Similarity=0.335  Sum_probs=15.4

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|||||.+.+.+.-
T Consensus        33 iiG~sGsGKSTLl~~i~G   50 (258)
T d1b0ua_          33 IIGSSGSGKSTFLRCINF   50 (258)
T ss_dssp             EECCTTSSHHHHHHHHTT
T ss_pred             EECCCCCcHHHHHHHHHc
Confidence            469999999999998854

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Helicase-like "domain" of reverse gyrase
domain: Helicase-like "domain" of reverse gyrase
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]

Probab=86.10  E-value=0.22  Score=31.81  Aligned_cols=21  Identities=33%  Similarity=0.306  Sum_probs=15.6

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      ..+||+|||++.-+.+.++..
T Consensus        64 ~apTGsGKT~~~~~~~~~~~~   84 (237)
T d1gkub1          64 TAPTGVGKTSFGLAMSLFLAL   84 (237)
T ss_dssp             CCCBTSCSHHHHHHHHHHHHT
T ss_pred             EecCCChHHHHHHHHHHHHHH
Confidence            467999999987776665543

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Haemolysin B ATP-binding protein
species: Escherichia coli [TaxId: 562]

Probab=85.94  E-value=0.1  Score=34.92  Aligned_cols=20  Identities=10%  Similarity=0.217  Sum_probs=17.0

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||||||-..++++..+
T Consensus        34 IvG~sGsGKSTLl~ll~gl~   53 (241)
T d2pmka1          34 IVGRSGSGKSTLTKLIQRFY   53 (241)
T ss_dssp             EECSTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHHhcC
Confidence            46999999999999987754

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Hexameric traffic ATPase, HP0525
species: Helicobacter pylori [TaxId: 210]

Probab=85.78  E-value=0.067  Score=37.17  Aligned_cols=20  Identities=20%  Similarity=0.330  Sum_probs=16.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      ++|.||||||.+.+.++.++
T Consensus       171 i~G~tgSGKTT~l~al~~~i  190 (323)
T d1g6oa_         171 VCGGTGSGKTTYIKSIMEFI  190 (323)
T ss_dssp             EEESTTSSHHHHHHHHGGGS
T ss_pred             EEeeccccchHHHHHHhhhc
Confidence            57999999999988776654

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Hel308 helicase
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=85.72  E-value=0.12  Score=32.40  Aligned_cols=18  Identities=22%  Similarity=0.134  Sum_probs=14.0

Q ss_pred             CCCcCCchHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~   19 (80)
                      +.+||+|||.+..+.+.+
T Consensus        46 ~apTGsGKT~~a~l~i~~   63 (202)
T d2p6ra3          46 AMPTAAGKTLLAEMAMVR   63 (202)
T ss_dssp             ECSSHHHHHHHHHHHHHH
T ss_pred             EcCCCCchhHHHHHHHHH
Confidence            578999999998665543

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: RecG helicase domain
species: Thermotoga maritima [TaxId: 2336]

Probab=85.51  E-value=0.27  Score=33.41  Aligned_cols=23  Identities=17%  Similarity=0.127  Sum_probs=18.6

Q ss_pred             CCCcCCchHHHHHHHHHHHhhhc
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~~~   24 (80)
                      -|.+|+|||+..-.++...+...
T Consensus       110 ~GdvGSGKT~Va~~a~~~~~~~g  132 (264)
T d1gm5a3         110 QGDVGSGKTVVAQLAILDNYEAG  132 (264)
T ss_dssp             ECCSSSSHHHHHHHHHHHHHHHT
T ss_pred             eccccccccHHHHHHHHHHHhcc
Confidence            48999999999998887665543

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Bacterial conjugative coupling protein TrwB
species: Escherichia coli [TaxId: 562]

Probab=85.48  E-value=0.16  Score=34.82  Aligned_cols=23  Identities=17%  Similarity=0.079  Sum_probs=17.9

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      |.|.||+|||.+.+.++..+...
T Consensus        55 I~G~tGsGKT~~l~~li~~~~~~   77 (433)
T d1e9ra_          55 VNGATGTGKSVLLRELAYTGLLR   77 (433)
T ss_dssp             EEECTTSSHHHHHHHHHHHHHHT
T ss_pred             EEeCCCCcHHHHHHHHHHHHHhC
Confidence            45999999999988777666543

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Methionine import ATP-binding protein MetN
species: Escherichia coli [TaxId: 562]

Probab=85.35  E-value=0.11  Score=34.92  Aligned_cols=18  Identities=22%  Similarity=0.241  Sum_probs=14.9

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|+||||||-..+++.-
T Consensus        36 iiG~sGsGKSTLl~~i~G   53 (240)
T d3dhwc1          36 VIGASGAGKSTLIRCVNL   53 (240)
T ss_dssp             EEESTTSSHHHHHHHHTT
T ss_pred             EECCCCCCHHHHHHHHcC
Confidence            469999999999887743

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain
domain: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=85.27  E-value=0.2  Score=30.53  Aligned_cols=21  Identities=29%  Similarity=0.180  Sum_probs=18.6

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      |.|-+|+|||-+++.+.++|-
T Consensus         7 l~GlpgsGKSTla~~L~~~l~   27 (213)
T d1bifa1           7 MVGLPARGKTYISKKLTRYLN   27 (213)
T ss_dssp             EECCTTSSHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHH
Confidence            569999999999999988874

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Bacillus globisporus [TaxId: 1459]

Probab=85.19  E-value=0.27  Score=29.97  Aligned_cols=19  Identities=11%  Similarity=-0.111  Sum_probs=17.3

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|..|||||..++.+..+|
T Consensus         6 ~G~pGSGKsT~a~~La~~~   24 (182)
T d1s3ga1           6 MGLPGAGKGTQADRIVEKY   24 (182)
T ss_dssp             ECSTTSSHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHH
Confidence            5999999999999998876

>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: DNA helicase UvsW
domain: DNA helicase UvsW
species: Bacteriophage T4 [TaxId: 10665]

Probab=84.91  E-value=0.31  Score=32.70  Aligned_cols=22  Identities=9%  Similarity=0.024  Sum_probs=18.4

Q ss_pred             CCcCCchHHHHHHHHHHHhhhc
Q psy17057          3 GSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         3 G~sg~gKte~~k~~l~~l~~~~   24 (80)
                      -.||+|||.++..+++++....
T Consensus       135 ~pTGsGKT~i~~~i~~~~~~~~  156 (282)
T d1rifa_         135 LPTSAGRSLIQALLARYYLENY  156 (282)
T ss_dssp             CCTTSCHHHHHHHHHHHHHHHC
T ss_pred             EEcccCccHHHHHHHHHhhhcc
Confidence            4799999999999998876653

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Escherichia coli [TaxId: 562]

Probab=84.78  E-value=0.18  Score=30.65  Aligned_cols=20  Identities=10%  Similarity=0.162  Sum_probs=17.3

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      +-|..|||||-.++.+.+++
T Consensus         5 i~G~pGSGKsT~~~~La~~~   24 (179)
T d1e4va1           5 LLGAPVAGKGTQAQFIMEKY   24 (179)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            35899999999999998875

>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: HPr kinase HprK C-terminal domain
domain: HPr kinase HprK C-terminal domain
species: Lactobacillus casei [TaxId: 1582]

Probab=84.43  E-value=0.19  Score=32.45  Aligned_cols=18  Identities=17%  Similarity=0.224  Sum_probs=14.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|+||+|||+++..+++
T Consensus        19 ~~G~sG~GKStlal~l~~   36 (176)
T d1kkma_          19 ITGDSGVGKSETALELVQ   36 (176)
T ss_dssp             EECCTTSCHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHH
Confidence            469999999998876554

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Archaeon Sulfolobus acidocaldarius [TaxId: 2285]

Probab=84.35  E-value=0.19  Score=29.74  Aligned_cols=22  Identities=18%  Similarity=0.069  Sum_probs=18.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~   22 (80)
                      |.|-+|+|||-..+.+..+|-.
T Consensus         6 i~G~~GsGKTT~~~~La~~L~~   27 (194)
T d1nksa_           6 VTGIPGVGKSTVLAKVKEILDN   27 (194)
T ss_dssp             EEECTTSCHHHHHHHHHHHHHT
T ss_pred             EECCCCCCHHHHHHHHHHHHHH
Confidence            4699999999999999888743

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: CMP kinase
species: Escherichia coli [TaxId: 562]

Probab=84.19  E-value=0.23  Score=30.43  Aligned_cols=20  Identities=15%  Similarity=0.132  Sum_probs=17.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|++||||+-.++.+...+
T Consensus         8 I~GppGSGKgT~ak~La~~~   27 (225)
T d1ckea_           8 IDGPSGAGKGTLCKAMAEAL   27 (225)
T ss_dssp             EECCTTSSHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHh
Confidence            35999999999999998876

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: delta prime subunit of DNA polymerase III, N-domain
species: Escherichia coli [TaxId: 562]

Probab=83.87  E-value=0.22  Score=31.75  Aligned_cols=24  Identities=8%  Similarity=0.033  Sum_probs=20.8

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhhc
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHED   24 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~~   24 (80)
                      +.|+.|.|||.+++.++++|....
T Consensus        29 l~Gp~G~GKtt~a~~~a~~l~~~~   52 (207)
T d1a5ta2          29 IQALPGMGDDALIYALSRYLLCQQ   52 (207)
T ss_dssp             EECCTTSCHHHHHHHHHHHHTCSS
T ss_pred             EECCCCCcHHHHHHHHHHhccccc
Confidence            369999999999999999987543

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Sulfate/molybdate ABC transporter, ATP-binding protein
species: Methanosarcina acetivorans [TaxId: 2214]

Probab=83.75  E-value=0.15  Score=34.18  Aligned_cols=18  Identities=28%  Similarity=0.217  Sum_probs=15.6

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|+||||||.+-+++.-
T Consensus        31 liGpsGaGKSTll~~l~G   48 (229)
T d3d31a2          31 ILGPTGAGKTLFLELIAG   48 (229)
T ss_dssp             EECCCTHHHHHHHHHHHT
T ss_pred             EECCCCCcHHHHHHHHhc
Confidence            469999999999998855

>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: HPr kinase HprK C-terminal domain
domain: HPr kinase HprK C-terminal domain
species: Mycoplasma pneumoniae [TaxId: 2104]

Probab=83.45  E-value=0.15  Score=33.01  Aligned_cols=18  Identities=17%  Similarity=0.209  Sum_probs=14.5

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|+||+|||+++..++.
T Consensus        20 i~G~sG~GKS~lal~l~~   37 (177)
T d1knxa2          20 LTGRSGIGKSECALDLIN   37 (177)
T ss_dssp             EEESSSSSHHHHHHHHHT
T ss_pred             EEcCCCCCHHHHHHHHHH
Confidence            469999999999866544

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Gene 4 protein (g4p, DNA primase), helicase domain
species: Bacteriophage T7 [TaxId: 10760]

Probab=83.28  E-value=0.27  Score=31.74  Aligned_cols=21  Identities=14%  Similarity=0.011  Sum_probs=16.3

Q ss_pred             CCCCcCCchHHHHHHHHHHHh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~   21 (80)
                      ++|.||+|||.....++.+++
T Consensus        40 i~G~~G~GKT~~~~~la~~~a   60 (277)
T d1cr2a_          40 VTSGSGMGKSTFVRQQALQWG   60 (277)
T ss_dssp             EECSTTSSHHHHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHHhhh
Confidence            589999999987776666544

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Holliday junction helicase RuvB
species: Thermus thermophilus [TaxId: 274]

Probab=83.25  E-value=0.35  Score=30.54  Aligned_cols=19  Identities=26%  Similarity=0.181  Sum_probs=17.4

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      .|++|.|||-+++.+.+.+
T Consensus        41 ~GPpG~GKTtla~~la~~~   59 (239)
T d1ixsb2          41 FGPPGLGKTTLAHVIAHEL   59 (239)
T ss_dssp             ECCTTSCHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHh
Confidence            5999999999999998876

>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: HPr kinase HprK C-terminal domain
domain: HPr kinase HprK C-terminal domain
species: Staphylococcus xylosus [TaxId: 1288]

Probab=82.94  E-value=0.2  Score=32.03  Aligned_cols=18  Identities=17%  Similarity=0.226  Sum_probs=14.3

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      |.|+||+|||+++-..++
T Consensus        20 i~G~sg~GKS~la~~l~~   37 (169)
T d1ko7a2          20 ITGDSGIGKSETALELIK   37 (169)
T ss_dssp             EEESTTSSHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHH
Confidence            469999999998865544

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C4
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=82.94  E-value=0.43  Score=29.96  Aligned_cols=21  Identities=24%  Similarity=0.056  Sum_probs=18.4

Q ss_pred             CCCcCCchHHHHHHHHHHHhh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLLH   22 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~~   22 (80)
                      -|++|.|||-+++.+.+.|..
T Consensus        42 ~Gp~G~GKTt~a~~la~~l~~   62 (224)
T d1sxjb2          42 SGMPGIGKTTSVHCLAHELLG   62 (224)
T ss_dssp             ECSTTSSHHHHHHHHHHHHHG
T ss_pred             ECCCCCCchhhHHHHHHHHhc
Confidence            599999999999999887754

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=82.77  E-value=0.15  Score=31.44  Aligned_cols=17  Identities=12%  Similarity=0.114  Sum_probs=13.3

Q ss_pred             CCCCcCCchHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVL   17 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l   17 (80)
                      ++|++|+|||.+...++
T Consensus        39 i~G~pGsGKT~l~lq~~   55 (251)
T d1szpa2          39 LFGEFRTGKSQLCHTLA   55 (251)
T ss_dssp             EEESTTSSHHHHHHHHT
T ss_pred             EEcCCCCCHHHHHHHHH
Confidence            57999999998665543

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Multidrug resistance ABC transporter LmrA, C-terminal domain
species: Lactococcus lactis [TaxId: 1358]

Probab=82.45  E-value=0.18  Score=33.62  Aligned_cols=20  Identities=15%  Similarity=0.122  Sum_probs=16.8

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|+||||||-..++++..+
T Consensus        33 ivG~sGsGKSTLl~ll~gl~   52 (242)
T d1mv5a_          33 FAGPSGGGKSTIFSLLERFY   52 (242)
T ss_dssp             EECCTTSSHHHHHHHHTTSS
T ss_pred             EECCCCCCHHHHHHHHHHhh
Confidence            46999999999999887654

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase-like domain of Cask
species: Human (Homo sapiens) [TaxId: 9606]

Probab=82.38  E-value=0.26  Score=30.82  Aligned_cols=18  Identities=11%  Similarity=0.178  Sum_probs=15.0

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|+||+||+.+.+-+++
T Consensus         8 l~Gpsg~GK~tl~~~L~~   25 (178)
T d1kgda_           8 LLGAHGVGRRHIKNTLIT   25 (178)
T ss_dssp             EECCTTSSHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHH
Confidence            359999999999887664

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Erwinia chrysanthemi [TaxId: 556]

Probab=82.24  E-value=0.42  Score=28.82  Aligned_cols=19  Identities=16%  Similarity=0.013  Sum_probs=16.7

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|.+|+|||-+.+.+.+.|
T Consensus         8 ~G~~GsGKSTia~~LA~~L   26 (170)
T d1e6ca_           8 VGARGCGMTTVGRELARAL   26 (170)
T ss_dssp             ESCTTSSHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHh
Confidence            4899999999999998765

>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: ABC transporter involved in vitamin B12 uptake, BtuD
species: Escherichia coli [TaxId: 562]

Probab=82.05  E-value=0.35  Score=31.78  Aligned_cols=18  Identities=11%  Similarity=0.074  Sum_probs=14.8

Q ss_pred             CCCCcCCchHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLL   18 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~   18 (80)
                      +.|++|||||..-+.+.-
T Consensus        30 iiG~nGaGKSTLl~~l~G   47 (231)
T d1l7vc_          30 LVGPNGAGKSTLLARMAG   47 (231)
T ss_dssp             CBCCTTSSHHHHHHHHHT
T ss_pred             EECCCCCcHHHHHHHHhC
Confidence            579999999998877643

>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: MJ1267
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=81.58  E-value=0.24  Score=33.11  Aligned_cols=19  Identities=16%  Similarity=0.146  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~   19 (80)
                      +.|++|||||...+.+.-.
T Consensus        35 liG~nGaGKSTLl~~i~Gl   53 (254)
T d1g6ha_          35 IIGPNGSGKSTLINVITGF   53 (254)
T ss_dssp             EECSTTSSHHHHHHHHTTS
T ss_pred             EECCCCCcHHHHHHHHHCC
Confidence            3699999999999988543

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C5
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=81.55  E-value=0.35  Score=30.39  Aligned_cols=20  Identities=15%  Similarity=0.149  Sum_probs=17.9

Q ss_pred             CCCcCCchHHHHHHHHHHHh
Q psy17057          2 AGSTMRDKTPFKLVVLLVLL   21 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l~   21 (80)
                      -|+.|.|||-+++.+++.|.
T Consensus        39 ~Gp~G~GKTt~~~~la~~l~   58 (252)
T d1sxje2          39 YGPNGTGKKTRCMALLESIF   58 (252)
T ss_dssp             ECSTTSSHHHHHHTHHHHHS
T ss_pred             ECCCCCCHHHHHHHHHHhhc
Confidence            49999999999999999874

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=81.55  E-value=0.47  Score=28.48  Aligned_cols=19  Identities=16%  Similarity=0.076  Sum_probs=16.8

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      -|-+|+|||-+.+++-..|
T Consensus         7 iG~~G~GKSTig~~La~~l   25 (165)
T d2iyva1           7 VGLPGSGKSTIGRRLAKAL   25 (165)
T ss_dssp             ECSTTSSHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHh
Confidence            3899999999999998776

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: MJ0796
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=81.20  E-value=0.25  Score=32.91  Aligned_cols=16  Identities=13%  Similarity=0.297  Sum_probs=13.4

Q ss_pred             CCCCcCCchHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVV   16 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~   16 (80)
                      +.|+||||||-.-+++
T Consensus        36 iiG~sGsGKSTLl~~i   51 (230)
T d1l2ta_          36 IMGPSGSGKSTMLNII   51 (230)
T ss_dssp             EECSTTSSHHHHHHHH
T ss_pred             EECCCCCCcchhhHhc
Confidence            3599999999887755

>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DNA repair protein RAD25
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=80.84  E-value=0.25  Score=31.22  Aligned_cols=19  Identities=21%  Similarity=0.076  Sum_probs=14.4

Q ss_pred             CCCcCCchHHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~l   20 (80)
                      +.+||+|||.+.-.++..+
T Consensus        91 ~~~tG~GKT~~a~~~~~~~  109 (206)
T d2fz4a1          91 VLPTGSGKTHVAMAAINEL  109 (206)
T ss_dssp             EESSSTTHHHHHHHHHHHS
T ss_pred             EeCCCCCceehHHhHHHHh
Confidence            4679999999877666543

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=80.82  E-value=0.24  Score=33.68  Aligned_cols=20  Identities=35%  Similarity=0.438  Sum_probs=16.7

Q ss_pred             CCCCcCCchHHHHHHHHHHH
Q psy17057          1 MAGSTMRDKTPFKLVVLLVL   20 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l   20 (80)
                      |.|++|||||-+-++++..+
T Consensus        67 ivG~nGsGKSTLl~~i~Gl~   86 (281)
T d1r0wa_          67 ITGSTGSGKTSLLMLILGEL   86 (281)
T ss_dssp             EEESTTSSHHHHHHHHHTSS
T ss_pred             EECCCCChHHHHHHHHhCCC
Confidence            35999999999999987643

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Phosphoribulokinase
species: Rhodobacter sphaeroides [TaxId: 1063]

Probab=80.81  E-value=0.17  Score=34.96  Aligned_cols=23  Identities=17%  Similarity=0.193  Sum_probs=15.7

Q ss_pred             CCCCcCCchHHHHHHHHHHHhhh
Q psy17057          1 MAGSTMRDKTPFKLVVLLVLLHE   23 (80)
Q Consensus         1 ~aG~sg~gKte~~k~~l~~l~~~   23 (80)
                      |||-||||||-.++.+...+-..
T Consensus         9 IaG~SGSGKTTva~~l~~i~~~~   31 (288)
T d1a7ja_           9 VTGSSGAGTSTVKHTFDQIFRRE   31 (288)
T ss_dssp             EESCC---CCTHHHHHHHHHHHH
T ss_pred             EECCCCCcHHHHHHHHHHHHhhc
Confidence            68999999999998877766443

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: HCV helicase domain
species: Human hepatitis C virus (HCV), different isolates [TaxId: 11103]

Probab=80.41  E-value=0.21  Score=29.10  Aligned_cols=12  Identities=17%  Similarity=-0.031  Sum_probs=9.8

Q ss_pred             CCCcCCchHHHH
Q psy17057          2 AGSTMRDKTPFK   13 (80)
Q Consensus         2 aG~sg~gKte~~   13 (80)
                      .++||+|||...
T Consensus        14 ~apTGsGKT~~~   25 (136)
T d1a1va1          14 HAPTGSGKSTKV   25 (136)
T ss_dssp             ECCTTSCTTTHH
T ss_pred             EeCCCCCHHHHH
Confidence            578999999754

>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Molybdate/tungstate import ATP-binding protein WtpC (ModC)
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=80.20  E-value=0.4  Score=32.23  Aligned_cols=18  Identities=22%  Similarity=0.218  Sum_probs=15.5

Q ss_pred             CCCcCCchHHHHHHHHHH
Q psy17057          2 AGSTMRDKTPFKLVVLLV   19 (80)
Q Consensus         2 aG~sg~gKte~~k~~l~~   19 (80)
                      -|++|||||.+-+++.-.
T Consensus        30 iGpnGaGKSTll~~i~Gl   47 (240)
T d2onka1          30 LGPTGAGKSVFLELIAGI   47 (240)
T ss_dssp             ECCTTSSHHHHHHHHHTS
T ss_pred             ECCCCChHHHHHHHHHcC
Confidence            499999999999988653