Psyllid ID: psy17073

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
VGDGTTSVVLLAGEILKQVKPYVEEGVHPRIVIKAVRKATSMALQKIDELAVKIQKSDSGEYRGLLEKCAATALSSKLIHQQKGFFSKMVVDAVMSLDDLFNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEMELSKALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLRQKHAQGRLKIL
ccccHHHHHHHHHHHHHHHHHHHHccccHHEHHHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHccccccccccccccccccccEEEEEEEEcccEEEEEEccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccc
cccccHHHHHHHHHHHHHHHHHHHccccEEEEHcHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHHEEEccccEEEEEccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccEEccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccc
VGDGTTSVVLLAGEILKqvkpyveegvhprIVIKAVRKATSMALQKIDELAVKIQKSDSGEYRGLLEKCAATALSSKLIHQQKGFFSKMVVDAVMSLDDLFNvfsgcknartcTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEMELSKALRDYSRSIAGKEQLLIGAVAKAFEViprqlsdnagfdATNILNKLRQKHAQGRLKIL
VGDGTTSVVLLAGeilkqvkpyveegvhprIVIKAVRKATSMALQKIDELAVKIQKSDSGEYRGLLEKCAATALSSKLIHQQKGFFSKMVVDAVMSLDDLFNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEMELSKALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLrqkhaqgrlkil
VGDGTTSVVLLAGEILKQVKPYVEEGVHPRIVIKAVRKATSMALQKIDELAVKIQKSDSGEYRGLLEKCAATALSSKLIHQQKGFFSKMVVDAVMSLDDLFNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEMELSKALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLRQKHAQGRLKIL
******SVVLLAGEILKQVKPYVEEGVHPRIVIKAVRKATSMALQKIDELAVKIQKSDSGEYRGLLEKCAATALSSKLIHQQKGFFSKMVVDAVMSLDDLFNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEMELSKALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILN**************
VGDGTTSVVLLAGEILKQVKPYVEEGVHPRIVIKAVRKATSMALQKIDELAVKIQKSDSGEYRGLLEKCAATALSSKLIHQQKGFFSKMVVDAVMSLDDLFNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEMELSKALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLRQKHA***L**L
VGDGTTSVVLLAGEILKQVKPYVEEGVHPRIVIKAVRKATSMALQKIDELAVKIQKSDSGEYRGLLEKCAATALSSKLIHQQKGFFSKMVVDAVMSLDDLFNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEMELSKALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLRQ**********
**DGTTSVVLLAGEILKQVKPYVEEGVHPRIVIKAVRKATSMALQKIDELAVKIQKSDSGEYRGLLEKCAATALSSKLIHQQKGFFSKMVVDAVMSLDDLFNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEMELSKALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLRQKHAQG*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VGDGTTSVVLLAGEILKQVKPYVEEGVHPRIVIKAVRKATSMALQKIDELAVKIQKSDSGEYRGLLEKCAATALSSKLIHQQKGFFSKMVVDAVMSLDDLFNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEMELSKALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLRQKHAQGRLKIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query219 2.2.26 [Sep-21-2011]
Q5ZJK8553 T-complex protein 1 subun yes N/A 0.529 0.209 0.810 2e-52
Q2NKZ1543 T-complex protein 1 subun yes N/A 0.470 0.189 0.807 1e-51
P80313544 T-complex protein 1 subun yes N/A 0.470 0.189 0.807 1e-51
Q99832543 T-complex protein 1 subun yes N/A 0.520 0.209 0.798 4e-51
Q5R5C8543 T-complex protein 1 subun yes N/A 0.520 0.209 0.798 5e-51
P87153558 Probable T-complex protei yes N/A 0.538 0.211 0.669 1e-43
Q54ER7555 T-complex protein 1 subun yes N/A 0.506 0.2 0.710 2e-43
P42943550 T-complex protein 1 subun yes N/A 0.520 0.207 0.652 1e-41
O77323539 T-complex protein 1 subun yes N/A 0.515 0.209 0.592 1e-34
P54409558 T-complex protein 1 subun N/A N/A 0.484 0.189 0.589 4e-34
>sp|Q5ZJK8|TCPH_CHICK T-complex protein 1 subunit eta OS=Gallus gallus GN=CCT7 PE=1 SV=1 Back     alignment and function desciption
 Score =  205 bits (522), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (89%)

Query: 99  DLFNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEME 158
           D +N F+GC  A+TCTII+RGGAEQF+EETERSLHDAIMIVRR I+N +VVAGGGAIEME
Sbjct: 356 DRYNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEME 415

Query: 159 LSKALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLRQKHAQG 214
           LSK LRDYSR+I GK+QLLIGA AKA E+IPRQL DNAGFDATNILNKLR KHAQG
Sbjct: 416 LSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRAKHAQG 471
Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. Known to play a role, in vitro, in the folding of actin and tubulin.
Gallus gallus (taxid: 9031)
>sp|Q2NKZ1|TCPH_BOVIN T-complex protein 1 subunit eta OS=Bos taurus GN=CCT7 PE=1 SV=1 Back     alignment and function description
>sp|P80313|TCPH_MOUSE T-complex protein 1 subunit eta OS=Mus musculus GN=Cct7 PE=1 SV=1 Back     alignment and function description
>sp|Q99832|TCPH_HUMAN T-complex protein 1 subunit eta OS=Homo sapiens GN=CCT7 PE=1 SV=2 Back     alignment and function description
>sp|Q5R5C8|TCPH_PONAB T-complex protein 1 subunit eta OS=Pongo abelii GN=CCT7 PE=2 SV=1 Back     alignment and function description
>sp|P87153|TCPH_SCHPO Probable T-complex protein 1 subunit eta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct7 PE=1 SV=1 Back     alignment and function description
>sp|Q54ER7|TCPH_DICDI T-complex protein 1 subunit eta OS=Dictyostelium discoideum GN=cct7 PE=3 SV=1 Back     alignment and function description
>sp|P42943|TCPH_YEAST T-complex protein 1 subunit eta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT7 PE=1 SV=1 Back     alignment and function description
>sp|O77323|TCPH_PLAF7 T-complex protein 1 subunit eta OS=Plasmodium falciparum (isolate 3D7) GN=MAL3P3.6 PE=3 SV=1 Back     alignment and function description
>sp|P54409|TCPH_TETPY T-complex protein 1 subunit eta OS=Tetrahymena pyriformis PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query219
28374336 422 Cct7 protein, partial [Danio rerio] 0.977 0.507 0.603 2e-74
157137026 488 chaperonin [Aedes aegypti] gi|108884249| 0.529 0.237 0.870 1e-54
170039250 542 chaperonin [Culex quinquefasciatus] gi|1 0.520 0.210 0.877 3e-54
157137024 542 chaperonin [Aedes aegypti] gi|108884248| 0.520 0.210 0.885 4e-54
347968503 542 AGAP002762-PA [Anopheles gambiae str. PE 0.520 0.210 0.877 1e-53
91093052 540 PREDICTED: similar to chaperonin [Tribol 0.520 0.211 0.877 1e-53
289739875 543 chaperonin complex component TcP-1 eta s 0.515 0.208 0.859 2e-52
332374936 540 unknown [Dendroctonus ponderosae] 0.525 0.212 0.852 2e-52
242003180 543 T-complex protein 1 subunit eta, putativ 0.520 0.209 0.833 4e-52
156405471 545 predicted protein [Nematostella vectensi 0.520 0.209 0.850 5e-52
>gi|28374336|gb|AAH45933.1| Cct7 protein, partial [Danio rerio] Back     alignment and taxonomy information
 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 176/252 (69%), Gaps = 38/252 (15%)

Query: 1   VGDGTTSVVLLAGEILKQVKPYVEEGVHPRIVIKAVRKATSMALQKIDELAVKIQKSDSG 60
           VGDGTTSV LLA E LKQ+KPYVEEG+HP+ +I+A R AT +A++KI E+AV I+K D  
Sbjct: 95  VGDGTTSVTLLAAEFLKQLKPYVEEGLHPQTIIRAFRIATQLAVKKIKEIAVTIKKDDKQ 154

Query: 61  EYRGLLEKCAATALSSKLIHQQKGFFSKMVVDAVMSLDDLF------------------N 102
           E R LLEKCAATAL+SKLI  QK FFSKMVVDAVM LDDL                    
Sbjct: 155 EQRRLLEKCAATALNSKLIAGQKDFFSKMVVDAVMMLDDLLPLKMIGVKKVQGGALEESQ 214

Query: 103 VFSGCKNARTCT--------------------IIVRGGAEQFLEETERSLHDAIMIVRRT 142
           + +G    +T +                    I +   AEQF+EET+RSLHDAIMIVRR 
Sbjct: 215 LVAGVAFKKTFSYAGFEMQPKRYMNPKIALLNIELELKAEQFMEETDRSLHDAIMIVRRA 274

Query: 143 IRNHAVVAGGGAIEMELSKALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATN 202
           I+N ++VAGGGAIEMELSK LRDYSR+I GK+QLLIGA AKA E+IPRQL DNAGFDATN
Sbjct: 275 IKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATN 334

Query: 203 ILNKLRQKHAQG 214
           ILNKLR KHAQG
Sbjct: 335 ILNKLRAKHAQG 346

Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota
>gi|157137026|ref|XP_001656982.1| chaperonin [Aedes aegypti] gi|108884249|gb|EAT48474.1| AAEL000486-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|170039250|ref|XP_001847454.1| chaperonin [Culex quinquefasciatus] gi|167862855|gb|EDS26238.1| chaperonin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157137024|ref|XP_001656981.1| chaperonin [Aedes aegypti] gi|108884248|gb|EAT48473.1| AAEL000486-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|347968503|ref|XP_312160.4| AGAP002762-PA [Anopheles gambiae str. PEST] gi|333467975|gb|EAA44880.4| AGAP002762-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|91093052|ref|XP_967459.1| PREDICTED: similar to chaperonin [Tribolium castaneum] gi|270002664|gb|EEZ99111.1| hypothetical protein TcasGA2_TC005004 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|289739875|gb|ADD18685.1| chaperonin complex component TcP-1 eta subunit CCT7 [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|332374936|gb|AEE62609.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|242003180|ref|XP_002422641.1| T-complex protein 1 subunit eta, putative [Pediculus humanus corporis] gi|212505442|gb|EEB09903.1| T-complex protein 1 subunit eta, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|156405471|ref|XP_001640755.1| predicted protein [Nematostella vectensis] gi|156227891|gb|EDO48692.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query219
FB|FBgn0037632544 Tcp-1eta "Tcp-1eta" [Drosophil 0.520 0.209 0.833 7.3e-84
UNIPROTKB|Q5ZJK8553 CCT7 "T-complex protein 1 subu 0.529 0.209 0.810 4.5e-82
UNIPROTKB|Q99832543 CCT7 "T-complex protein 1 subu 0.520 0.209 0.798 1.1e-80
UNIPROTKB|F5GZK5443 CCT7 "T-complex protein 1 subu 0.520 0.257 0.798 3.2e-75
UNIPROTKB|F6Y487411 F6Y487 "Uncharacterized protei 0.433 0.231 0.842 1.1e-72
DICTYBASE|DDB_G0291225555 cct7 "chaperonin containing TC 0.520 0.205 0.710 1.8e-68
TAIR|locus:2081491557 AT3G11830 [Arabidopsis thalian 0.511 0.201 0.723 3.7e-68
CGD|CAL0003198549 CCT7 [Candida albicans (taxid: 0.534 0.213 0.658 1.1e-66
SGD|S000003647550 CCT7 "Subunit of the cytosolic 0.520 0.207 0.657 1.4e-66
UNIPROTKB|B8ZZC9501 CCT7 "T-complex protein 1 subu 0.520 0.227 0.798 1.1e-64
FB|FBgn0037632 Tcp-1eta "Tcp-1eta" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 488 (176.8 bits), Expect = 7.3e-84, Sum P(2) = 7.3e-84
 Identities = 95/114 (83%), Positives = 105/114 (92%)

Query:   101 FNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEMELS 160
             FN+F GC NA+T T+I+RGGAEQFLEETERSLHDAIMIVRRTI++ +VVAGGGAIEMELS
Sbjct:   357 FNLFQGCPNAKTSTLILRGGAEQFLEETERSLHDAIMIVRRTIKHDSVVAGGGAIEMELS 416

Query:   161 KALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLRQKHAQG 214
             K LRDYSR+IAGKEQLLI A+AK  E+IPRQL DNAGFDATNILNKLRQKHAQG
Sbjct:   417 KLLRDYSRTIAGKEQLLIAAIAKGLEIIPRQLCDNAGFDATNILNKLRQKHAQG 470
GO:0006457 "protein folding" evidence=ISS
GO:0042623 "ATPase activity, coupled" evidence=ISS
GO:0005832 "chaperonin-containing T-complex" evidence=ISS
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0031122 "cytoplasmic microtubule organization" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|Q5ZJK8 CCT7 "T-complex protein 1 subunit eta" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q99832 CCT7 "T-complex protein 1 subunit eta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5GZK5 CCT7 "T-complex protein 1 subunit eta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y487 F6Y487 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291225 cct7 "chaperonin containing TCP1 eta subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2081491 AT3G11830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0003198 CCT7 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
SGD|S000003647 CCT7 "Subunit of the cytosolic chaperonin Cct ring complex" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|B8ZZC9 CCT7 "T-complex protein 1 subunit eta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5ZJK8TCPH_CHICKNo assigned EC number0.81030.52960.2097yesN/A
P42943TCPH_YEASTNo assigned EC number0.65210.52050.2072yesN/A
O77323TCPH_PLAF7No assigned EC number0.59290.51590.2096yesN/A
Q5R5C8TCPH_PONABNo assigned EC number0.79820.52050.2099yesN/A
Q2NKZ1TCPH_BOVINNo assigned EC number0.80700.47030.1896yesN/A
P80313TCPH_MOUSENo assigned EC number0.80700.47030.1893yesN/A
Q99832TCPH_HUMANNo assigned EC number0.79820.52050.2099yesN/A
Q54ER7TCPH_DICDINo assigned EC number0.71050.50680.2yesN/A
P87153TCPH_SCHPONo assigned EC number0.66940.53880.2114yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query219
cd03340522 cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type I 1e-72
TIGR02345523 TIGR02345, chap_CCT_eta, T-complex protein 1, eta 2e-60
cd03340 522 cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type I 3e-50
cd00309464 cd00309, chaperonin_type_I_II, chaperonin families 3e-49
TIGR02345 523 TIGR02345, chap_CCT_eta, T-complex protein 1, eta 2e-41
pfam00118481 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin fami 7e-37
cd03343517 cd03343, cpn60, cpn60 chaperonin family 9e-37
COG0459524 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Po 5e-35
TIGR02339519 TIGR02339, thermosome_arch, thermosome, various su 1e-34
cd03337480 cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type 4e-33
cd03335527 cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type 4e-32
PTZ00212533 PTZ00212, PTZ00212, T-complex protein 1 subunit be 6e-32
cd03338515 cd03338, TCP1_delta, TCP-1 (CTT or eukaryotic type 1e-31
cd03336517 cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type 2e-31
cd00309 464 cd00309, chaperonin_type_I_II, chaperonin families 2e-30
TIGR02344525 TIGR02344, chap_CCT_gamma, T-complex protein 1, ga 2e-30
TIGR02340536 TIGR02340, chap_CCT_alpha, T-complex protein 1, al 7e-29
TIGR02342517 TIGR02342, chap_CCT_delta, T-complex protein 1, de 3e-28
TIGR02341518 TIGR02341, chap_CCT_beta, T-complex protein 1, bet 8e-28
cd03341472 cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type 1e-24
TIGR02346531 TIGR02346, chap_CCT_theta, T-complex protein 1, th 4e-24
cd03339526 cd03339, TCP1_epsilon, TCP-1 (CTT or eukaryotic ty 5e-24
pfam00118 481 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin fami 2e-22
PTZ00212 533 PTZ00212, PTZ00212, T-complex protein 1 subunit be 3e-21
TIGR02343532 TIGR02343, chap_CCT_epsi, T-complex protein 1, eps 4e-21
cd03343 517 cd03343, cpn60, cpn60 chaperonin family 1e-20
cd03342484 cd03342, TCP1_zeta, TCP-1 (CTT or eukaryotic type 3e-20
cd03336 517 cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type 4e-20
COG0459 524 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Po 9e-20
TIGR02347531 TIGR02347, chap_CCT_zeta, T-complex protein 1, zet 3e-19
cd03337 480 cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type 6e-19
TIGR02339 519 TIGR02339, thermosome_arch, thermosome, various su 2e-17
TIGR02342 517 TIGR02342, chap_CCT_delta, T-complex protein 1, de 2e-17
cd03335 527 cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type 3e-17
cd03338 515 cd03338, TCP1_delta, TCP-1 (CTT or eukaryotic type 5e-17
TIGR02340 536 TIGR02340, chap_CCT_alpha, T-complex protein 1, al 1e-16
TIGR02344 525 TIGR02344, chap_CCT_gamma, T-complex protein 1, ga 2e-16
TIGR02341 518 TIGR02341, chap_CCT_beta, T-complex protein 1, bet 3e-16
cd03339 526 cd03339, TCP1_epsilon, TCP-1 (CTT or eukaryotic ty 7e-16
TIGR02347 531 TIGR02347, chap_CCT_zeta, T-complex protein 1, zet 7e-16
cd03342 484 cd03342, TCP1_zeta, TCP-1 (CTT or eukaryotic type 2e-15
TIGR02343 532 TIGR02343, chap_CCT_epsi, T-complex protein 1, eps 5e-14
cd03333209 cd03333, chaperonin_like, chaperonin_like superfam 5e-14
cd03341 472 cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type 8e-12
TIGR02346 531 TIGR02346, chap_CCT_theta, T-complex protein 1, th 1e-09
cd03344 520 cd03344, GroEL, GroEL_like type I chaperonin 4e-04
cd03333209 cd03333, chaperonin_like, chaperonin_like superfam 0.001
CHL00093 529 CHL00093, groEL, chaperonin GroEL 0.003
>gnl|CDD|239456 cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit Back     alignment and domain information 
 Score =  229 bits (585), Expect = 1e-72
 Identities = 91/114 (79%), Positives = 104/114 (91%)

Query: 101 FNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEMELS 160
           +N+F+GC  A+TCTII+RGGAEQF+EE ERSLHDAIMIVRR I+N +VVAGGGAIEMELS
Sbjct: 354 YNIFTGCPKAKTCTIILRGGAEQFIEEAERSLHDAIMIVRRAIKNDSVVAGGGAIEMELS 413

Query: 161 KALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLRQKHAQG 214
           K LRDYSR+IAGK+QL+I A AKA E+IPRQL DNAGFDAT+ILNKLRQKHAQG
Sbjct: 414 KYLRDYSRTIAGKQQLVINAFAKALEIIPRQLCDNAGFDATDILNKLRQKHAQG 467

Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin. Length = 522
>gnl|CDD|200176 TIGR02345, chap_CCT_eta, T-complex protein 1, eta subunit Back     alignment and domain information
>gnl|CDD|239456 cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit Back     alignment and domain information
>gnl|CDD|238189 cd00309, chaperonin_type_I_II, chaperonin families, type I and type II Back     alignment and domain information
>gnl|CDD|200176 TIGR02345, chap_CCT_eta, T-complex protein 1, eta subunit Back     alignment and domain information
>gnl|CDD|215730 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin family Back     alignment and domain information
>gnl|CDD|239459 cd03343, cpn60, cpn60 chaperonin family Back     alignment and domain information
>gnl|CDD|223535 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233823 TIGR02339, thermosome_arch, thermosome, various subunits, archaeal Back     alignment and domain information
>gnl|CDD|239453 cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit Back     alignment and domain information
>gnl|CDD|239451 cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit Back     alignment and domain information
>gnl|CDD|185514 PTZ00212, PTZ00212, T-complex protein 1 subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|239454 cd03338, TCP1_delta, TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit Back     alignment and domain information
>gnl|CDD|239452 cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit Back     alignment and domain information
>gnl|CDD|238189 cd00309, chaperonin_type_I_II, chaperonin families, type I and type II Back     alignment and domain information
>gnl|CDD|233825 TIGR02344, chap_CCT_gamma, T-complex protein 1, gamma subunit Back     alignment and domain information
>gnl|CDD|131393 TIGR02340, chap_CCT_alpha, T-complex protein 1, alpha subunit Back     alignment and domain information
>gnl|CDD|233824 TIGR02342, chap_CCT_delta, T-complex protein 1, delta subunit Back     alignment and domain information
>gnl|CDD|211733 TIGR02341, chap_CCT_beta, T-complex protein 1, beta subunit Back     alignment and domain information
>gnl|CDD|239457 cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit Back     alignment and domain information
>gnl|CDD|233826 TIGR02346, chap_CCT_theta, T-complex protein 1, theta subunit Back     alignment and domain information
>gnl|CDD|239455 cd03339, TCP1_epsilon, TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit Back     alignment and domain information
>gnl|CDD|215730 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin family Back     alignment and domain information
>gnl|CDD|185514 PTZ00212, PTZ00212, T-complex protein 1 subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|131396 TIGR02343, chap_CCT_epsi, T-complex protein 1, epsilon subunit Back     alignment and domain information
>gnl|CDD|239459 cd03343, cpn60, cpn60 chaperonin family Back     alignment and domain information
>gnl|CDD|239458 cd03342, TCP1_zeta, TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit Back     alignment and domain information
>gnl|CDD|239452 cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit Back     alignment and domain information
>gnl|CDD|223535 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233827 TIGR02347, chap_CCT_zeta, T-complex protein 1, zeta subunit Back     alignment and domain information
>gnl|CDD|239453 cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit Back     alignment and domain information
>gnl|CDD|233823 TIGR02339, thermosome_arch, thermosome, various subunits, archaeal Back     alignment and domain information
>gnl|CDD|233824 TIGR02342, chap_CCT_delta, T-complex protein 1, delta subunit Back     alignment and domain information
>gnl|CDD|239451 cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit Back     alignment and domain information
>gnl|CDD|239454 cd03338, TCP1_delta, TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit Back     alignment and domain information
>gnl|CDD|131393 TIGR02340, chap_CCT_alpha, T-complex protein 1, alpha subunit Back     alignment and domain information
>gnl|CDD|233825 TIGR02344, chap_CCT_gamma, T-complex protein 1, gamma subunit Back     alignment and domain information
>gnl|CDD|211733 TIGR02341, chap_CCT_beta, T-complex protein 1, beta subunit Back     alignment and domain information
>gnl|CDD|239455 cd03339, TCP1_epsilon, TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit Back     alignment and domain information
>gnl|CDD|233827 TIGR02347, chap_CCT_zeta, T-complex protein 1, zeta subunit Back     alignment and domain information
>gnl|CDD|239458 cd03342, TCP1_zeta, TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit Back     alignment and domain information
>gnl|CDD|131396 TIGR02343, chap_CCT_epsi, T-complex protein 1, epsilon subunit Back     alignment and domain information
>gnl|CDD|239449 cd03333, chaperonin_like, chaperonin_like superfamily Back     alignment and domain information
>gnl|CDD|239457 cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit Back     alignment and domain information
>gnl|CDD|233826 TIGR02346, chap_CCT_theta, T-complex protein 1, theta subunit Back     alignment and domain information
>gnl|CDD|239460 cd03344, GroEL, GroEL_like type I chaperonin Back     alignment and domain information
>gnl|CDD|239449 cd03333, chaperonin_like, chaperonin_like superfamily Back     alignment and domain information
>gnl|CDD|177025 CHL00093, groEL, chaperonin GroEL Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 219
KOG0361|consensus543 100.0
KOG0363|consensus527 100.0
cd03336517 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaper 100.0
cd03342484 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaper 100.0
cd03337480 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chape 100.0
PTZ00212533 T-complex protein 1 subunit beta; Provisional 100.0
cd03335527 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chape 100.0
TIGR02344525 chap_CCT_gamma T-complex protein 1, gamma subunit. 100.0
cd03340522 TCP1_eta TCP-1 (CTT or eukaryotic type II) chapero 100.0
TIGR02347531 chap_CCT_zeta T-complex protein 1, zeta subunit. M 100.0
KOG0358|consensus534 100.0
TIGR02341519 chap_CCT_beta T-complex protein 1, beta subunit. M 100.0
TIGR02342517 chap_CCT_delta T-complex protein 1, delta subunit. 100.0
TIGR02339519 thermosome_arch thermosome, various subunits, arch 100.0
TIGR02345522 chap_CCT_eta T-complex protein 1, eta subunit. Mem 100.0
cd03338515 TCP1_delta TCP-1 (CTT or eukaryotic type II) chape 100.0
TIGR02340536 chap_CCT_alpha T-complex protein 1, alpha subunit. 100.0
cd03339526 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) cha 100.0
TIGR02343532 chap_CCT_epsi T-complex protein 1, epsilon subunit 100.0
cd03343517 cpn60 cpn60 chaperonin family. Chaperonins are inv 100.0
TIGR02346531 chap_CCT_theta T-complex protein 1, theta subunit. 100.0
cd00309464 chaperonin_type_I_II chaperonin families, type I a 100.0
cd03341472 TCP1_theta TCP-1 (CTT or eukaryotic type II) chape 100.0
PRK12849542 groEL chaperonin GroEL; Reviewed 100.0
COG0459524 GroL Chaperonin GroEL (HSP60 family) [Posttranslat 100.0
cd03344520 GroEL GroEL_like type I chaperonin. Chaperonins ar 100.0
KOG0364|consensus527 100.0
PRK00013542 groEL chaperonin GroEL; Reviewed 100.0
PRK12850544 groEL chaperonin GroEL; Reviewed 100.0
PTZ00114555 Heat shock protein 60; Provisional 100.0
PRK12852545 groEL chaperonin GroEL; Reviewed 100.0
PRK12851541 groEL chaperonin GroEL; Reviewed 100.0
TIGR02348524 GroEL chaperonin GroL. This family consists of Gro 100.0
PF00118485 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperon 100.0
CHL00093529 groEL chaperonin GroEL 100.0
PRK14104546 chaperonin GroEL; Provisional 100.0
PLN03167600 Chaperonin-60 beta subunit; Provisional 100.0
KOG0360|consensus545 100.0
KOG0357|consensus400 100.0
KOG0359|consensus520 100.0
KOG0362|consensus537 100.0
KOG0356|consensus550 99.95
cd03333209 chaperonin_like chaperonin_like superfamily. Chape 99.4
cd03334261 Fab1_TCP TCP-1 like domain of the eukaryotic phosp 98.81
KOG0230|consensus 1598 80.02
>KOG0361|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.1e-54  Score=377.60  Aligned_cols=216  Identities=73%  Similarity=1.092  Sum_probs=208.1

Q ss_pred             CCCChhhHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHhhcccccCCCchhhHHHHHHHHHHhhhhhcch
Q psy17073          1 VGDGTTSVVLLAGEILKQVKPYVEEGVHPRIVIKAVRKATSMALQKIDELAVKIQKSDSGEYRGLLEKCAATALSSKLIH   80 (219)
Q Consensus         1 vGDGTTsvvvLa~~ll~~a~~li~~gihP~~Ii~g~~~a~~~~l~~L~~~s~~v~~~~~~~~~~~l~~va~tsl~sK~~~   80 (219)
                      |||||||||+||+|+|+++..+++.|+||..|+++|+.|...+++.+++++++++..+..+.++.|.++|.|+++||++.
T Consensus        90 VGDGTTSVv~la~E~lk~~Kpfiedgv~~~~iir~~rka~~l~v~ki~elav~i~~~~~~~~r~lL~KcA~T~lsSKlI~  169 (543)
T KOG0361|consen   90 VGDGTTSVVLLAAEFLKEAKPFIEDGVHPQLIIRAYRKARQLAVEKIKELAVEIDGSSKTELRELLEKCAATALSSKLIR  169 (543)
T ss_pred             ccCCceeEeeeHHHHHHhhhhHhhcCCCHHHHHHHHHHHHHHHHHHHHHheeEecccchhhHHHHHHHHHHHHhhhhhhh
Confidence            79999999999999999999999999999999999999999999999999999886666677899999999999999999


Q ss_pred             hhhchhHHHHHHHHHhhccc------------------------------------------------------------
Q psy17073         81 QQKGFFSKMVVDAVMSLDDL------------------------------------------------------------  100 (219)
Q Consensus        81 ~~~~~i~~l~~~Av~~v~~~------------------------------------------------------------  100 (219)
                      ++.++|++|++||+..+++.                                                            
T Consensus       170 ~ek~fF~~MvVDAV~~ld~~l~~~mIGIKKV~GG~~~dS~lv~GVAFkKtFsYAGfEqqPKk~~NpkIl~LnvELElKaE  249 (543)
T KOG0361|consen  170 QEKEFFAKMVVDAVLTLDNDLDLNMIGIKKVPGGAMEDSLLVNGVAFKKTFSYAGFEQQPKKFLNPKILLLNVELELKAE  249 (543)
T ss_pred             hhHHHHHHHHHHHHHhhccccchhhcceeecCCCccchhhhccceeeeehccccchhhCccccCCceEEEEeeeeeeccc
Confidence            99999999999999987520                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q psy17073        101 --------------------------------------------------------------------------------  100 (219)
Q Consensus       101 --------------------------------------------------------------------------------  100 (219)
                                                                                                      
T Consensus       250 kdNAEiRv~~v~eyQ~iVDAEW~Ii~~KL~ki~~sGAnVVLSkLpIGD~ATQyFAdrdiFCAGRV~~eDl~Rv~~acGGs  329 (543)
T KOG0361|consen  250 KDNAEIRVDNVEEYQAIVDAEWNIIYDKLDKIHESGANVVLSKLPIGDLATQYFADRDIFCAGRVPEEDLNRVMQACGGS  329 (543)
T ss_pred             ccCceeecCCHHHHHHHHhHHHHHHHHHHHHHHhcCCeEEEecccchHHHHHHhhccCceecCcCCHHHHHHHHHhcCcc
Confidence                                                                                            


Q ss_pred             ----------------------------eeEEecccCCceEEEEecCCCHHHHHHHHHHHHHHHHHHHHHHHcCcccccc
Q psy17073        101 ----------------------------FNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGG  152 (219)
Q Consensus       101 ----------------------------~~~~~~~~~~~~~tI~irg~t~~~l~E~er~i~dal~v~~~~~~~~~~v~GG  152 (219)
                                                  |.||+||+..++||+++||+-++.++|.||++|||++++|.++++..+|+||
T Consensus       330 i~tt~~~i~~~~LG~C~~FeE~QvG~eRyN~Fegcp~aktcTliLRGgaeqfieE~eRSlHDAImIVrralkn~~vVaGG  409 (543)
T KOG0361|consen  330 IQTTVSDIKEEVLGTCALFEERQVGGERYNLFEGCPKAKTCTLILRGGAEQFIEETERSLHDAIMIVRRALKNDSVVAGG  409 (543)
T ss_pred             hhhhhhhcchhhcchhhhHHHHhhcchhhhhhcCCCccceeEEEEeccHHHHHHHHhhhhhhHHHHHHHHhccCcEeeCC
Confidence                                        9999999999999999999999999999999999999999999999999999


Q ss_pred             cHHHHHHHHHHHHHhcccchHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHhcCCC
Q psy17073        153 GAIEMELSKALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLRQKHAQGRL  216 (219)
Q Consensus       153 G~~e~~l~~~l~~~~~~~~~~~~~~~~~~a~al~~ip~~L~~NaG~d~~~~~~~l~~~h~~~~~  216 (219)
                      |++||+||+.|++|+.++.+++|+.+.+|++|||.|||+|++|+|+|..+++.+||.+|++|.+
T Consensus       410 GaiEMElSk~lRd~S~ti~gK~q~~i~A~akalEvIPrqLc~NaGfDa~~ilnkLR~rHA~G~~  473 (543)
T KOG0361|consen  410 GAIEMELSKYLRDYSRTIAGKQQLFINAYAKALEVIPRQLCDNAGFDATNILNKLRQRHAQGEK  473 (543)
T ss_pred             ceeeehHHHHHHHhhcccCcHHHHHHHHHHHHHHHhHHHHhhhcCCcHHHHHHHHHHHhhcCCc
Confidence            9999999999999999999999999999999999999999999999999999999999999865

>KOG0363|consensus Back     alignment and domain information
>cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit Back     alignment and domain information
>cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit Back     alignment and domain information
>cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit Back     alignment and domain information
>PTZ00212 T-complex protein 1 subunit beta; Provisional Back     alignment and domain information
>cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit Back     alignment and domain information
>TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit Back     alignment and domain information
>cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit Back     alignment and domain information
>TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit Back     alignment and domain information
>KOG0358|consensus Back     alignment and domain information
>TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit Back     alignment and domain information
>TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit Back     alignment and domain information
>TIGR02339 thermosome_arch thermosome, various subunits, archaeal Back     alignment and domain information
>TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit Back     alignment and domain information
>cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit Back     alignment and domain information
>TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit Back     alignment and domain information
>cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit Back     alignment and domain information
>TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit Back     alignment and domain information
>cd03343 cpn60 cpn60 chaperonin family Back     alignment and domain information
>TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit Back     alignment and domain information
>cd00309 chaperonin_type_I_II chaperonin families, type I and type II Back     alignment and domain information
>cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit Back     alignment and domain information
>PRK12849 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03344 GroEL GroEL_like type I chaperonin Back     alignment and domain information
>KOG0364|consensus Back     alignment and domain information
>PRK00013 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12850 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PTZ00114 Heat shock protein 60; Provisional Back     alignment and domain information
>PRK12852 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12851 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>TIGR02348 GroEL chaperonin GroL Back     alignment and domain information
>PF00118 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperonins cpn60 signature Chaperonins TCP-1 signatures 60 kd chaperonin signature; InterPro: IPR002423 Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism Back     alignment and domain information
>CHL00093 groEL chaperonin GroEL Back     alignment and domain information
>PRK14104 chaperonin GroEL; Provisional Back     alignment and domain information
>PLN03167 Chaperonin-60 beta subunit; Provisional Back     alignment and domain information
>KOG0360|consensus Back     alignment and domain information
>KOG0357|consensus Back     alignment and domain information
>KOG0359|consensus Back     alignment and domain information
>KOG0362|consensus Back     alignment and domain information
>KOG0356|consensus Back     alignment and domain information
>cd03333 chaperonin_like chaperonin_like superfamily Back     alignment and domain information
>cd03334 Fab1_TCP TCP-1 like domain of the eukaryotic phosphatidylinositol 3-phosphate (PtdIns3P) 5-kinase Fab1 Back     alignment and domain information
>KOG0230|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query219
3iyg_H515 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 1e-52
3p9d_G550 The Crystal Structure Of Yeast Cct Reveals Intrinsi 1e-42
1a6d_A545 Thermosome From T. Acidophilum Length = 545 2e-25
3iyg_D518 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 3e-24
3p9d_B527 The Crystal Structure Of Yeast Cct Reveals Intrinsi 6e-24
3izk_A491 Mm-Cpn Rls Deltalid With Atp Length = 491 1e-23
3iyf_A521 Atomic Model Of The Lidless Mm-Cpn In The Open Stat 1e-23
3izn_A491 Mm-Cpn Deltalid With Atp Length = 491 1e-23
3los_A543 Atomic Model Of Mm-Cpn In The Closed State Length = 1e-23
3rus_A543 Crystal Structure Of Cpn-Rls In Complex With Adp Fr 1e-23
3izi_A513 Mm-Cpn Rls With Atp Length = 513 1e-23
3izh_A513 Mm-Cpn D386a With Atp Length = 513 1e-23
3ko1_A553 Cystal Structure Of Thermosome From Acidianus Tengc 8e-23
3iyg_G515 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 1e-22
3j02_A491 Lidless D386a Mm-Cpn In The Pre-Hydrolysis Atp-Boun 1e-22
1q2v_A548 Crystal Structure Of The Chaperonin From Thermococc 8e-22
1q3r_A548 Crystal Structure Of The Chaperonin From Thermococc 8e-22
1q3s_A548 Crystal Structure Of The Chaperonin From Thermococc 9e-22
3iyg_B513 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 2e-21
3aq1_B500 Open State Monomer Of A Group Ii Chaperonin From Me 5e-21
3p9d_D528 The Crystal Structure Of Yeast Cct Reveals Intrinsi 2e-20
3p9d_C590 The Crystal Structure Of Yeast Cct Reveals Intrinsi 4e-19
3iyg_A529 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 5e-19
3p9d_A559 The Crystal Structure Of Yeast Cct Reveals Intrinsi 2e-18
3iyg_E515 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 5e-18
1a6d_B543 Thermosome From T. Acidophilum Length = 543 6e-18
3iyg_Q512 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 3e-16
3iyg_Z517 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 3e-15
3p9d_E562 The Crystal Structure Of Yeast Cct Reveals Intrinsi 4e-14
3p9d_H568 The Crystal Structure Of Yeast Cct Reveals Intrinsi 1e-12
3p9d_F 546 The Crystal Structure Of Yeast Cct Reveals Intrinsi 2e-11
3p9d_F546 The Crystal Structure Of Yeast Cct Reveals Intrinsi 1e-09
>pdb|3IYG|H Chain H, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515 Back     alignment and structure 
Iteration: 1

 Score =  202 bits (514), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 92/114 (80%), Positives = 103/114 (90%)
Query: 101 FNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEMELS 160
           +N F+GC  A+TCTII+RGGAEQF+EETERSLHDAIMIVRR I+N +VVAGGGAIEMELS
Sbjct: 349 YNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELS 408
Query: 161 KALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLRQKHAQG 214
           K LRDYSR+I GK+QLLIGA AKA E+IPRQL DNAGFDATNILNKLR +HAQG
Sbjct: 409 KYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQG 462
>pdb|3P9D|G Chain G, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 550 Back     alignment and structure
>pdb|1A6D|A Chain A, Thermosome From T. Acidophilum Length = 545 Back     alignment and structure
>pdb|3IYG|D Chain D, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 518 Back     alignment and structure
>pdb|3P9D|B Chain B, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 527 Back     alignment and structure
>pdb|3IZK|A Chain A, Mm-Cpn Rls Deltalid With Atp Length = 491 Back     alignment and structure
>pdb|3IYF|A Chain A, Atomic Model Of The Lidless Mm-Cpn In The Open State Length = 521 Back     alignment and structure
>pdb|3IZN|A Chain A, Mm-Cpn Deltalid With Atp Length = 491 Back     alignment and structure
>pdb|3LOS|A Chain A, Atomic Model Of Mm-Cpn In The Closed State Length = 543 Back     alignment and structure
>pdb|3RUS|A Chain A, Crystal Structure Of Cpn-Rls In Complex With Adp From Methanococcus Maripaludis Length = 543 Back     alignment and structure
>pdb|3IZI|A Chain A, Mm-Cpn Rls With Atp Length = 513 Back     alignment and structure
>pdb|3IZH|A Chain A, Mm-Cpn D386a With Atp Length = 513 Back     alignment and structure
>pdb|3KO1|A Chain A, Cystal Structure Of Thermosome From Acidianus Tengchongensis Strain S5 Length = 553 Back     alignment and structure
>pdb|3IYG|G Chain G, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515 Back     alignment and structure
>pdb|3J02|A Chain A, Lidless D386a Mm-Cpn In The Pre-Hydrolysis Atp-Bound State Length = 491 Back     alignment and structure
>pdb|1Q2V|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Nucleotide-Free Form) Length = 548 Back     alignment and structure
>pdb|1Q3R|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Nucleotide-Free Form Of Single Mutant) Length = 548 Back     alignment and structure
>pdb|1Q3S|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Formiii Crystal Complexed With Adp) Length = 548 Back     alignment and structure
>pdb|3IYG|B Chain B, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 513 Back     alignment and structure
>pdb|3AQ1|B Chain B, Open State Monomer Of A Group Ii Chaperonin From Methanococcoides Burtonii Length = 500 Back     alignment and structure
>pdb|3P9D|D Chain D, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 528 Back     alignment and structure
>pdb|3P9D|C Chain C, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 590 Back     alignment and structure
>pdb|3IYG|A Chain A, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 529 Back     alignment and structure
>pdb|3P9D|A Chain A, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 559 Back     alignment and structure
>pdb|3IYG|E Chain E, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515 Back     alignment and structure
>pdb|1A6D|B Chain B, Thermosome From T. Acidophilum Length = 543 Back     alignment and structure
>pdb|3IYG|Q Chain Q, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 512 Back     alignment and structure
>pdb|3IYG|Z Chain Z, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 517 Back     alignment and structure
>pdb|3P9D|E Chain E, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 562 Back     alignment and structure
>pdb|3P9D|H Chain H, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 568 Back     alignment and structure
>pdb|3P9D|F Chain F, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 546 Back     alignment and structure
>pdb|3P9D|F Chain F, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 546 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query219
3iyg_B513 T-complex protein 1 subunit beta; TRIC/CCT, asymme 1e-61
3iyg_B 513 T-complex protein 1 subunit beta; TRIC/CCT, asymme 6e-37
3aq1_B500 Thermosome subunit; group II chaperonin, protein f 4e-61
3aq1_B 500 Thermosome subunit; group II chaperonin, protein f 4e-36
3p9d_B527 T-complex protein 1 subunit beta; HSP60, eukaryoti 5e-61
3p9d_B 527 T-complex protein 1 subunit beta; HSP60, eukaryoti 3e-35
3iyg_H515 T-complex protein 1 subunit ETA; TRIC/CCT, asymmet 5e-61
3iyg_H 515 T-complex protein 1 subunit ETA; TRIC/CCT, asymmet 4e-39
3p9d_G550 T-complex protein 1 subunit ETA; HSP60, eukaryotic 8e-61
3p9d_G 550 T-complex protein 1 subunit ETA; HSP60, eukaryotic 2e-36
3p9d_E562 T-complex protein 1 subunit epsilon; HSP60, eukary 8e-61
3p9d_E 562 T-complex protein 1 subunit epsilon; HSP60, eukary 2e-37
1a6d_B543 Thermosome (beta subunit); group II chaperonin, CC 2e-60
1a6d_B 543 Thermosome (beta subunit); group II chaperonin, CC 6e-36
3iyg_A529 T-complex protein 1 subunit alpha; TRIC/CCT, asymm 2e-60
3iyg_A 529 T-complex protein 1 subunit alpha; TRIC/CCT, asymm 3e-33
1a6d_A545 Thermosome (alpha subunit); group II chaperonin, C 4e-60
1a6d_A 545 Thermosome (alpha subunit); group II chaperonin, C 3e-34
3iyg_E515 T-complex protein 1 subunit; TRIC/CCT, asymmetric, 4e-60
3iyg_E 515 T-complex protein 1 subunit; TRIC/CCT, asymmetric, 1e-34
3p9d_A559 T-complex protein 1 subunit alpha; HSP60, eukaryot 5e-60
3p9d_A 559 T-complex protein 1 subunit alpha; HSP60, eukaryot 2e-33
3iyg_G515 T-complex protein 1 subunit gamma; TRIC/CCT, asymm 1e-59
3iyg_G 515 T-complex protein 1 subunit gamma; TRIC/CCT, asymm 2e-36
3ruv_A543 Chaperonin, CPN; double-ring, protein folding mach 3e-59
3ruv_A 543 Chaperonin, CPN; double-ring, protein folding mach 2e-35
1q3q_A548 Thermosome alpha subunit; chaperone, chaperonin; H 4e-59
1q3q_A 548 Thermosome alpha subunit; chaperone, chaperonin; H 2e-36
3ko1_A553 Chaperonin; 9-fold symmetry, double ring, ATP hydr 7e-59
3ko1_A 553 Chaperonin; 9-fold symmetry, double ring, ATP hydr 2e-35
3iyg_D518 T-complex protein 1 subunit delta; TRIC/CCT, asymm 3e-58
3iyg_D 518 T-complex protein 1 subunit delta; TRIC/CCT, asymm 2e-35
3p9d_D528 T-complex protein 1 subunit delta; HSP60, eukaryot 1e-57
3p9d_D 528 T-complex protein 1 subunit delta; HSP60, eukaryot 8e-36
3iyg_Z517 T-complex protein 1 subunit zeta; TRIC/CCT, asymme 1e-56
3iyg_Z 517 T-complex protein 1 subunit zeta; TRIC/CCT, asymme 2e-34
3iyg_Q512 T-complex protein 1 subunit theta; TRIC/CCT, asymm 3e-56
3iyg_Q 512 T-complex protein 1 subunit theta; TRIC/CCT, asymm 8e-30
3p9d_H568 T-complex protein 1 subunit theta; HSP60, eukaryot 3e-54
3p9d_H 568 T-complex protein 1 subunit theta; HSP60, eukaryot 8e-30
3p9d_F546 T-complex protein 1 subunit zeta; HSP60, eukaryoti 4e-54
3p9d_F 546 T-complex protein 1 subunit zeta; HSP60, eukaryoti 8e-35
3p9d_C590 T-complex protein 1 subunit gamma; HSP60, eukaryot 1e-36
3p9d_C 590 T-complex protein 1 subunit gamma; HSP60, eukaryot 2e-34
1gml_A178 T-complex protein 1 subunit gamma; chaperone, chap 1e-07
1we3_A543 CPN60(groel); chaperonin, chaperone, groel, HSP60, 3e-05
1kp8_A547 Groel protein; chaperonin, assisted protein foldin 8e-04
>3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A Length = 513 Back     alignment and structure
 Score =  199 bits (509), Expect = 1e-61
 Identities = 43/117 (36%), Positives = 74/117 (63%)

Query: 98  DDLFNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEM 157
           +D    FSG      CTI++RG  +Q L+E ERSLHDA+ ++ +T+++   V GGG  EM
Sbjct: 343 EDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEM 402

Query: 158 ELSKALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLRQKHAQG 214
            ++ A+   +    GKE + + + AKA  ++P  ++DNAG+D+ +++ +LR  H++G
Sbjct: 403 LMAHAVTQLASRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEG 459
>3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A Length = 513 Back     alignment and structure
>3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} Length = 500 Back     alignment and structure
>3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} Length = 500 Back     alignment and structure
>3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* Length = 527 Back     alignment and structure
>3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* Length = 527 Back     alignment and structure
>3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 Back     alignment and structure
>3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 Back     alignment and structure
>3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* Length = 550 Back     alignment and structure
>3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* Length = 550 Back     alignment and structure
>3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* Length = 562 Back     alignment and structure
>3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* Length = 562 Back     alignment and structure
>1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B Length = 543 Back     alignment and structure
>1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B Length = 543 Back     alignment and structure
>3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 529 Back     alignment and structure
>3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 529 Back     alignment and structure
>1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* Length = 545 Back     alignment and structure
>1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* Length = 545 Back     alignment and structure
>3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 Back     alignment and structure
>3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 Back     alignment and structure
>3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* Length = 559 Back     alignment and structure
>3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* Length = 559 Back     alignment and structure
>3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 Back     alignment and structure
>3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 Back     alignment and structure
>3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A Length = 543 Back     alignment and structure
>3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A Length = 543 Back     alignment and structure
>1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A Length = 548 Back     alignment and structure
>1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A Length = 548 Back     alignment and structure
>3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} Length = 553 Back     alignment and structure
>3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} Length = 553 Back     alignment and structure
>3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 518 Back     alignment and structure
>3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 518 Back     alignment and structure
>3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* Length = 528 Back     alignment and structure
>3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* Length = 528 Back     alignment and structure
>3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 517 Back     alignment and structure
>3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 517 Back     alignment and structure
>3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 512 Back     alignment and structure
>3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 512 Back     alignment and structure
>3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* Length = 568 Back     alignment and structure
>3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* Length = 568 Back     alignment and structure
>3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* Length = 546 Back     alignment and structure
>3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* Length = 546 Back     alignment and structure
>3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 2bbm_B 2bbn_B Length = 590 Back     alignment and structure
>3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 2bbm_B 2bbn_B Length = 590 Back     alignment and structure
>1gml_A T-complex protein 1 subunit gamma; chaperone, chaperonin, actin, tubulin; 2.2A {Mus musculus} SCOP: c.8.5.2 PDB: 1gn1_A Length = 178 Back     alignment and structure
>1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* Length = 543 Back     alignment and structure
>1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... Length = 547 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query219
3iyg_A529 T-complex protein 1 subunit alpha; TRIC/CCT, asymm 100.0
3iyg_H515 T-complex protein 1 subunit ETA; TRIC/CCT, asymmet 100.0
3ko1_A553 Chaperonin; 9-fold symmetry, double ring, ATP hydr 100.0
3ruv_A543 Chaperonin, CPN; double-ring, protein folding mach 100.0
3aq1_B500 Thermosome subunit; group II chaperonin, protein f 100.0
3iyg_B513 T-complex protein 1 subunit beta; TRIC/CCT, asymme 100.0
3iyg_D518 T-complex protein 1 subunit delta; TRIC/CCT, asymm 100.0
3iyg_G515 T-complex protein 1 subunit gamma; TRIC/CCT, asymm 100.0
1a6d_B543 Thermosome (beta subunit); group II chaperonin, CC 100.0
1q3q_A548 Thermosome alpha subunit; chaperone, chaperonin; H 100.0
3p9d_G550 T-complex protein 1 subunit ETA; HSP60, eukaryotic 100.0
3iyg_E515 T-complex protein 1 subunit; TRIC/CCT, asymmetric, 100.0
1a6d_A545 Thermosome (alpha subunit); group II chaperonin, C 100.0
3p9d_B527 T-complex protein 1 subunit beta; HSP60, eukaryoti 100.0
3p9d_A559 T-complex protein 1 subunit alpha; HSP60, eukaryot 100.0
3iyg_Q512 T-complex protein 1 subunit theta; TRIC/CCT, asymm 100.0
3p9d_D528 T-complex protein 1 subunit delta; HSP60, eukaryot 100.0
3p9d_E562 T-complex protein 1 subunit epsilon; HSP60, eukary 100.0
3iyg_Z517 T-complex protein 1 subunit zeta; TRIC/CCT, asymme 100.0
3p9d_C590 T-complex protein 1 subunit gamma; HSP60, eukaryot 100.0
3p9d_H568 T-complex protein 1 subunit theta; HSP60, eukaryot 100.0
3p9d_F546 T-complex protein 1 subunit zeta; HSP60, eukaryoti 100.0
1we3_A543 CPN60(groel); chaperonin, chaperone, groel, HSP60, 100.0
1iok_A545 Chaperonin 60; chaperone; 3.20A {Paracoccus denitr 100.0
1kp8_A547 Groel protein; chaperonin, assisted protein foldin 100.0
3rtk_A546 60 kDa chaperonin 2; heat shock protein, chaperone 100.0
1gml_A178 T-complex protein 1 subunit gamma; chaperone, chap 96.95
>3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
Probab=100.00  E-value=9.1e-55  Score=405.38  Aligned_cols=211  Identities=39%  Similarity=0.621  Sum_probs=200.8

Q ss_pred             CCCChhhHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHh-hcccccCCCchhhHHHHHHHHHHhhhhhcc
Q psy17073          1 VGDGTTSVVLLAGEILKQVKPYVEEGVHPRIVIKAVRKATSMALQKIDE-LAVKIQKSDSGEYRGLLEKCAATALSSKLI   79 (219)
Q Consensus         1 vGDGTTsvvvLa~~ll~~a~~li~~gihP~~Ii~g~~~a~~~~l~~L~~-~s~~v~~~~~~~~~~~l~~va~tsl~sK~~   79 (219)
                      +||||||+||||++||++|++++++|+||+.|++||++|++.++++|++ ++++++..+    ++.|.++|+|+++||+.
T Consensus        80 ~GDGTTtvvvLA~eLL~~a~~li~~GihP~~I~~G~~~A~~~a~~~L~~~~s~~v~~~~----~e~l~~va~tsl~sK~~  155 (529)
T 3iyg_A           80 VGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYISENLIINTDELG----RDCLINAAKTSMSSKVI  155 (529)
T ss_pred             hCCChhhHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHhcccCCCCCC----HHHHHHHHHHHhccCcc
Confidence            6999999999999999999999999999999999999999999999998 998887544    68899999999999999


Q ss_pred             hhhhchhHHHHHHHHHhhc----c---------c----------------------------------------------
Q psy17073         80 HQQKGFFSKMVVDAVMSLD----D---------L----------------------------------------------  100 (219)
Q Consensus        80 ~~~~~~i~~l~~~Av~~v~----~---------~----------------------------------------------  100 (219)
                      +.++++|++|++||+.+|+    +         +                                              
T Consensus       156 ~~~~~~i~~livdAv~~V~~~~~~g~~~~dv~~I~I~k~~G~~~~ds~lv~G~v~dk~~~~~~m~~~ien~kIlll~~~l  235 (529)
T 3iyg_A          156 GINGDFFANLVVDAVLAIKYTDIRGQPRYPVNSINVLKAHGRSQMESMLINGYALNCVVGSQGMPKRIVNAKIACLDFSL  235 (529)
T ss_pred             cccHHHHHHHHHHHHHHHhhhccCCCcccccceEEEEEecCCCccceEEEeeeEEecCcccccCCcccCCceEEEecCCc
Confidence            9999999999999998773    0         1                                              


Q ss_pred             --------------------------------------------------------------------------------
Q psy17073        101 --------------------------------------------------------------------------------  100 (219)
Q Consensus       101 --------------------------------------------------------------------------------  100 (219)
                                                                                                      
T Consensus       236 e~~k~e~~~~v~i~~~~~~~~i~~~E~~~l~~~v~kI~~~g~nvvi~~~~I~d~al~~L~~~gI~av~~v~k~~leria~  315 (529)
T 3iyg_A          236 QKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAK  315 (529)
T ss_pred             ccccccCCceEEeCCHHHHHHHHHHHHHHHHHHHHHHHhcCCCEEEECCCCCHHHHHHHHHcCCceeccCCHHHHHHHHH
Confidence                                                                                            


Q ss_pred             ---------------------------------------eeEEecccCCceEEEEecCCCHHHHHHHHHHHHHHHHHHHH
Q psy17073        101 ---------------------------------------FNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRR  141 (219)
Q Consensus       101 ---------------------------------------~~~~~~~~~~~~~tI~irg~t~~~l~E~er~i~dal~v~~~  141 (219)
                                                             |+||++|+++++|||+|||+|+++++|+||+++|||+++|+
T Consensus       316 ~tGa~iv~~~~~l~~~e~~~~~~LG~a~~v~~~~ig~~~~~~~~g~~~~~~~TI~lrG~t~~~l~E~er~l~Dal~v~r~  395 (529)
T 3iyg_A          316 ASGATVLSTLANLEGEETFEASMLGQAEEVVQERICDDELILIKNTKARTSASVILRGANDFMCDEMERSLHDALCVVKR  395 (529)
T ss_pred             HhCCeeecchhcccchhccChhhCccceEEEEEEeCCceEEEEEcCCCCceEEEEECCchHHHHHHHHHHHHHHHHHHHH
Confidence                                                   78899999999999999999999999999999999999999


Q ss_pred             HHHcCcccccccHHHHHHHHHHHHHhcccchHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHhcCC
Q psy17073        142 TIRNHAVVAGGGAIEMELSKALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLRQKHAQGR  215 (219)
Q Consensus       142 ~~~~~~~v~GGG~~e~~l~~~l~~~~~~~~~~~~~~~~~~a~al~~ip~~L~~NaG~d~~~~~~~l~~~h~~~~  215 (219)
                      ++++|++|||||++|++++.+|++++.+.++++|+++++|++||+.||++||+|||+|+.+++.+|++.|++|+
T Consensus       396 ~v~~~~iVpGGGa~E~~ls~~L~~~~~~~~g~eq~~i~~fa~ALe~ip~~La~NaG~d~~~~v~~l~~~h~~~~  469 (529)
T 3iyg_A          396 VLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQ  469 (529)
T ss_pred             HhhCCeEEeCCcHHHHHHHHHHHHHhhhcCChHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHhccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999998765
>3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} Back     alignment and structure
>3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A Back     alignment and structure
>3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} Back     alignment and structure
>3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A Back     alignment and structure
>3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B Back     alignment and structure
>1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A Back     alignment and structure
>3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* 4d8q_G* 4d8r_g* Back     alignment and structure
>3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* Back     alignment and structure
>3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* 4d8q_B* 4d8r_b* Back     alignment and structure
>3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* 4d8q_A* 4d8r_a* Back     alignment and structure
>3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* 4d8q_D* 4d8r_d* Back     alignment and structure
>3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* 4d8q_E* 4d8r_e* Back     alignment and structure
>3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 4d8q_C* 4d8r_c* 2bbm_B 2bbn_B Back     alignment and structure
>3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* 4d8q_H* 4d8r_h* Back     alignment and structure
>3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* 4d8q_F* 4d8r_f* Back     alignment and structure
>1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* Back     alignment and structure
>1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 Back     alignment and structure
>1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... Back     alignment and structure
>3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A Back     alignment and structure
>1gml_A T-complex protein 1 subunit gamma; chaperone, chaperonin, actin, tubulin; 2.2A {Mus musculus} SCOP: c.8.5.2 PDB: 1gn1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 219
d1a6db1243 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domai 1e-11
d1a6db1243 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domai 6e-06
d1a6da1245 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domai 2e-10
d1a6da1245 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domai 2e-07
d1q3qa3107 d.56.1.2 (A:146-216,A:370-405) Thermosome, I domai 6e-08
d1a6da3105 d.56.1.2 (A:146-214,A:368-403) Thermosome, I domai 7e-07
d1a6db3107 d.56.1.2 (B:145-215,B:368-403) Thermosome, I domai 6e-06
d1gmla_168 c.8.5.2 (A:) Thermosome, A-domain {Mouse (Mus musc 9e-05
d1sjpa1180 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {My 0.001
>d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} Length = 243 Back     information, alignment and structure

class: All alpha proteins
fold: GroEL equatorial domain-like
superfamily: GroEL equatorial domain-like
family: Group II chaperonin (CCT, TRIC), ATPase domain
domain: Thermosome, E domain
species: Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]

 Score = 59.7 bits (144), Expect = 1e-11
 Identities = 34/69 (49%), Positives = 45/69 (65%)

Query: 147 AVVAGGGAIEMELSKALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNK 206
           A  AGGGA   E++  LR Y++ I G++QL I   A A E IPR L++NAG D  +IL K
Sbjct: 126 AYAAGGGATAAEIAFRLRSYAQKIGGRQQLAIEKFADAIEEIPRALAENAGLDPIDILLK 185

Query: 207 LRQKHAQGR 215
           LR +HA+G 
Sbjct: 186 LRAEHAKGN 194
>d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} Length = 243 Back     information, alignment and structure
>d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} Length = 245 Back     information, alignment and structure
>d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} Length = 245 Back     information, alignment and structure
>d1q3qa3 d.56.1.2 (A:146-216,A:370-405) Thermosome, I domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} Length = 107 Back     information, alignment and structure
>d1a6da3 d.56.1.2 (A:146-214,A:368-403) Thermosome, I domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} Length = 105 Back     information, alignment and structure
>d1a6db3 d.56.1.2 (B:145-215,B:368-403) Thermosome, I domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} Length = 107 Back     information, alignment and structure
>d1gmla_ c.8.5.2 (A:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain [TaxId: 10090]} Length = 168 Back     information, alignment and structure
>d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Length = 180 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query219
d1a6db1243 Thermosome, E domain {Archaeon Thermoplasma acidop 99.95
d1a6da1245 Thermosome, E domain {Archaeon Thermoplasma acidop 99.93
d1q3qa1258 Thermosome, E domain {Archaeon Thermococcus sp. ks 99.9
d1sjpa1180 GroEL, E domain {Mycobacterium tuberculosis, GroEL 99.74
d1we3a1255 GroEL, E domain {Thermus thermophilus [TaxId: 274] 99.69
d1ioka1252 GroEL, E domain {Paracoccus denitrificans [TaxId: 99.35
d1kp8a1252 GroEL, E domain {Escherichia coli [TaxId: 562]} 99.34
d1ioka397 GroEL, I domain {Paracoccus denitrificans [TaxId: 98.45
d1a6db3107 Thermosome, I domain {Archaeon Thermoplasma acidop 98.37
d1kp8a397 GroEL, I domain {Escherichia coli [TaxId: 562]} 98.34
d1q3qa3107 Thermosome, I domain {Archaeon Thermococcus sp. ks 98.1
d1a6da3105 Thermosome, I domain {Archaeon Thermoplasma acidop 97.76
d1kp8a1252 GroEL, E domain {Escherichia coli [TaxId: 562]} 97.34
d1sjpa389 GroEL, I domain {Mycobacterium tuberculosis, GroEL 96.3
d1we3a386 GroEL, I domain {Thermus thermophilus [TaxId: 274] 95.98
d1gmla_168 Thermosome, A-domain {Mouse (Mus musculus), gamma 94.29
>d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} Back     information, alignment and structure
class: All alpha proteins
fold: GroEL equatorial domain-like
superfamily: GroEL equatorial domain-like
family: Group II chaperonin (CCT, TRIC), ATPase domain
domain: Thermosome, E domain
species: Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]

Probab=99.95  E-value=5e-28  Score=203.06  Aligned_cols=125  Identities=44%  Similarity=0.715  Sum_probs=116.9

Q ss_pred             CCCChhhHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHhhcccccCCCchhhHHHHHHHHHHhhhhhcch
Q psy17073          1 VGDGTTSVVLLAGEILKQVKPYVEEGVHPRIVIKAVRKATSMALQKIDELAVKIQKSDSGEYRGLLEKCAATALSSKLIH   80 (219)
Q Consensus         1 vGDGTTsvvvLa~~ll~~a~~li~~gihP~~Ii~g~~~a~~~~l~~L~~~s~~v~~~~~~~~~~~l~~va~tsl~sK~~~   80 (219)
                      +||||||+++|+++||+++.++++.|+||..|++||+.+.+.+++.|++++.++.                         
T Consensus        72 ~GDGttt~~vl~~~ll~~~~~~i~~G~~p~~I~~g~~~a~~~~~~~L~~~a~~v~-------------------------  126 (243)
T d1a6db1          72 VGDGTTTAVIIAGGLLQQAQGLINQNVHPTVISEGYRMASEEAKRVIDEISTKIA-------------------------  126 (243)
T ss_dssp             CTTHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHCEECE-------------------------
T ss_pred             hhcCCcchHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHhhccccc-------------------------
Confidence            6999999999999999999999999999999999999999999999888765543                         


Q ss_pred             hhhchhHHHHHHHHHhhccceeEEecccCCceEEEEecCCCHHHHHHHHHHHHHHHHHHHHHHHcCcccccccHHHHHHH
Q psy17073         81 QQKGFFSKMVVDAVMSLDDLFNVFSGCKNARTCTIIVRGGAEQFLEETERSLHDAIMIVRRTIRNHAVVAGGGAIEMELS  160 (219)
Q Consensus        81 ~~~~~i~~l~~~Av~~v~~~~~~~~~~~~~~~~tI~irg~t~~~l~E~er~i~dal~v~~~~~~~~~~v~GGG~~e~~l~  160 (219)
                                                                                         ++||||++|++++
T Consensus       127 -------------------------------------------------------------------~~~ggGa~e~~~a  139 (243)
T d1a6db1         127 -------------------------------------------------------------------YAAGGGATAAEIA  139 (243)
T ss_dssp             -------------------------------------------------------------------EEETTTHHHHHHH
T ss_pred             -------------------------------------------------------------------cccCCCchhHHHH
Confidence                                                                               1248999999999


Q ss_pred             HHHHHHhcccchHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHhcCCCC
Q psy17073        161 KALRDYSRSIAGKEQLLIGAVAKAFEVIPRQLSDNAGFDATNILNKLRQKHAQGRLK  217 (219)
Q Consensus       161 ~~l~~~~~~~~~~~~~~~~~~a~al~~ip~~L~~NaG~d~~~~~~~l~~~h~~~~~~  217 (219)
                      ..++++++++++++|+++++|++||+.||++|++|+|+|+.+++.+|+..|.+|+.+
T Consensus       140 ~~l~~~a~~~~g~~q~~i~~~a~Ale~ip~~LaeNaG~d~~~~i~~l~~~h~~~~~~  196 (243)
T d1a6db1         140 FRLRSYAQKIGGRQQLAIEKFADAIEEIPRALAENAGLDPIDILLKLRAEHAKGNKT  196 (243)
T ss_dssp             HHHHHHHHHTCSSHHHHHHHHHHHHTHHHHHHHHHHTCCHHHHHHHHHHHHHTTCTT
T ss_pred             HHHhhhhhccCCHHHHHHHHHHHHhhccCccccccCCCChhHHHHHHHHHHhCCCCc
Confidence            999999999999999999999999999999999999999999999999999988754
>d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} Back     information, alignment and structure
>d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} Back     information, alignment and structure
>d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Back     information, alignment and structure
>d1we3a1 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ioka1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kp8a1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ioka3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1a6db3 d.56.1.2 (B:145-215,B:368-403) Thermosome, I domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} Back     information, alignment and structure
>d1kp8a3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3qa3 d.56.1.2 (A:146-216,A:370-405) Thermosome, I domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} Back     information, alignment and structure
>d1a6da3 d.56.1.2 (A:146-214,A:368-403) Thermosome, I domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} Back     information, alignment and structure
>d1kp8a1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sjpa3 d.56.1.1 (A:135-188,A:373-407) GroEL, I domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Back     information, alignment and structure
>d1we3a3 d.56.1.1 (A:139-189,A:374-408) GroEL, I domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gmla_ c.8.5.2 (A:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain [TaxId: 10090]} Back     information, alignment and structure