Psyllid ID: psy17078


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------
MKKKFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVN
cHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccEEccEEEEEcccccccHHHHHHHHc
ccccccEEEEEEEccccHHccHHHHHHHHHHHHHHcccHHHHccccccEEEEccccEEcHHHHHHHHc
mkkkfktgipmeaTSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVN
mkkkfktgipmeatsnlvalkkDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVN
MKKKFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVN
****************LVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEI**
**KKFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVN
********IPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVN
***KFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVN
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKKFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query68 2.2.26 [Sep-21-2011]
Q0GA42 951 Metal transporter CNNM1 O yes N/A 0.705 0.050 0.520 3e-08
Q9NRU3 951 Metal transporter CNNM1 O yes N/A 0.705 0.050 0.520 3e-08
Q9H8M5 875 Metal transporter CNNM2 O no N/A 0.705 0.054 0.541 7e-08
Q3TWN3 875 Metal transporter CNNM2 O no N/A 0.705 0.054 0.541 8e-08
Q5U2P1 875 Metal transporter CNNM2 O no N/A 0.705 0.054 0.541 8e-08
Q6P4Q7 775 Metal transporter CNNM4 O no N/A 0.705 0.061 0.520 1e-07
A0JPA0 769 Metal transporter CNNM4 O no N/A 0.838 0.074 0.403 1e-07
P0C588 772 Metal transporter CNNM4 O no N/A 0.705 0.062 0.520 1e-07
Q69ZF7 771 Metal transporter CNNM4 O no N/A 0.705 0.062 0.520 1e-07
Q12296 706 Protein MAM3 OS=Saccharom yes N/A 0.985 0.094 0.373 4e-06
>sp|Q0GA42|CNNM1_MOUSE Metal transporter CNNM1 OS=Mus musculus GN=Cnnm1 PE=1 SV=5 Back     alignment and function desciption
 Score = 57.4 bits (137), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 36/48 (75%)

Query: 20  LKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIV 67
           L K+E+NII GALE+  K VEE++T L DC+ML  + +L+F  +SEI+
Sbjct: 410 LVKEELNIIQGALELRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEIL 457




Probable metal transporter.
Mus musculus (taxid: 10090)
>sp|Q9NRU3|CNNM1_HUMAN Metal transporter CNNM1 OS=Homo sapiens GN=CNNM1 PE=2 SV=3 Back     alignment and function description
>sp|Q9H8M5|CNNM2_HUMAN Metal transporter CNNM2 OS=Homo sapiens GN=CNNM2 PE=1 SV=2 Back     alignment and function description
>sp|Q3TWN3|CNNM2_MOUSE Metal transporter CNNM2 OS=Mus musculus GN=Cnnm2 PE=1 SV=3 Back     alignment and function description
>sp|Q5U2P1|CNNM2_RAT Metal transporter CNNM2 OS=Rattus norvegicus GN=Cnnm2 PE=2 SV=1 Back     alignment and function description
>sp|Q6P4Q7|CNNM4_HUMAN Metal transporter CNNM4 OS=Homo sapiens GN=CNNM4 PE=1 SV=3 Back     alignment and function description
>sp|A0JPA0|CNNM4_XENTR Metal transporter CNNM4 OS=Xenopus tropicalis GN=cnnm4 PE=2 SV=1 Back     alignment and function description
>sp|P0C588|CNNM4_RAT Metal transporter CNNM4 OS=Rattus norvegicus GN=Cnnm4 PE=1 SV=1 Back     alignment and function description
>sp|Q69ZF7|CNNM4_MOUSE Metal transporter CNNM4 OS=Mus musculus GN=Cnnm4 PE=1 SV=2 Back     alignment and function description
>sp|Q12296|MAM3_YEAST Protein MAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAM3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query68
405973540 1096 Metal transporter CNNM2 [Crassostrea gig 0.838 0.052 0.526 5e-10
328720335 986 PREDICTED: metal transporter CNNM2-like 0.705 0.048 0.645 2e-09
328720337 950 PREDICTED: metal transporter CNNM2-like 0.705 0.050 0.645 3e-09
328720333 931 PREDICTED: metal transporter CNNM2-like 0.705 0.051 0.645 3e-09
357621730 962 ancient conserved domain protein 2 [Dana 0.838 0.059 0.543 1e-08
347967171 854 AGAP002094-PA [Anopheles gambiae str. PE 0.838 0.066 0.491 2e-08
242021399 834 conserved hypothetical protein [Pediculu 0.705 0.057 0.604 3e-08
260817760 800 hypothetical protein BRAFLDRAFT_86581 [B 0.838 0.071 0.508 3e-08
350403868 950 PREDICTED: metal transporter CNNM2-like 0.838 0.06 0.508 5e-08
170073576 553 MAM3 [Culex quinquefasciatus] gi|1678702 0.838 0.103 0.456 5e-08
>gi|405973540|gb|EKC38248.1| Metal transporter CNNM2 [Crassostrea gigas] Back     alignment and taxonomy information
 Score = 68.6 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 30/57 (52%), Positives = 45/57 (78%)

Query: 11  MEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIV 67
           ++ T     LK DEVNIISGAL++++K V+E+MTK++D YMLDI ++L+F  +SEI+
Sbjct: 597 VKVTKEFNDLKNDEVNIISGALDLSKKSVKEVMTKIEDVYMLDINSVLDFETVSEIM 653




Source: Crassostrea gigas

Species: Crassostrea gigas

Genus: Crassostrea

Family: Ostreidae

Order: Ostreoida

Class: Bivalvia

Phylum: Mollusca

Superkingdom: Eukaryota

>gi|328720335|ref|XP_001945496.2| PREDICTED: metal transporter CNNM2-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328720337|ref|XP_003247005.1| PREDICTED: metal transporter CNNM2-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328720333|ref|XP_003247004.1| PREDICTED: metal transporter CNNM2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|357621730|gb|EHJ73464.1| ancient conserved domain protein 2 [Danaus plexippus] Back     alignment and taxonomy information
>gi|347967171|ref|XP_320945.5| AGAP002094-PA [Anopheles gambiae str. PEST] gi|333469727|gb|EAA01004.5| AGAP002094-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|242021399|ref|XP_002431132.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212516381|gb|EEB18394.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|260817760|ref|XP_002603753.1| hypothetical protein BRAFLDRAFT_86581 [Branchiostoma floridae] gi|229289076|gb|EEN59764.1| hypothetical protein BRAFLDRAFT_86581 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|350403868|ref|XP_003486930.1| PREDICTED: metal transporter CNNM2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|170073576|ref|XP_001870397.1| MAM3 [Culex quinquefasciatus] gi|167870221|gb|EDS33604.1| MAM3 [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query68
FB|FBgn0262124 834 uex "unextended" [Drosophila m 0.852 0.069 0.448 1.3e-08
UNIPROTKB|F1ND49 598 CNNM2 "Uncharacterized protein 0.705 0.080 0.520 7.4e-08
RGD|1308728 878 Cnnm1 "cyclin M1" [Rattus norv 0.705 0.054 0.520 1.2e-07
UNIPROTKB|F1MD84 941 CNNM1 "Uncharacterized protein 0.705 0.051 0.520 1.4e-07
UNIPROTKB|Q6P4Q7 775 CNNM4 "Metal transporter CNNM4 0.705 0.061 0.520 1.4e-07
UNIPROTKB|F1PMJ7 948 CNNM1 "Uncharacterized protein 0.705 0.050 0.520 1.4e-07
UNIPROTKB|F1S8W6 949 CNNM1 "Uncharacterized protein 0.705 0.050 0.520 1.4e-07
UNIPROTKB|Q9NRU3 951 CNNM1 "Metal transporter CNNM1 0.705 0.050 0.520 1.4e-07
MGI|MGI:1891366 951 Cnnm1 "cyclin M1" [Mus musculu 0.705 0.050 0.520 1.4e-07
UNIPROTKB|F1S849 827 CNNM2 "Uncharacterized protein 0.705 0.058 0.541 1.5e-07
FB|FBgn0262124 uex "unextended" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 142 (55.0 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 26/58 (44%), Positives = 44/58 (75%)

Query:    11 MEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVN 68
             +  T+++  L K+EVNIISGALE+ +K V ++MT ++D +ML ++ +L+F  +SEI+N
Sbjct:   348 VRVTNDVNDLDKNEVNIISGALELRKKTVADVMTHINDAFMLSLDALLDFETVSEIMN 405




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0006873 "cellular ion homeostasis" evidence=ISS
UNIPROTKB|F1ND49 CNNM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1308728 Cnnm1 "cyclin M1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MD84 CNNM1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P4Q7 CNNM4 "Metal transporter CNNM4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PMJ7 CNNM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8W6 CNNM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NRU3 CNNM1 "Metal transporter CNNM1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1891366 Cnnm1 "cyclin M1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1S849 CNNM2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0GA42CNNM1_MOUSENo assigned EC number0.52080.70580.0504yesN/A
Q9NRU3CNNM1_HUMANNo assigned EC number0.52080.70580.0504yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 68
PRK11573 413 hypothetical protein; Provisional 99.19
TIGR03520 408 GldE gliding motility-associated protein GldE. Mem 99.16
PRK15094 292 magnesium/cobalt efflux protein CorC; Provisional 99.12
KOG2118|consensus 498 99.06
COG1253 429 TlyC Hemolysins and related proteins containing CB 99.03
COG4536 423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 98.91
COG4535 293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 98.25
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 94.58
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
Probab=99.19  E-value=1.4e-11  Score=90.62  Aligned_cols=60  Identities=13%  Similarity=0.338  Sum_probs=50.4

Q ss_pred             hhhhcccceecccCCCccCCHhHHHHHHhhhccCcceeccceeecccEEEeeCCCCCCHHHHHHh
Q psy17078          2 KKKFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEI   66 (68)
Q Consensus         2 k~elk~Lv~lh~~~~~g~l~~~E~~mi~g~lel~~~~V~diMtPr~~V~~L~~d~~l~~~t~~~I   66 (68)
                      ++||+.+++.+.    +.++++|++||+|+|+|++++|+||||||.+|++++.+++++ +.+..+
T Consensus       156 ~eEl~~lv~~~~----~~l~~~e~~mi~~vl~l~~~~v~eiMtPr~~i~~l~~~~~~~-e~~~~~  215 (413)
T PRK11573        156 KEELRTIVHESR----SQISRRNQDMLLSVLDLEKVTVDDIMVPRNEIVGIDINDDWK-SILRQL  215 (413)
T ss_pred             HHHHHHHHHHHh----hhcCHHHHHHHHHHhccCCCChhhcCCccceEEEEECCCCHH-HHHHHH
Confidence            468888887543    259999999999999999999999999999999999999984 444443



>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>KOG2118|consensus Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query68
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 98.85
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 98.71
3ocm_A 173 Putative membrane protein; structural genomics, PS 98.53
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 98.45
3oco_A 153 Hemolysin-like protein containing CBS domains; str 97.94
3t4n_C 323 Nuclear protein SNF4; CBS domain, nucleotide bindi 97.74
2qrd_G 334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 97.47
3kxr_A 205 Magnesium transporter, putative; cystathionine bet 96.98
3k6e_A 156 CBS domain protein; streptococcus pneumoniae TIGR4 96.61
2v8q_E 330 5'-AMP-activated protein kinase subunit gamma-1; p 96.45
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 95.74
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 95.03
2yvy_A 278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 95.0
3lfr_A 136 Putative metal ION transporter; CBS, AMP, PSI, MCS 94.91
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 94.9
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 94.8
3ctu_A 156 CBS domain protein; structural genomics, PSI-2, pr 94.22
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 93.89
2oux_A 286 Magnesium transporter; 10001B, structural genomics 92.77
2emq_A 157 Hypothetical conserved protein; CBS domains, NPPSF 92.1
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 88.28
1yav_A 159 Hypothetical protein BSU14130; cystathionine beta 88.06
3lqn_A 150 CBS domain protein; csgid, structural genomics, un 86.65
4gqw_A 152 CBS domain-containing protein CBSX1, chloroplasti; 85.96
3org_A 632 CMCLC; transporter, transport protein; 3.50A {Cyan 84.78
4esy_A 170 CBS domain containing membrane protein; structural 84.39
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
Probab=98.85  E-value=6.3e-10  Score=69.05  Aligned_cols=57  Identities=9%  Similarity=0.096  Sum_probs=50.9

Q ss_pred             hhhhcccceecccCCCccCCHhHHHHHHhhhccCcceeccceeecccEEEeeCCCCCCH
Q psy17078          2 KKKFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNF   60 (68)
Q Consensus         2 k~elk~Lv~lh~~~~~g~l~~~E~~mi~g~lel~~~~V~diMtPr~~V~~L~~d~~l~~   60 (68)
                      ..||+.|+....  ++|.++++|++++.++++|++.+|+++|+|+.++++++.++++..
T Consensus         5 ~~el~~li~~~~--~~g~l~~~e~~~i~~~~~l~~~~v~diM~~~~~~~~v~~~~~i~~   61 (156)
T 3oi8_A            5 AEDVLNLLRQAH--EQEVFDADTLLRLEKVLDFSDLEVRDAMITRSRMNVLKENDSIER   61 (156)
T ss_dssp             HHHHHHHHHHHH--HTTSSCHHHHHHHHHHHHHTTCBGGGTCEEGGGCCCEETTCCHHH
T ss_pred             HHHHHHHHHhHH--hcCCcCHHHHHHHHHHhccCCCCHhheeeeHHHeEEECCCCCHHH
Confidence            468899988543  468899999999999999999999999999999999999998764



>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query68
d2ooxe1 179 Uncharacterized protein C1556.08c {Schizosaccharom 95.95
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 95.67
d2v8qe2 159 5'-AMP-activated protein kinase subunit gamma-1, A 93.01
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 81.86
d2d4za3 160 Chloride channel protein, CBS tandem {Marbled elec 80.57
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Uncharacterized protein C1556.08c
species: Schizosaccharomyces pombe [TaxId: 4896]
Probab=95.95  E-value=0.00064  Score=40.89  Aligned_cols=43  Identities=2%  Similarity=0.149  Sum_probs=37.4

Q ss_pred             CCHhHHHHHHhhhcc-CcceeccceeecccEEEeeCCCCCCHHH
Q psy17078         20 LKKDEVNIISGALEM-TQKKVEEIMTKLDDCYMLDIETILNFTV   62 (68)
Q Consensus        20 l~~~E~~mi~g~lel-~~~~V~diMtPr~~V~~L~~d~~l~~~t   62 (68)
                      +.+.++..++.+.+| .++++.|+|+|..+++.++.+.++....
T Consensus         2 ~~~~~~~~~~~i~~fl~~~~~~dvm~~s~~vv~i~~~~~v~~A~   45 (179)
T d2ooxe1           2 VQETQKGALKEIQAFIRSRTSYDVLPTSFRLIVFDVTLFVKTSL   45 (179)
T ss_dssp             HHHHHHHHHHHHHHHHHHSBHHHHSCSEEEEEEEETTSBHHHHH
T ss_pred             cCHHHHHHHHHHHHHHcCCEeeeeCCCCCcEEEEECcchHHHHH
Confidence            346678899999996 9999999999999999999999987543



>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure