Psyllid ID: psy17085

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820------

MSQVDSLNLDSIINRLIDIDARSGRNVNLHESEISALCRVSREIFLSEPMLLELGTPLKICGDIHGQYLDLLMLFDYGKYPPKSRYLFLGDYVDRGSNSLETICLLLAYKIKYPGMFHLLRGNHECANINKVYGFYDECKRRYNVKLWKTFTECFNCMPVAAIVDEKIFCCHGGLSPYLSSIDQIRRISRPTRVPEQGLLCDLLWSDPEKAAESQLTIVRQVRFHAEVKLGAHYLSSQLNNAVYPVEKTFLHEKYDKAEIKSDIALLKLGRKVQFTNFIQPICLPIKQYWQHDFAQAIATVAGWGYYTYTTAISNAKNTLKFPGMSLQILQWFVDSYHSIHLENYATEAAISNANNTLKFPGMSLQILQWFVDSYKLNSSLGAVAPTPKPQSGLFVYGVKFLQWLYWFHPKLKSERTASVGRQTMFQQRSKIEHRTAKVEGQSLVTSRVFRLRSRSGKTNLTRHRFTTIIVPGKDPKLSTVLRKLKVKVWSQAECLDYDPEVEKQICAGGEKGNVDVKEDLRFEEVDSSRRLTVCQFNDVHHSESFTTIWRNFCSQQTKPGTKDTKEEDEFNIKYTLKQDDLNRIKQGLSGKPLKVEEIVDEENAGNNEEIVGHNKKALSEMDKKIKENIEMLKNDLGKMKKTPEIIKYRDMIAKYLPVKISNMEELKSLLNKEFDQFKMSDLNQVPNHIMLLAVAGLVPFLVPCVDVLLISGYTPTMELIQTTYSSLLLTTLGGIHLTSHFRAILHNQVNKEDIPTILYPCTFAWISLLAPSVGLVVNSTGLVLLLLADIQKNQARPSWYKSLRLMTTSTAVVTMVVMVAGKLFS

ccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccEEEEcccEEEEccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHcccHHHHHHHHHHcccccHHEEEcccEEEEccccccccccHHHHHHccccccccccccccccccccccccccccccccccccEEccHHHHHHHHHHHccccccccEEEcccccccccccccEEEEEccccEEEEEccEEEEEEEcccHHccHHHHHHHEEcccccEEEEEEEccccccccccccccEEEEEEEEccEEEEEccHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccEEEEHHHHHHHHHHHccccccccccccccHHHHHHccccccccccccccEEEEEEEEEEEccccccccccEEEEEEEEccccccHHHHHHHHHEEEEcccccccccHHHHHHHHccccccccccccccccccccccccEEEEEEccccccccHHHHHHHHHcccccccccccccccccccEEEEcccHHHHHHccccccccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHcccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHccccHHHHHHHEEccccEEEEEEEEccccccc

ccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccEEEEcccEEEEcEccccHHHHHHHHHHHcccccccEEEccccccccccHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHcHHHHHHHHccHHHHHHHHHHHcccccEEEEcccEEEEccccccccccHHHHHHcccccccccccHHHHHHHcEEccccccEEEccccccEEEcHHHHHHHHcccccccHHHEEEEEEccccEccccEcccEEEEEcccccccccccccEccHHHHHHHHHHccccEEEEEcccccccccccccEEEEEcccHHHHHHHcccccccccccccHHHEEEccccccccccccHHHHHHHHHHHHHccccHHHcccccccccccEEEcHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccEEEEccccEEEEEEEEEEccccccccccccEEEEEEccccccHHHHHHHccEEEEccHHHccccHHHHHEEEcccccccccccccccEEEEccccEEEEEEEccccccccHHHHHHHHccccccccccccccccccEEEEEccHcHHHHHHHcccccccEEEEEEEccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEccHHHHHHHHHHHHHHccHccHcccccHHHHHHHHccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHccHHHcHHHHHHHHHcccHcccccEccHHHHHHHHHHcccccEEEccHHHHHHHHHHHHHHcccccHHHHHHHHHccHHHHHHHHHHHHHHcc

msqvdslnLDSIINRLIDidarsgrnvnlhESEISALCRVSReiflsepmllelgtplkicgDIHGQYLDLLMLfdygkyppksrylflgdyvdrgsnSLETICLLLAYKIKYPGMFHLLRGNHECANINKVYGFYDECKRRYNVKLWKTFTEcfncmpvaaivdekifcchgglspylssidqirrisrptrvpeqgllcdllwsdpekaaESQLTIVRQVRFHAEVKLGAHYLSsqlnnavypvektflhekydkaeIKSDIALLKLgrkvqftnfiqpiclpikQYWQHDFAQAIATVAGWGYYTYTTAISnakntlkfpgmSLQILQWFVDSYHSIHLENYATEAAISnanntlkfpgmSLQILQWFVDSYKlnsslgavaptpkpqsglfvyGVKFLQWLywfhpklksertasvgrQTMFQQRSKIEHRTAKVEGQSLVTSRVFRlrsrsgktnltrhrfttiivpgkdpklsTVLRKLKVKVWSQaecldydpevekqicaggekgnvdvkedlrfeevdssrrltvcqfndvhhseSFTTIWRNFCsqqtkpgtkdtkeedefnikytlkqddlnrikqglsgkplkveeivdeenagnneeiVGHNKKALSEMDKKIKENIEMLKNDlgkmkktpeiIKYRDMIAKYLPVKISNMEELKSLLNKEfdqfkmsdlnqvpNHIMLLAVAGLVPFLVPCVDVLLISGYTPTMELIQTTYSSLLLTTLGGIHLTSHFRAILHnqvnkediptilypcTFAWISllapsvglvvnSTGLVLLLLADIQKNQARPSWYKSLRLMTTSTAVVTMVVMVAGKLFS

MSQVDSLNLDSIINRLIDIDARSGRNVNLHESEISALCRVSREIFLSEPMLLELGTPLKICGDIHGQYLDLLMLFDYGKYPPKSRYLFLGDYVDRGSNSLETICLLLAYKIKYPGMFHLLRGNHECANINKVYGFYDECKRRYNVKLWKTFTECFNCMPVAAIVDEKIFCCHGGLSPYLSSIDQIRRISRPTRVPEQGLLCDLLWSDPEKAAESQLTIVRQVRFHAEVKLGAHYLSSQLNNAVYPVEKTFLHEKYDKAEIKSDIALLKLGRKVQFTNFIQPICLPIKQYWQHDFAQAIATVAGWGYYTYTTAISNAKNTLKFPGMSLQILQWFVDSYHSIHLENYATEAAISNANNTLKFPGMSLQILQWFVDSYKLNSSLGAVAPTPKPQSGLFVYGVKFLQWLYWFHPKLKSERTASVGRQTmfqqrskiehrtakvegqslvtsrvfrlrsrsgktnltrhrfttiivpgkdpklstVLRKLKVKVWSQAECLDYDPEVEKQIcaggekgnvdvkeDLRFEevdssrrltvcqfndVHHSESFTTIWRNFCSQqtkpgtkdtkeedefnikytlkqddlnrikqglsgkplkveeivdeenagnneeivghnkkalsEMDKKIKENIEMLkndlgkmkktpeiIKYRDMIAKYLPVKISNMEELKSLLNKEFDQFKMSDLNQVPNHIMLLAVAGLVPFLVPCVDVLLISGYTPTMELIQTTYSSLLLTTLGGIHLTSHFRAILHNQVNKEDIPTILYPCTFAWISLLAPSVGLVVNSTGLVLLLLADIQKNQARPSWYKSLRLMTTSTAVVTMVVMVAGKLFS

MSQVDSLNLDSIINRLIDIDARSGRNVNLHESEISALCRVSREIFLSEPMLLELGTPLKICGDIHGQYLDLLMLFDYGKYPPKSRYLFLGDYVDRGSNSLETICLLLAYKIKYPGMFHLLRGNHECANINKVYGFYDECKRRYNVKLWKTFTECFNCMPVAAIVDEKIFCCHGGLSPYLSSIDQIRRISRPTRVPEQGLLCDLLWSDPEKAAESQLTIVRQVRFHAEVKLGAHYLSSQLNNAVYPVEKTFLHEKYDKAEIKSDIALLKLGRKVQFTNFIQPICLPIKQYWQHDFAQAIATVAGWGYYTYTTAISNAKNTLKFPGMSLQILQWFVDSYHSIHLENYATEAAISNANNTLKFPGMSLQILQWFVDSYKLNSSLGAVAPTPKPQSGLFVYGVKFLQWLYWFHPKLKSERTASVGRQTMFQQRSKIEHRTAKVEGQSLVTSRVFRLRSRSGKTNLTRHRFTTIIVPGKDPKLSTVLRKLKVKVWSQAECLDYDPEVEKQICAGGEKGNVDVKEDLRFEEVDSSRRLTVCQFNDVHHSESFTTIWRNFCSQQTKPGTKDTKEEDEFNIKYTLKQDDLNRIKQGLSGKPLKVEEIVDEENAGNNEEIVGHNKKALSEMDKKIKENIEMLKNDLGKMKKTPEIIKYRDMIAKYLPVKISNMEELKSLLNKEFDQFKMSDLNQVPNHIMLLAVAGLVPFLVPCVDVLLISGYTPTMEliqttysslllttlggihltshFRAILHNQVNKEDIPTILYPCTFAWISLLAPSVGLVVNSTGLVLLLLADIQKNQARPSWYKSLRLmttstavvtmvvmvaGKLFS

********LDSIINRLIDIDARSGRNVNLHESEISALCRVSREIFLSEPMLLELGTPLKICGDIHGQYLDLLMLFDYGKYPPKSRYLFLGDYVDRGSNSLETICLLLAYKIKYPGMFHLLRGNHECANINKVYGFYDECKRRYNVKLWKTFTECFNCMPVAAIVDEKIFCCHGGLSPYLSSIDQIRRISRPTRVPEQGLLCDLLWSDPEKAAESQLTIVRQVRFHAEVKLGAHYLSSQLNNAVYPVEKTFLHEKYDKAEIKSDIALLKLGRKVQFTNFIQPICLPIKQYWQHDFAQAIATVAGWGYYTYTTAISNAKNTLKFPGMSLQILQWFVDSYHSIHLENYATEAAISNANNTLKFPGMSLQILQWFVDSYKLNSSLGAVAPTPKPQSGLFVYGVKFLQWLYWFHPKL********************************VTSRVFRLR****KTNLTRHRFTTIIVPGKDPKLSTVLRKLKVKVWSQAECLDYDPEVEKQICAGGEKGNVDVKEDLRFEEVDSSRRLTVCQFNDVHHSESFTTIWRNFCS*******************Y*******************************************************************TPEIIKYRDMIAKYLPVKISNMEELKSLLNKEFDQFKMSDLNQVPNHIMLLAVAGLVPFLVPCVDVLLISGYTPTMELIQTTYSSLLLTTLGGIHLTSHFRAILHNQVNKEDIPTILYPCTFAWISLLAPSVGLVVNSTGLVLLLLADIQKNQARPSWYKSLRLMTTSTAVVTMVVMVAGKL**

****DSL*LDSIINRLIDIDARSGRNVNLHESEISALCRVSREIFLSEPMLLELGTPLKICGDIHGQYLDLLMLFDYGKYPPKSRYLFLGDYVDRGSNSLETICLLLAYKIKYPGMFHLLRGNHECANINKVYGFYDECKRRYNVKLWKTFTECFNCMPVAAIVDEKIFCCHGGLSPYLSSIDQIRRISRPTRVPEQGLLCDLLWSDPEKAAESQLTIVRQVRFHAEVKLGAHYLSSQLNNAVYPVEKTFLHEKYDKAEIKSDIALLKLGRKVQFTNFIQPICLPIKQYWQHDFAQAIATVAGWGYYTYT****************LQILQWFVDSYHSIHLENYATEAAISNANNTLKFPGMSLQILQWFVDSYKLNSSLGAVAPTPKPQSGLFVYGVKFLQWLYWFHPKLKS***************************QSLVTSRVFRLRSR*****LTRHRFTTIIVPGKDPKLSTVLRKLKVKVWSQAECLDYDPEVEKQICAGGEKGNVDVKEDLRFEEVDSSRRLTVCQFNDVHHSESFTTIWRNF*****************FNIKYTLKQDDLNRIKQGLSGKPLKVEEIVD**********VG***************NIEMLKNDLGKMKKTPEIIKYRDMIAKYLPVKISNMEELKSLLNKEFDQFKMSDLNQVPNHIMLLAVAGLVPFLVPCVDVLLISGYTPTMELIQTTYSSLLLTTLGGIHLTSHFRAILHNQVNKEDIPTILYPCTFAWISLLAPSVGLVVNSTGLVLLLLADIQKNQARPSWYKSLRLMTTSTAVVTMVVMVAGKLFS

MSQVDSLNLDSIINRLIDIDARSGRNVNLHESEISALCRVSREIFLSEPMLLELGTPLKICGDIHGQYLDLLMLFDYGKYPPKSRYLFLGDYVDRGSNSLETICLLLAYKIKYPGMFHLLRGNHECANINKVYGFYDECKRRYNVKLWKTFTECFNCMPVAAIVDEKIFCCHGGLSPYLSSIDQIRRISRPTRVPEQGLLCDLLWSDPEKAAESQLTIVRQVRFHAEVKLGAHYLSSQLNNAVYPVEKTFLHEKYDKAEIKSDIALLKLGRKVQFTNFIQPICLPIKQYWQHDFAQAIATVAGWGYYTYTTAISNAKNTLKFPGMSLQILQWFVDSYHSIHLENYATEAAISNANNTLKFPGMSLQILQWFVDSYKLNSSLGAVAPTPKPQSGLFVYGVKFLQWLYWFHPKLKSERTASVGRQTMFQQRSKIEHRTAKVEGQSLVTSRVFRLRSRSGKTNLTRHRFTTIIVPGKDPKLSTVLRKLKVKVWSQAECLDYDPEVEKQICAGGEKGNVDVKEDLRFEEVDSSRRLTVCQFNDVHHSESFTTIWRNFCSQQ**********EDEFNIKYTLKQDDLNRIKQGLSGKPLKVEEIVDEENAGNNEEIVGHNKKALSEMDKKIKENIEMLKNDLGKMKKTPEIIKYRDMIAKYLPVKISNMEELKSLLNKEFDQFKMSDLNQVPNHIMLLAVAGLVPFLVPCVDVLLISGYTPTMELIQTTYSSLLLTTLGGIHLTSHFRAILHNQVNKEDIPTILYPCTFAWISLLAPSVGLVVNSTGLVLLLLADIQKNQARPSWYKSLRLMTTSTAVVTMVVMVAGKLFS

*****SLNLDSIINRLIDIDARSGRNVNLHESEISALCRVSREIFLSEPMLLELGTPLKICGDIHGQYLDLLMLFDYGKYPPKSRYLFLGDYVDRGSNSLETICLLLAYKIKYPGMFHLLRGNHECANINKVYGFYDECKRRYNVKLWKTFTECFNCMPVAAIVDEKIFCCHGGLSPYLSSIDQIRRISRPTRVPEQGLLCDLLWSDPEKAAESQLTIVRQVRFHAEVKLGAHYLSSQLNNAVYPVEKTFLHEKYDKAEIKSDIALLKLGRKVQFTNFIQPICLPIKQYWQHDFAQAIATVAGWGYYTYTTAISNAKNTLKFPGMSLQILQWFVDSYHSIHLENYATEAAISNANNTLKFPGMSLQILQWFVDSYKLNSSLGAVAPTPKPQSGLFVYGVKFLQWLYWFHPKLKSERTASVGRQTMFQQRSKIEHRTAKVEGQSLVTSRVFRLRSRSGKTNLTRHRFTTIIVPGKDPKLSTVLRKLKVKVWSQAECLDYDPEVEKQICAGGEKGNVDVKEDLRFEEVDSSRRLTVCQFNDVHHSESFTTIWRNFCSQQ**********EDEFNIKYTLKQDDLNRIKQGLSGKPLKVEEIVDEENAGNNEEIVGHNKKALSEMDKKIKENIEMLKNDLGKMKKTPEIIKYRDMIAKYLPVKISNMEELKSLLNKEFDQFKMSDLNQVPNHIMLLAVAGLVPFLVPCVDVLLISGYTPTMELIQTTYSSLLLTTLGGIHLTSHFRAILHNQVNKEDIPTILYPCTFAWISLLAPSVGLVVNSTGLVLLLLADIQKNQARPSWYKSLRLMTTSTAVVTMVVMVAGKLFS

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSQVDSLNLDSIINRLIDIDARSGRNVNLHESEISALCRVSREIFLSEPMLLELGTPLKICGDIHGQYLDLLMLFDYGKYPPKSRYLFLGDYVDRGSNSLETICLLLAYKIKYPGMFHLLRGNHECANINKVYGFYDECKRRYNVKLWKTFTECFNCMPVAAIVDEKIFCCHGGLSPYLSSIDQIRRISRPTRVPEQGLLCDLLWSDPEKAAESQLTIVRQVRFHAEVKLGAHYLSSQLNNAVYPVEKTFLHEKYDKAEIKSDIALLKLGRKVQFTNFIQPICLPIKQYWQHDFAQAIATVAGWGYYTYTTAISNAKNTLKFPGMSLQILQWFVDSYHSIHLENYATEAAISNANNTLKFPGMSLQILQWFVDSYKLNSSLGAVAPTPKPQSGLFVYGVKFLQWLYWFHPKLKSERTASVGRQTMFQQRSKIEHRTAKVEGQSLVTSRVFRLRSRSGKTNLTRHRFTTIIVPGKDPKLSTVLRKLKVKVWSQAECLDYDPEVEKQICAGGEKGNVDVKEDLRFEEVDSSRRLTVCQFNDVHHSESFTTIWRNFCSQQTKPGTKDTKEEDEFNIKYTLKQDDLNRIKQGLSGKPLKVEEIVDEENAGNNEEIVGHNxxxxxxxxxxxxxxxxxxxxxLGKMKKTPEIIKYRDMIAKYLPVKISNMEELKSLLNKEFDQFKMSDLNQVPNHIMLLAVAGLVPFLVPCVDVLLISGYTPTMELIQTTYSSLLLTTLGGIHLTSHFRAILHNQVNKEDIPTILYPCTFAWISLLAPSVGLVVNSTGLVLLLLADIQKNQARPSWYKSLRLMTTSTAVVTMVVMVAGKLFS

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		826	2.2.26 [Sep-21-2011]
P62138		330	Serine/threonine-protein	yes	N/A	0.284	0.712	0.699	2e-95
P62139		330	Serine/threonine-protein	yes	N/A	0.284	0.712	0.699	2e-95
P62136		330	Serine/threonine-protein	yes	N/A	0.284	0.712	0.699	2e-95
Q3T0E7		330	Serine/threonine-protein	yes	N/A	0.284	0.712	0.699	2e-95
Q6NVU2		323	Serine/threonine-protein	yes	N/A	0.284	0.727	0.694	2e-95
P36874		323	Serine/threonine-protein	N/A	N/A	0.284	0.727	0.694	2e-95
Q7SZ10		323	Serine/threonine-protein	N/A	N/A	0.284	0.727	0.694	2e-95
P63088		323	Serine/threonine-protein	no	N/A	0.284	0.727	0.690	3e-95
P63087		323	Serine/threonine-protein	yes	N/A	0.284	0.727	0.690	3e-95
P61287		323	Serine/threonine-protein	no	N/A	0.284	0.727	0.690	3e-95

>sp\|P62138\|PP1A_RAT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus GN=Ppp1ca PE=1 SV=1	Back alignment and function desciption

 Score =  351 bits (900), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 165/236 (69%), Positives = 192/236 (81%), Gaps = 1/236 (0%)

Query: 1   MSQVDSLNLDSIINRLIDID-ARSGRNVNLHESEISALCRVSREIFLSEPMLLELGTPLK 59
           MS  + LNLDSII RL+++  +R G+NV L E+EI  LC  SREIFLS+P+LLEL  PLK
Sbjct: 1   MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK 60

Query: 60  ICGDIHGQYLDLLMLFDYGKYPPKSRYLFLGDYVDRGSNSLETICLLLAYKIKYPGMFHL 119
           ICGDIHGQY DLL LF+YG +PP+S YLFLGDYVDRG  SLETICLLLAYKIKYP  F L
Sbjct: 61  ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL 120

Query: 120 LRGNHECANINKVYGFYDECKRRYNVKLWKTFTECFNCMPVAAIVDEKIFCCHGGLSPYL 179
           LRGNHECA+IN++YGFYDECKRRYN+KLWKTFT+CFNC+P+AAIVDEKIFCCHGGLSP L
Sbjct: 121 LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL 180

Query: 180 SSIDQIRRISRPTRVPEQGLLCDLLWSDPEKAAESQLTIVRQVRFHAEVKLGAHYL 235
            S++QIRRI RPT VP+QGLLCDLLWSDP+K  +      R V F    ++ A +L
Sbjct: 181 QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFL 236

Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca(2+)/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Regulates NEK2 function in terms of kinase activity and centrosome number and splitting, both in the presence and absence of radiation-induced DNA damage. Regulator of neural tube and optic fissure closure, and enteric neural crest cell (ENCCs) migration during development.
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6

>sp\|P62139\|PP1A_RABIT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CA PE=1 SV=1	Back alignment and function description

>sp\|P62136\|PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens GN=PPP1CA PE=1 SV=1	Back alignment and function description

>sp\|Q3T0E7\|PP1A_BOVIN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Bos taurus GN=PPP1CA PE=2 SV=1	Back alignment and function description

>sp\|Q6NVU2\|PPIG_XENTR Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Xenopus tropicalis GN=ppp1cc PE=2 SV=1	Back alignment and function description

>sp\|P36874\|PP1GA_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A OS=Xenopus laevis GN=ppp1cc-a PE=1 SV=2	Back alignment and function description

>sp\|Q7SZ10\|PP1GB_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit B OS=Xenopus laevis GN=ppp1cc-b PE=2 SV=1	Back alignment and function description

>sp\|P63088\|PP1G_RAT Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Rattus norvegicus GN=Ppp1cc PE=1 SV=1	Back alignment and function description

>sp\|P63087\|PP1G_MOUSE Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Mus musculus GN=Ppp1cc PE=1 SV=1	Back alignment and function description

>sp\|P61287\|PP1G_BOVIN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Bos taurus GN=PPP1CC PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		826
225719040		329	Serine/threonine-protein phosphatase PP1	0.284	0.714	0.699	3e-94
443726554		329	hypothetical protein CAPTEDRAFT_150639 [	0.284	0.714	0.694	4e-94
189238091		327	PREDICTED: similar to protein phosphatas	0.254	0.642	0.767	6e-94
348522267		323	PREDICTED: serine/threonine-protein phos	0.254	0.650	0.758	1e-93
4506003		330	serine/threonine-protein phosphatase PP1	0.284	0.712	0.699	1e-93
350536263		342	putative protein phosphatase 1 catalytic	0.284	0.687	0.694	1e-93
1535		330	unnamed protein product [Oryctolagus cun	0.284	0.712	0.699	1e-93
405945066		331	Chain A, Protein SerTHR PHOSPHATASE-1 In	0.284	0.709	0.699	1e-93
393277		323	protein phosphatase 1-gamma 1 [Xenopus l	0.284	0.727	0.694	1e-93
47497994		323	serine/threonine-protein phosphatase PP1	0.284	0.727	0.694	1e-93

>gi\|225719040\|gb\|ACO15366.1\| Serine/threonine-protein phosphatase PP1-beta [Caligus clemensi]	Back alignment and taxonomy information

 Score =  353 bits (905), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 165/236 (69%), Positives = 192/236 (81%), Gaps = 1/236 (0%)

Query: 1   MSQVDSLNLDSIINRLIDI-DARSGRNVNLHESEISALCRVSREIFLSEPMLLELGTPLK 59
           M + D++N+DSII RL+++  +R GRNV L E EI  LC  SREIFLS+P+LLEL  PLK
Sbjct: 1   MPETDTVNIDSIIARLLEVRGSRPGRNVQLSEDEIKGLCLRSREIFLSQPILLELEAPLK 60

Query: 60  ICGDIHGQYLDLLMLFDYGKYPPKSRYLFLGDYVDRGSNSLETICLLLAYKIKYPGMFHL 119
           ICGDIHGQY DLL LF+YG +PP+S YLFLGDYVDRG  SLETICLLLAYKIKYP  F L
Sbjct: 61  ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL 120

Query: 120 LRGNHECANINKVYGFYDECKRRYNVKLWKTFTECFNCMPVAAIVDEKIFCCHGGLSPYL 179
           LRGNHECA+IN++YGFYDECKRRYNVK+WKTFT+CFNC+PVAAIVDEKIFCCHGGLSP L
Sbjct: 121 LRGNHECASINRIYGFYDECKRRYNVKIWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDL 180

Query: 180 SSIDQIRRISRPTRVPEQGLLCDLLWSDPEKAAESQLTIVRQVRFHAEVKLGAHYL 235
            +++QIRRI RPT VP+QGLLCDLLWSDP+K A       R V F    ++ A +L
Sbjct: 181 QTMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDAMGWAENDRGVSFTFGQEIAAKFL 236

Source: Caligus clemensi

Species: Caligus clemensi

Genus: Caligus

Family: Caligidae

Order: Siphonostomatoida

Class: Maxillopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|443726554\|gb\|ELU13673.1\| hypothetical protein CAPTEDRAFT_150639 [Capitella teleta]	Back alignment and taxonomy information

>gi\|189238091\|ref\|XP_001813974.1\| PREDICTED: similar to protein phosphatase 1, catalytic subunit, alpha isoform 1 [Tribolium castaneum] gi\|270008741\|gb\|EFA05189.1\| hypothetical protein TcasGA2_TC015321 [Tribolium castaneum]	Back alignment and taxonomy information

>gi|348522267|ref|XP_003448647.1| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like [Oreochromis niloticus] gi|410922301|ref|XP_003974621.1| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like [Takifugu rubripes] gi|432875392|ref|XP_004072819.1| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like isoform 1 [Oryzias latipes]

Back alignment and taxonomy information

>gi|4506003|ref|NP_002699.1| serine/threonine-protein phosphatase PP1-alpha catalytic subunit isoform 1 [Homo sapiens] gi|13928710|ref|NP_113715.1| serine/threonine-protein phosphatase PP1-alpha catalytic subunit [Rattus norvegicus] gi|78369446|ref|NP_001030393.1| serine/threonine-protein phosphatase PP1-alpha catalytic subunit [Bos taurus] gi|113205690|ref|NP_001038024.1| protein phosphatase 1 catalytic subunit alpha isoform [Sus scrofa] gi|297267307|ref|XP_002799514.1| PREDICTED: serine/threonine-protein phosphatase PP1-alpha catalytic subunit-like isoform 2 [Macaca mulatta] gi|301771820|ref|XP_002921324.1| PREDICTED: serine/threonine-protein phosphatase PP1-alpha catalytic subunit-like [Ailuropoda melanoleuca] gi|332249653|ref|XP_003273972.1| PREDICTED: serine/threonine-protein phosphatase PP1-alpha catalytic subunit isoform 1 [Nomascus leucogenys] gi|332837056|ref|XP_001151893.2| PREDICTED: serine/threonine-protein phosphatase PP1-alpha catalytic subunit isoform 1 [Pan troglodytes] gi|348565091|ref|XP_003468337.1| PREDICTED: serine/threonine-protein phosphatase PP1-alpha catalytic subunit-like isoform 1 [Cavia porcellus] gi|354495736|ref|XP_003509985.1| PREDICTED: serine/threonine-protein phosphatase PP1-alpha catalytic subunit-like [Cricetulus griseus] gi|395742377|ref|XP_002821493.2| PREDICTED: serine/threonine-protein phosphatase PP1-alpha catalytic subunit isoform 1 [Pongo abelii] gi|395851661|ref|XP_003798371.1| PREDICTED: serine/threonine-protein phosphatase PP1-alpha catalytic subunit isoform 1 [Otolemur garnettii] gi|402892662|ref|XP_003909528.1| PREDICTED: serine/threonine-protein phosphatase PP1-alpha catalytic subunit isoform 1 [Papio anubis] gi|426252118|ref|XP_004019765.1| PREDICTED: serine/threonine-protein phosphatase PP1-alpha catalytic subunit isoform 1 [Ovis aries] gi|426369413|ref|XP_004051684.1| PREDICTED: serine/threonine-protein phosphatase PP1-alpha catalytic subunit isoform 1 [Gorilla gorilla gorilla] gi|49065778|sp|P62138.1|PP1A_RAT RecName: Full=Serine/threonine-protein phosphatase PP1-alpha catalytic subunit; Short=PP-1A gi|49065811|sp|P62136.1|PP1A_HUMAN RecName: Full=Serine/threonine-protein phosphatase PP1-alpha catalytic subunit; Short=PP-1A gi|49065813|sp|P62139.1|PP1A_RABIT RecName: Full=Serine/threonine-protein phosphatase PP1-alpha catalytic subunit; Short=PP-1A gi|108860895|sp|Q3T0E7.1|PP1A_BOVIN RecName: Full=Serine/threonine-protein phosphatase PP1-alpha catalytic subunit; Short=PP-1A gi|1633403|pdb|1FJM|A Chain A, Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isoform, Type 1) Complexed With Microcystin-Lr Toxin gi|1633404|pdb|1FJM|B Chain B, Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isoform, Type 1) Complexed With Microcystin-Lr Toxin gi|1679|emb|CAA32941.1| unnamed protein product [Oryctolagus cuniculus] gi|35451|emb|CAA50197.1| serine/threonine specific protein phosphatase [Homo sapiens] gi|190516|gb|AAA36508.1| protein phosphatase-1 [Homo sapiens] gi|220865|dbj|BAA14194.1| protein phosphatase 1, catalytic subunit [Rattus norvegicus] gi|220867|dbj|BAA00732.1| protein phosphatase type 1 alpha catalytic subunit [Rattus norvegicus] gi|999339|gb|AAB34333.1| protein phosphatase 1 alpha [Rattus sp.] gi|12804879|gb|AAH01888.1| Protein phosphatase 1, catalytic subunit, alpha isoform [Homo sapiens] gi|13325343|gb|AAH04482.1| Protein phosphatase 1, catalytic subunit, alpha isoform [Homo sapiens] gi|14124968|gb|AAH08010.1| Protein phosphatase 1, catalytic subunit, alpha isoform [Homo sapiens] gi|30582097|gb|AAP35275.1| protein phosphatase 1, catalytic subunit, alpha isoform [Homo sapiens] gi|47683037|gb|AAH70517.1| Protein phosphatase 1, catalytic subunit, alpha isoform [Rattus norvegicus] gi|60656413|gb|AAX32770.1| protein phosphatase 1 catalytic subunit alpha isoform [synthetic construct] gi|74267665|gb|AAI02425.1| Protein phosphatase 1, catalytic subunit, alpha isoform [Bos taurus] gi|87621715|gb|ABD38708.1| protein phosphatase 1 catalytic subunit alpha isoform [Sus scrofa] gi|149061962|gb|EDM12385.1| protein phosphatase 1, catalytic subunit, alpha isoform, isoform CRA_a [Rattus norvegicus] gi|189069323|dbj|BAG36355.1| unnamed protein product [Homo sapiens] gi|387539934|gb|AFJ70594.1| serine/threonine-protein phosphatase PP1-alpha catalytic subunit isoform 1 [Macaca mulatta] gi|417399055|gb|JAA46559.1| Putative protein phosphatase 1 catalytic subunit alpha isoform [Desmodus rotundus] gi|227433|prf||1703469A protein phosphatase 1 alpha gi|1582003|prf||2117365A protein phosphatase 1:ISOTYPE=alpha

Back alignment and taxonomy information

>gi\|350536263\|ref\|NP_001232237.1\| putative protein phosphatase 1 catalytic subunit alpha [Taeniopygia guttata] gi\|197127212\|gb\|ACH43710.1\| putative protein phosphatase 1 catalytic subunit alpha [Taeniopygia guttata]	Back alignment and taxonomy information

>gi\|1535\|emb\|CAA30645.1\| unnamed protein product [Oryctolagus cuniculus]	Back alignment and taxonomy information

>gi\|405945066\|pdb\|4G9J\|A Chain A, Protein SerTHR PHOSPHATASE-1 In Complex With Cell-Permeable Peptide gi\|405945067\|pdb\|4G9J\|B Chain B, Protein SerTHR PHOSPHATASE-1 In Complex With Cell-Permeable Peptide	Back alignment and taxonomy information

>gi\|393277\|gb\|AAA49934.1\| protein phosphatase 1-gamma 1 [Xenopus laevis]	Back alignment and taxonomy information

>gi|47497994|ref|NP_998835.1| serine/threonine-protein phosphatase PP1-gamma catalytic subunit [Xenopus (Silurana) tropicalis] gi|147900808|ref|NP_001081308.1| serine/threonine-protein phosphatase PP1-gamma catalytic subunit A [Xenopus laevis] gi|82202196|sp|Q6NVU2.1|PPIG_XENTR RecName: Full=Serine/threonine-protein phosphatase PP1-gamma catalytic subunit; Short=PP-1G gi|224471849|sp|P36874.2|PP1GA_XENLA RecName: Full=Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A; Short=PP-1G-A; Short=xPP1-gamma1 gi|45709760|gb|AAH67911.1| protein phosphatase 1, catalytic subunit, gamma isoform [Xenopus (Silurana) tropicalis] gi|58702012|gb|AAH90213.1| LOC397767 protein [Xenopus laevis] gi|89266681|emb|CAJ81429.1| protein phosphatase 1, catalytic subunit, gamma isoform [Xenopus (Silurana) tropicalis] gi|138999376|dbj|BAF51554.1| protein phosphatase 1 gamma 1 [Xenopus laevis]

Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		826
UNIPROTKB\|P36874		323	ppp1cc-a "Serine/threonine-pro	0.254	0.650	0.753	7.5e-89
UNIPROTKB\|Q6NVU2		323	ppp1cc "Serine/threonine-prote	0.254	0.650	0.753	7.5e-89
UNIPROTKB\|Q7SZ10		323	ppp1cc-b "Serine/threonine-pro	0.254	0.650	0.753	7.5e-89
ZFIN\|ZDB-GENE-030131-5877		323	ppp1cc "protein phosphatase 1,	0.254	0.650	0.748	7.5e-89
UNIPROTKB\|Q5ZL39		323	LOC100858156 "Serine/threonine	0.254	0.650	0.748	9.6e-89
UNIPROTKB\|P61287		323	PPP1CC "Serine/threonine-prote	0.254	0.650	0.748	9.6e-89
UNIPROTKB\|Q3T0E7		330	PPP1CA "Serine/threonine-prote	0.284	0.712	0.699	9.6e-89
UNIPROTKB\|E2QXE0		337	PPP1CC "Serine/threonine-prote	0.254	0.623	0.748	9.6e-89
UNIPROTKB\|L7N0D0		330	PPP1CA "Serine/threonine-prote	0.284	0.712	0.699	9.6e-89
UNIPROTKB\|P62136		330	PPP1CA "Serine/threonine-prote	0.284	0.712	0.699	9.6e-89

UNIPROTKB\|P36874 ppp1cc-a "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

 Score = 887 (317.3 bits), Expect = 7.5e-89, P = 7.5e-89
 Identities = 159/211 (75%), Positives = 184/211 (87%)

Query:     1 MSQVDSLNLDSIINRLIDI-DARSGRNVNLHESEISALCRVSREIFLSEPMLLELGTPLK 59
             M+ VD LN+DSII RL+++  ++ G+NV L E+EI  LC  SREIFLS+P+LLEL  PLK
Sbjct:     1 MADVDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK 60

Query:    60 ICGDIHGQYLDLLMLFDYGKYPPKSRYLFLGDYVDRGSNSLETICLLLAYKIKYPGMFHL 119
             ICGDIHGQY DLL LF+YG +PP+S YLFLGDYVDRG  SLETICLLLAYKIKYP  F L
Sbjct:    61 ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL 120

Query:   120 LRGNHECANINKVYGFYDECKRRYNVKLWKTFTECFNCMPVAAIVDEKIFCCHGGLSPYL 179
             LRGNHECA+IN++YGFYDECKRRYN+KLWKTFT+CFNC+P+AAIVDEKIFCCHGGLSP L
Sbjct:   121 LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL 180

Query:   180 SSIDQIRRISRPTRVPEQGLLCDLLWSDPEK 210
              S++QIRRI RPT VP+QGLLCDLLWSDP+K
Sbjct:   181 QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK 211

GO:0004722 "protein serine/threonine phosphatase activity" evidence=IDA

GO:0005515 "protein binding" evidence=IPI

GO:0005739 "mitochondrion" evidence=ISS

GO:0006470 "protein dephosphorylation" evidence=IDA

GO:0007084 "mitotic nuclear envelope reassembly" evidence=IMP

GO:0016020 "membrane" evidence=IDA

UNIPROTKB\|Q6NVU2 ppp1cc "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit" [Xenopus (Silurana) tropicalis (taxid:8364)]	Back alignment and assigned GO terms

UNIPROTKB\|Q7SZ10 ppp1cc-b "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit B" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-5877 ppp1cc "protein phosphatase 1, catalytic subunit, gamma isoform" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ZL39 LOC100858156 "Serine/threonine-protein phosphatase" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|P61287 PPP1CC "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3T0E7 PPP1CA "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QXE0 PPP1CC "Serine/threonine-protein phosphatase" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|L7N0D0 PPP1CA "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|P62136 PPP1CA "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q3T0E7	PP1A_BOVIN	3, ., 1, ., 3, ., 1, 6	0.6991	0.2845	0.7121	yes	N/A
Q8MJ46	PP1G_CANFA	3, ., 1, ., 3, ., 1, 6	0.6864	0.2845	0.7275	yes	N/A
P12982	PP12_DROME	3, ., 1, ., 3, ., 1, 6	0.6982	0.2796	0.7649	yes	N/A
P20654	PP1_EMENI	3, ., 1, ., 3, ., 1, 6	0.7038	0.2481	0.6346	yes	N/A
P48461	PP11_DROME	3, ., 1, ., 3, ., 1, 6	0.7681	0.2493	0.6299	yes	N/A
P48484	PP14_ARATH	3, ., 1, ., 3, ., 1, 6	0.6778	0.2506	0.6448	yes	N/A
Q6NVU2	PPIG_XENTR	3, ., 1, ., 3, ., 1, 6	0.6949	0.2845	0.7275	yes	N/A
P32598	PP12_YEAST	3, ., 1, ., 3, ., 1, 6	0.6878	0.2469	0.6538	yes	N/A
O15757	PP1_DICDI	3, ., 1, ., 3, ., 1, 6	0.6941	0.2481	0.6386	yes	N/A
P48727	GLC7B_CAEEL	3, ., 1, ., 3, ., 1, 6	0.6952	0.2808	0.6966	yes	N/A
P13681	PP11_SCHPO	3, ., 1, ., 3, ., 1, 6	0.7109	0.2530	0.6391	yes	N/A
P62136	PP1A_HUMAN	3, ., 1, ., 3, ., 1, 6	0.6991	0.2845	0.7121	yes	N/A
P63087	PP1G_MOUSE	3, ., 1, ., 3, ., 1, 6	0.6906	0.2845	0.7275	yes	N/A
P62138	PP1A_RAT	3, ., 1, ., 3, ., 1, 6	0.6991	0.2845	0.7121	yes	N/A
P62139	PP1A_RABIT	3, ., 1, ., 3, ., 1, 6	0.6991	0.2845	0.7121	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.1.3.16	0.737
3rd Layer	3.1.3	0.691
3rd Layer	3.6.1.17	LOW CONFIDENCE prediction!
3rd Layer	3.4.21	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		826
cd07414		293	cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-li	1e-135
PTZ00480		320	PTZ00480, PTZ00480, serine/threonine-protein phosp	1e-109
smart00156		271	smart00156, PP2Ac, Protein phosphatase 2A homologu	2e-92
cd07415		285	cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos	3e-87
PTZ00244		294	PTZ00244, PTZ00244, serine/threonine-protein phosp	2e-84
cd07416		305	cd07416, MPP_PP2B, PP2B, metallophosphatase domain	7e-68
cd07419		311	cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 pho	2e-67
PTZ00239		303	PTZ00239, PTZ00239, serine/threonine protein phosp	3e-66
cd07417		316	cd07417, MPP_PP5_C, PP5, C-terminal metallophospha	6e-60
cd00144		225	cd00144, MPP_PPP_family, phosphoprotein phosphatas	2e-54
cd07420		321	cd07420, MPP_RdgC, Drosophila melanogaster RdgC an	2e-31
pfam00149		185	pfam00149, Metallophos, Calcineurin-like phosphoes	4e-29
cd07418		377	cd07418, MPP_PP7, PP7, metallophosphatase domain	2e-28
smart00020		229	smart00020, Tryp_SPc, Trypsin-like serine protease	3e-19
cd00190		232	cd00190, Tryp_SPc, Trypsin-like serine protease; M	1e-18
pfam11911		140	pfam11911, DUF3429, Protein of unknown function (D	6e-14
COG0639		155	COG0639, ApaH, Diadenosine tetraphosphatase and re	9e-14
cd07424		207	cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophos	3e-11
pfam00089		218	pfam00089, Trypsin, Trypsin	1e-10
cd07425		208	cd07425, MPP_Shelphs, Shewanella-like phosphatases	8e-06
cd07423		234	cd07423, MPP_PrpE, Bacillus subtilis PrpE and rela	1e-05
cd00838		131	cd00838, MPP_superfamily, metallophosphatase super	4e-05
cd07413		222	cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087	6e-05
cd07421		304	cd07421, MPP_Rhilphs, Rhilph phosphatases, metallo	3e-04
TIGR04075		851	TIGR04075, bacter_Pnkp, polynucleotide kinase-phos	0.002
PHA02239		235	PHA02239, PHA02239, putative protein phosphatase	0.002
smart00020		229	smart00020, Tryp_SPc, Trypsin-like serine protease	0.003
cd00190		232	cd00190, Tryp_SPc, Trypsin-like serine protease; M	0.003
PRK13625		245	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphospha	0.003

>gnl\|CDD\|163657 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain	Back alignment and domain information

 Score =  403 bits (1038), Expect = e-135
 Identities = 154/204 (75%), Positives = 178/204 (87%), Gaps = 1/204 (0%)

Query: 8   NLDSIINRLIDI-DARSGRNVNLHESEISALCRVSREIFLSEPMLLELGTPLKICGDIHG 66
           ++DSII RL+++  +R G+NV L E+EI  LC  SREIFLS+P+LLEL  PLKICGDIHG
Sbjct: 1   DIDSIIERLLEVRGSRPGKNVQLTEAEIRGLCLKSREIFLSQPILLELEAPLKICGDIHG 60

Query: 67  QYLDLLMLFDYGKYPPKSRYLFLGDYVDRGSNSLETICLLLAYKIKYPGMFHLLRGNHEC 126
           QY DLL LF+YG +PP+S YLFLGDYVDRG  SLETICLLLAYKIKYP  F LLRGNHEC
Sbjct: 61  QYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEC 120

Query: 127 ANINKVYGFYDECKRRYNVKLWKTFTECFNCMPVAAIVDEKIFCCHGGLSPYLSSIDQIR 186
           A+IN++YGFYDECKRRYN+KLWKTFT+CFNC+PVAAI+DEKIFC HGGLSP L S++QIR
Sbjct: 121 ASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIIDEKIFCMHGGLSPDLQSMEQIR 180

Query: 187 RISRPTRVPEQGLLCDLLWSDPEK 210
           RI RPT VP+QGLLCDLLWSDP+K
Sbjct: 181 RIMRPTDVPDQGLLCDLLWSDPDK 204

PP1 (protein phosphatase type 1) is a serine/threonine phosphatase that regulates many cellular processes including: cell-cycle progression, protein synthesis, muscle contraction, carbohydrate metabolism, transcription and neuronal signaling, through its interaction with at least 180 known targeting proteins. PP1 occurs in all tissues and regulates many pathways, ranging from cell-cycle progression to carbohydrate metabolism. Also included here are the PPKL (PP1 and kelch-like) enzymes including the PPQ, PPZ1, and PPZ2 fungal phosphatases. These PPKLs have a large N-terminal kelch repeat in addition to a C-terminal phosphoesterase domain. The PPP (phosphoprotein phosphatase) family, to which PP1 belongs, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 293

>gnl\|CDD\|185658 PTZ00480, PTZ00480, serine/threonine-protein phosphatase; Provisional	Back alignment and domain information

>gnl\|CDD\|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain	Back alignment and domain information

>gnl\|CDD\|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain	Back alignment and domain information

>gnl\|CDD\|140271 PTZ00244, PTZ00244, serine/threonine-protein phosphatase PP1; Provisional	Back alignment and domain information

>gnl\|CDD\|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain	Back alignment and domain information

>gnl\|CDD\|163662 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain	Back alignment and domain information

>gnl\|CDD\|173488 PTZ00239, PTZ00239, serine/threonine protein phosphatase 2A; Provisional	Back alignment and domain information

>gnl\|CDD\|163660 cd07417, MPP_PP5_C, PP5, C-terminal metallophosphatase domain	Back alignment and domain information

>gnl\|CDD\|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain	Back alignment and domain information

>gnl\|CDD\|163663 cd07420, MPP_RdgC, Drosophila melanogaster RdgC and related proteins, metallophosphatase domain	Back alignment and domain information

>gnl\|CDD\|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase	Back alignment and domain information

>gnl\|CDD\|163661 cd07418, MPP_PP7, PP7, metallophosphatase domain	Back alignment and domain information

>gnl\|CDD\|214473 smart00020, Tryp_SPc, Trypsin-like serine protease	Back alignment and domain information

>gnl\|CDD\|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms	Back alignment and domain information

>gnl\|CDD\|221308 pfam11911, DUF3429, Protein of unknown function (DUF3429)	Back alignment and domain information

>gnl\|CDD\|223712 COG0639, ApaH, Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|163667 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophosphatase domain	Back alignment and domain information

>gnl\|CDD\|215708 pfam00089, Trypsin, Trypsin	Back alignment and domain information

>gnl\|CDD\|163668 cd07425, MPP_Shelphs, Shewanella-like phosphatases, metallophosphatase domain	Back alignment and domain information

>gnl\|CDD\|163666 cd07423, MPP_PrpE, Bacillus subtilis PrpE and related proteins, metallophosphatase domain	Back alignment and domain information

>gnl\|CDD\|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain	Back alignment and domain information

>gnl\|CDD\|163656 cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain	Back alignment and domain information

>gnl\|CDD\|163664 cd07421, MPP_Rhilphs, Rhilph phosphatases, metallophosphatase domain	Back alignment and domain information

>gnl\|CDD\|234457 TIGR04075, bacter_Pnkp, polynucleotide kinase-phosphatase	Back alignment and domain information

>gnl\|CDD\|107154 PHA02239, PHA02239, putative protein phosphatase	Back alignment and domain information

>gnl\|CDD\|214473 smart00020, Tryp_SPc, Trypsin-like serine protease	Back alignment and domain information

>gnl\|CDD\|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms	Back alignment and domain information

>gnl\|CDD\|184187 PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		826
KOG0372\|consensus		303		100.0
KOG0373\|consensus		306		100.0
KOG0374\|consensus		331		100.0
PTZ00480		320	serine/threonine-protein phosphatase; Provisional	100.0
PTZ00244		294	serine/threonine-protein phosphatase PP1; Provisio	100.0
cd07420		321	MPP_RdgC Drosophila melanogaster RdgC and related	100.0
cd07414		293	MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme	100.0
KOG0375\|consensus		517		100.0
PTZ00239		303	serine/threonine protein phosphatase 2A; Provision	100.0
cd07415		285	MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein	100.0
cd07416		305	MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca	100.0
smart00156		271	PP2Ac Protein phosphatase 2A homologues, catalytic	100.0
cd07417		316	MPP_PP5_C PP5, C-terminal metallophosphatase domai	100.0
KOG0371\|consensus		319		100.0
cd07419		311	MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a	100.0
cd07418		377	MPP_PP7 PP7, metallophosphatase domain. PP7 is a p	100.0
KOG0377\|consensus		631		99.98
PF11911		142	DUF3429: Protein of unknown function (DUF3429); In	99.97
KOG0376\|consensus		476		99.94
cd00144		225	MPP_PPP_family phosphoprotein phosphatases of the	99.88
PRK13625		245	bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision	99.86
TIGR00668		279	apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric	99.85
cd07422		257	MPP_ApaH Escherichia coli ApaH and related protein	99.85
KOG3627\|consensus		256		99.84
PRK00166		275	apaH diadenosine tetraphosphatase; Reviewed	99.83
cd07423		234	MPP_PrpE Bacillus subtilis PrpE and related protei	99.82
cd00190		232	Tryp_SPc Trypsin-like serine protease; Many of the	99.81
cd07413		222	MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat	99.8
cd07421		304	MPP_Rhilphs Rhilph phosphatases, metallophosphatas	99.78
PRK11439		218	pphA serine/threonine protein phosphatase 1; Provi	99.77
PHA02239		235	putative protein phosphatase	99.75
cd07424		207	MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do	99.74
smart00020		229	Tryp_SPc Trypsin-like serine protease. Many of the	99.73
cd07425		208	MPP_Shelphs Shewanella-like phosphatases, metallop	99.72
PRK09968		218	serine/threonine-specific protein phosphatase 2; P	99.68
PF00089		220	Trypsin: Trypsin; InterPro: IPR001254 In the MEROP	99.66
COG5640		413	Secreted trypsin-like serine protease [Posttransla	99.5
PRK09453		182	phosphodiesterase; Provisional	98.76
PF00149		200	Metallophos: Calcineurin-like phosphoesterase; Int	98.67
cd00841		155	MPP_YfcE Escherichia coli YfcE and related protein	98.53
TIGR00040		158	yfcE phosphoesterase, MJ0936 family. Members of th	98.46
PF12850		156	Metallophos_2: Calcineurin-like phosphoesterase su	98.34
cd07397		238	MPP_DevT Myxococcus xanthus DevT and related prote	98.28
cd07388		224	MPP_Tt1561 Thermus thermophilus Tt1561 and related	98.16
cd07379		135	MPP_239FB Homo sapiens 239FB and related proteins,	98.0
cd00838		131	MPP_superfamily metallophosphatase superfamily, me	97.86
cd07392		188	MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel	97.77
cd07394		178	MPP_Vps29 Homo sapiens Vps29 and related proteins,	97.75
PRK05340		241	UDP-2,3-diacylglucosamine hydrolase; Provisional	97.61
PRK11340		271	phosphodiesterase YaeI; Provisional	97.54
cd07385		223	MPP_YkuE_C Bacillus subtilis YkuE and related prot	97.52
cd07404		166	MPP_MS158 Microscilla MS158 and related proteins,	97.52
cd07403		129	MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel	97.19
TIGR03729		239	acc_ester putative phosphoesterase. Members of thi	97.11
TIGR00619		253	sbcd exonuclease SbcD. This family is based on the	97.03
COG0622		172	Predicted phosphoesterase [General function predic	96.97
PHA02546		340	47 endonuclease subunit; Provisional	96.83
cd07400		144	MPP_YydB Bacillus subtilis YydB and related protei	96.82
cd07396		267	MPP_Nbla03831 Homo sapiens Nbla03831 and related p	96.82
TIGR01854		231	lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase.	96.69
PRK04036		504	DNA polymerase II small subunit; Validated	96.66
cd07402		240	MPP_GpdQ Enterobacter aerogenes GpdQ and related p	96.59
COG0639		155	ApaH Diadenosine tetraphosphatase and related seri	96.53
cd00844		262	MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t	96.52
cd07383		199	MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase	96.51
cd07391		172	MPP_PF1019 Pyrococcus furiosus PF1019 and related	96.49
cd07390		168	MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro	96.45
cd07398		217	MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat	96.37
PRK11148		275	cyclic 3',5'-adenosine monophosphate phosphodieste	96.36
PRK10966		407	exonuclease subunit SbcD; Provisional	96.34
cd00840		223	MPP_Mre11_N Mre11 nuclease, N-terminal metallophos	96.29
PF03761		282	DUF316: Domain of unknown function (DUF316) ; Inte	96.27
TIGR00024		225	SbcD_rel_arch putative phosphoesterase, SbcD/Mre11	96.22
cd07399		214	MPP_YvnB Bacillus subtilis YvnB and related protei	96.11
cd08165		156	MPP_MPPE1 human MPPE1 and related proteins, metall	96.01
cd07393		232	MPP_DR1119 Deinococcus radiodurans DR1119 and rela	95.82
TIGR00583		405	mre11 DNA repair protein (mre11). All proteins in	95.81
COG2908		237	Uncharacterized protein conserved in bacteria [Fun	95.72
COG1409		301	Icc Predicted phosphohydrolases [General function	95.61
KOG0376\|consensus		476		95.54
cd07401		256	MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal	95.14
cd07384		171	MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re	94.82
cd07386		243	MPP_DNA_pol_II_small_archeal_C archeal DNA polymer	94.81
cd00839		294	MPP_PAPs purple acid phosphatases of the metalloph	94.8
cd07395		262	MPP_CSTP1 Homo sapiens CSTP1 and related proteins,	94.79
COG2129		226	Predicted phosphoesterases, related to the Icc pro	94.65
COG4186		186	Predicted phosphoesterase or phosphohydrolase [Gen	94.52
COG1408		284	Predicted phosphohydrolases [General function pred	94.35
cd08166		195	MPP_Cdc1_like_1 uncharacterized subgroup related t	94.28
cd07380		150	MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re	94.26
cd00845		252	MPP_UshA_N_like Escherichia coli UshA-like family,	93.5
PF09342		267	DUF1986: Domain of unknown function (DUF1986); Int	92.84
COG1407		235	Predicted ICC-like phosphoesterases [General funct	92.19
cd08163		257	MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related	90.97
PLN02533		427	probable purple acid phosphatase	90.82
COG0420		390	SbcD DNA repair exonuclease [DNA replication, reco	90.62
cd07410		277	MPP_CpdB_N Escherichia coli CpdB and related prote	90.5
cd08164		193	MPP_Ted1 Saccharomyces cerevisiae Ted1 and related	89.78
PF14582		255	Metallophos_3: Metallophosphoesterase, calcineurin	89.18
cd07408		257	MPP_SA0022_N Staphylococcus aureus SA0022 and rela	86.58
cd07412		288	MPP_YhcR_N Bacillus subtilis YhcR endonuclease and	86.49
cd07378		277	MPP_ACP5 Homo sapiens acid phosphatase 5 and relat	86.08
PF06874		640	FBPase_2: Firmicute fructose-1,6-bisphosphatase; I	85.55
TIGR00282		266	metallophosphoesterase, MG_246/BB_0505 family. A m	81.9
cd07411		264	MPP_SoxB_N Thermus thermophilus SoxB and related p	81.14

>KOG0372\|consensus	Back alignment and domain information

Probab=100.00  E-value=5.1e-54  Score=424.92  Aligned_cols=220  Identities=49%  Similarity=0.892  Sum_probs=211.0

Q ss_pred             CHHHHHHHHHccccCCCCcccCCHHHHHHHHHHHHHHHhcCCCceeeCCCeeEEecCCCCHHHHHHHHHhCCCCCCCccc
Q psy17085          8 NLDSIINRLIDIDARSGRNVNLHESEISALCRVSREIFLSEPMLLELGTPLKICGDIHGQYLDLLMLFDYGKYPPKSRYL   87 (826)
Q Consensus         8 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~ep~~l~~~~~i~viGDIHG~~~~L~~~l~~~g~~~~~~~v   87 (826)
                      ++|+.+++|.+.       ..+.+.++..||.++.++|.+|++++.++.|++|+||||||++||+.+|+..|-+++++|+
T Consensus         2 dldr~ie~L~~~-------~li~E~eV~~LC~~~~eiL~~E~NV~~i~tPvtvcGDIHGQf~Dllelf~igG~~~~t~YL   74 (303)
T KOG0372|consen    2 DLDRQIEQLRRC-------ELIAESEVKALCAKVREILVEESNVQRIDTPVTVCGDIHGQFYDLLELFRIGGDVPETNYL   74 (303)
T ss_pred             cHHHHHHHHHhc-------CCCcHHHHHHHHHHHHHHHhcCCCceecCCCcEEeecccchHHHHHHHHHhCCCCCCCceE
Confidence            488999999764       4589999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCcccCCCCCcHHHHHHHHHhhhccCCcEEEECCCChhhhhHhhhCChHHHHHHH-hHHHHHHHHHHHhcCCcEEEECC
Q psy17085         88 FLGDYVDRGSNSLETICLLLAYKIKYPGMFHLLRGNHECANINKVYGFYDECKRRY-NVKLWKTFTECFNCMPVAAIVDE  166 (826)
Q Consensus        88 flGD~VDrG~~s~evl~ll~~lk~~~p~~v~~lrGNHE~~~~~~~~gf~~e~~~~~-~~~~~~~~~~~f~~LPl~~~i~~  166 (826)
                      |||||||||.+|+|++.+|++||++||+++.+||||||.+.++..|||++||.+|| +.++|+...+.|++||++|+|++
T Consensus        75 FLGDyVDRG~~SvEt~lLLl~lK~rYP~ritLiRGNHEsRqitqvYGFY~EclrKYG~~~vWr~c~eiFdyL~l~aiid~  154 (303)
T KOG0372|consen   75 FLGDYVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSANVWRYCTEIFDYLSLAAIIDG  154 (303)
T ss_pred             eecchhccccchHHHHHHHHHHhhcCcceeEEeeccchhhhhhhhhhHHHHHHHHcCChHHHHHHHHHHHhhhHhheecC
Confidence            99999999999999999999999999999999999999999999999999999999 67999999999999999999999


Q ss_pred             cEEEEeCCCCCCcCCHHHHhhccCCCCCCCCCcccccccCCcccchhchhcccceeeEEEEEEEcceeccccc
Q psy17085        167 KIFCCHGGLSPYLSSIDQIRRISRPTRVPEQGLLCDLLWSDPEKAAESQLTIVRQVRFHAEVKLGAHYLSSQL  239 (826)
Q Consensus       167 ~il~vHgGi~~~~~~l~~i~~i~r~~~~~~~~~~~dllWsdP~~~~~~~~~~~RG~g~~l~V~~G~~~~~~~~  239 (826)
                      ++||||||++|++.++++|+.+.|..++|+.+.+||||||||++. .+|..||||.||+    ||.+.+.++.
T Consensus       155 kifCVHGGlSP~i~~lDqIr~lDR~~Eiph~g~m~DllWSDPee~-~g~~~SPRGaGyl----FG~dvv~~F~  222 (303)
T KOG0372|consen  155 KIFCVHGGLSPSIQTLDQIRVLDRKQEVPHDGAMCDLLWSDPEEG-PGWGLSPRGAGYL----FGEDVVESFL  222 (303)
T ss_pred             cEEEEcCCCCcchhhHHHHHHhhccccCCCCCcchheeccCcccC-CCcccCCCCcccc----ccHHHHHHHH
Confidence            999999999999999999999999999999999999999999976 5999999999999    9998876654

>KOG0373\|consensus	Back alignment and domain information

>KOG0374\|consensus	Back alignment and domain information

>PTZ00480 serine/threonine-protein phosphatase; Provisional	Back alignment and domain information

>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional	Back alignment and domain information

>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain	Back alignment and domain information

>KOG0375\|consensus	Back alignment and domain information

>PTZ00239 serine/threonine protein phosphatase 2A; Provisional	Back alignment and domain information

>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain	Back alignment and domain information

>cd07416 MPP_PP2B PP2B, metallophosphatase domain	Back alignment and domain information

>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain	Back alignment and domain information

>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain	Back alignment and domain information

>KOG0371\|consensus	Back alignment and domain information

>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain	Back alignment and domain information

>cd07418 MPP_PP7 PP7, metallophosphatase domain	Back alignment and domain information

>KOG0377\|consensus	Back alignment and domain information

>PF11911 DUF3429: Protein of unknown function (DUF3429); InterPro: IPR021836 This family of proteins are functionally uncharacterised	Back alignment and domain information

>KOG0376\|consensus	Back alignment and domain information

>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain	Back alignment and domain information

>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional	Back alignment and domain information

>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical)	Back alignment and domain information

>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain	Back alignment and domain information

>KOG3627\|consensus	Back alignment and domain information

>PRK00166 apaH diadenosine tetraphosphatase; Reviewed	Back alignment and domain information

>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain	Back alignment and domain information

>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms	Back alignment and domain information

>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain	Back alignment and domain information

>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional	Back alignment and domain information

>PHA02239 putative protein phosphatase	Back alignment and domain information

>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain	Back alignment and domain information

>smart00020 Tryp_SPc Trypsin-like serine protease	Back alignment and domain information

>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain	Back alignment and domain information

>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional	Back alignment and domain information

>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK09453 phosphodiesterase; Provisional	Back alignment and domain information

>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11	Back alignment and domain information

>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain	Back alignment and domain information

>TIGR00040 yfcE phosphoesterase, MJ0936 family	Back alignment and domain information

>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily []	Back alignment and domain information

>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain	Back alignment and domain information

>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain	Back alignment and domain information

>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain	Back alignment and domain information

>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional	Back alignment and domain information

>PRK11340 phosphodiesterase YaeI; Provisional	Back alignment and domain information

>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain	Back alignment and domain information

>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain	Back alignment and domain information

>TIGR03729 acc_ester putative phosphoesterase	Back alignment and domain information

>TIGR00619 sbcd exonuclease SbcD	Back alignment and domain information

>COG0622 Predicted phosphoesterase [General function prediction only]	Back alignment and domain information

>PHA02546 47 endonuclease subunit; Provisional	Back alignment and domain information

>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain	Back alignment and domain information

>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase	Back alignment and domain information

>PRK04036 DNA polymerase II small subunit; Validated	Back alignment and domain information

>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain	Back alignment and domain information

>COG0639 ApaH Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms]	Back alignment and domain information

>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain	Back alignment and domain information

>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional	Back alignment and domain information

>PRK10966 exonuclease subunit SbcD; Provisional	Back alignment and domain information

>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain	Back alignment and domain information

>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans	Back alignment and domain information

>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related	Back alignment and domain information

>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain	Back alignment and domain information

>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain	Back alignment and domain information

>TIGR00583 mre11 DNA repair protein (mre11)	Back alignment and domain information

>COG2908 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG1409 Icc Predicted phosphohydrolases [General function prediction only]	Back alignment and domain information

>KOG0376\|consensus	Back alignment and domain information

>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain	Back alignment and domain information

>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain	Back alignment and domain information

>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain	Back alignment and domain information

>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain	Back alignment and domain information

>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only]	Back alignment and domain information

>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only]	Back alignment and domain information

>COG1408 Predicted phosphohydrolases [General function prediction only]	Back alignment and domain information

>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain	Back alignment and domain information

>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain	Back alignment and domain information

>PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>COG1407 Predicted ICC-like phosphoesterases [General function prediction only]	Back alignment and domain information

>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain	Back alignment and domain information

>PLN02533 probable purple acid phosphatase	Back alignment and domain information

>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair]	Back alignment and domain information

>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain	Back alignment and domain information

>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A	Back alignment and domain information

>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain	Back alignment and domain information

>PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate []	Back alignment and domain information

>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family	Back alignment and domain information

>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		826
1fjm_A		330	Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isofor		3e-96
4g9j_A		331	Protein SerTHR PHOSPHATASE-1 In Complex With Cell-P		4e-96
3n5u_B		300	Crystal Structure Of An Rb C-Terminal Peptide Bound		5e-96
1jk7_A		323	Crystal Structure Of The Tumor-Promoter Okadaic Aci		9e-96
3egg_A		329	Crystal Structure Of A Complex Between Protein Phos		1e-95
3e7a_A		299	Crystal Structure Of Protein Phosphatase-1 Bound To		2e-95
3v4y_A		306	Crystal Structure Of The First Nuclear Pp1 Holoenzy		2e-95
2o8a_A		329	Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Leng		3e-95
1u32_A		293	Crystal Structure Of A Protein Phosphatase-1: Calci		9e-94
1s70_A		330	Complex Between Protein Ser/thr Phosphatase-1 (delt		2e-91
3p71_C		304	Crystal Structure Of The Complex Of Lcmt-1 And Pp2a		3e-52
2nyl_C		293	Crystal Structure Of Protein Phosphatase 2a (Pp2a)		3e-52
3c5w_C		310	Complex Between Pp2a-Specific Methylesterase Pme-1		4e-52
2ie4_C		309	Structure Of The Protein Phosphatase 2a Core Enzyme		4e-52
2ie3_C		309	Structure Of The Protein Phosphatase 2a Core Enzyme		4e-52
2iae_C		309	Crystal Structure Of A Protein Phosphatase 2a (Pp2a		1e-51
3fga_C		309	Structural Basis Of Pp2a And Sgo Interaction Length		1e-51
1aui_A		521	Human Calcineurin Heterodimer Length = 521		3e-45
2p6b_A		383	Crystal Structure Of Human Calcineurin In Complex W		2e-44
3ll8_A		357	Crystal Structure Of Calcineurin In Complex With Ak		2e-44
1m63_A		372	Crystal Structure Of Calcineurin-Cyclophilin-Cyclos		2e-44
1tco_A		375	Ternary Complex Of A Calcineurin A Fragment, Calcin		2e-44
1mf8_A		373	Crystal Structure Of Human Calcineurin Complexed Wi		2e-44
2jog_A		327	Structure Of The Calcineurin-Nfat Complex Length =		3e-44
1wao_1		477	Pp5 Structure Length = 477		6e-38
1s95_A		333	Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5		9e-38
3h60_A		315	Catalytic Domain Of Human SerineTHREONINE PHOSPHATA		1e-37
3icf_A		335	Structure Of Protein SerineTHREONINE PHOSPHATASE FR		2e-35
2xxl_A		408	Crystal Structure Of Drosophila Grass Clip Serine P		2e-09
3gyl_B		261	Structure Of Prostasin At 1.3 Angstroms Resolution		2e-07
3e0p_B		271	The X-Ray Structure Of Human Prostasin In Complex W		2e-07
3dfj_A		263	Crystal Structure Of Human Prostasin Length = 263		7e-07
4gaw_A		226	Crystal Structure Of Active Human Granzyme H Length		1e-06
1xx9_A		238	Crystal Structure Of The Fxia Catalytic Domain In C		1e-06
1eq9_A		222	Crystal Structure Of Fire Ant Chymotrypsin Complexe		2e-06
2f83_A		625	Crystal Structure At 2.9 Angstroms Resolution Of Hu		2e-06
3edx_B		258	Crystal Structure Of The W215aE217A MUTANT OF MURIN		3e-06
2ocv_B		259	Structural Basis Of Na+ Activation Mimicry In Murin		3e-06
2pux_B		258	Crystal Structure Of Murine Thrombin In Complex Wit		3e-06
1zhp_A		238	Crystal Structure Of The Catalytic Domain Of Coagul		4e-06
3tju_A		226	Crystal Structure Of Human Granzyme H With An Inhib		4e-06
1bbr_K		259	The Structure Of Residues 7-16 Of The A Alpha Chain		4e-06
1id5_H		256	Crystal Structure Of Bovine Thrombin Complex With P		5e-06
1mkw_K		308	The Co-Crystal Structure Of Unliganded Bovine Alpha		5e-06
1xxd_A		238	Crystal Structure Of The Fxia Catalytic Domain In C		5e-06
1zhm_A		238	Crystal Structure Of The Catalytic Domain Of The Co		5e-06
1utj_A		242	Trypsin Specificity As Elucidated By Lie Calculatio		6e-06
1bzx_E		222	The Crystal Structure Of Anionic Salmon Trypsin In		6e-06
1bit_A		237	The Crystal Structure Of Anionic Salmon Trypsin In		6e-06
1hj8_A		222	1.00 Aa Trypsin From Atlantic Salmon Length = 222		6e-06
1ekb_B		235	The Serine Protease Domain Of Enteropeptidase Bound		7e-06
1h8i_H		253	X-Ray Crystal Structure Of Human Alpha-Thrombin Wit		7e-06
2olg_A		278	Crystal Structure Of The Serine Protease Domain Of		1e-05
1bth_H		259	Structure Of Thrombin Complexed With Bovine Pancrea		1e-05
3r3g_B		259	Structure Of Human Thrombin With Residues 145-150 O		1e-05
1hyl_A		230	The 1.8 A Structure Of Collagenase From Hypoderma L		1e-05
3bg8_A		238	Crystal Structure Of Factor Xia In Complex With Cla		1e-05
1vzq_H		250	Complex Of Thrombin With Designed Inhibitor 7165 Le		1e-05
1nu9_A		291	Staphylocoagulase-prethrombin-2 Complex Length = 29		2e-05
2bdy_A		289	Thrombin In Complex With Inhibitor Length = 289		2e-05
3sqe_E		290	Crystal Structure Of Prethrombin-2 Mutant S195a In		2e-05
1nm6_A		287	Thrombin In Complex With Selective Macrocyclic Inhi		2e-05
1jwt_A		305	Crystal Structure Of Thrombin In Complex With A Nov		2e-05
1d6w_A		287	Structure Of Thrombin Complexed With Selective Non-		2e-05
1d9i_A		288	Structure Of Thrombin Complexed With Selective Non-		2e-05
1eoj_A		289	Design Of P1' And P3' Residues Of Trivalent Thrombi		2e-05
1hag_E		295	The Isomorphous Structures Of Prethrombin2, Hirugen		2e-05
2tbs_A		222	Cold-Adaption Of Enzymes: Structural Comparison Bet		2e-05
3f6u_H		240	Crystal Structure Of Human Activated Protein C (Apc		2e-05
1b7x_B		259	Structure Of Human Alpha-Thrombin Y225i Mutant Boun		2e-05
1bhx_B		147	X-Ray Structure Of The Complex Of Human Alpha Throm		2e-05
1q3x_A		328	Crystal Structure Of The Catalytic Region Of Human		2e-05
1thp_B		259	Structure Of Human Alpha-Thrombin Y225p Mutant Boun		2e-05
1mbq_A		220	Anionic Trypsin From Pacific Chum Salmon Length = 2		2e-05
1aut_C		250	Human Activated Protein C Length = 250		2e-05
2thf_B		259	Structure Of Human Alpha-thrombin Y225f Mutant Boun		2e-05
1dx5_M		259	Crystal Structure Of The Thrombin-Thrombomodulin Co		2e-05
3k65_B		308	Crystal Structure Of Prethombin-2FRAGMENT-2 Complex		2e-05
1h8d_H		260	X-Ray Structure Of The Human Alpha-Thrombin Complex		2e-05
1z8j_B		259	Crystal Structure Of The Thrombin Mutant G193p Boun		2e-05
3sor_A		238	Factor Xia In Complex With A Clorophenyl-tetrazole		2e-05
1qur_H		257	Human Alpha-Thrombin In Complex With Bivalent, Benz		3e-05
1rd3_B		259	2.5a Structure Of Anticoagulant Thrombin Variant E2		3e-05
1dm4_B		260	Ser195ala Mutant Of Human Thrombin Complexed With F		3e-05
1gj5_H		258	Selectivity At S1, H2o Displacement, Upa, Tpa, Ser1		3e-05
1abi_H		259	Structure Of The Hirulog 3-Thrombin Complex And Nat		3e-05
1wbg_B		259	Active Site Thrombin Inhibitors Length = 259		3e-05
1z8i_B		259	Crystal Structure Of The Thrombin Mutant G193a Boun		3e-05
1jou_B		259	Crystal Structure Of Native S195a Thrombin With An		3e-05
1zpz_A		238	Factor Xi Catalytic Domain Complexed With N-((R)-1-		3e-05
1mh0_A		287	Crystal Structure Of The Anticoagulant Slow Form Of		3e-05
2pgb_B		259	Inhibitor-Free Human Thrombin Mutant C191a-C220a Le		3e-05
1vr1_H		261	Specifity For Plasminogen Activator Inhibitor-1 Len		3e-05
3ee0_B		259	Crystal Structure Of The W215aE217A MUTANT OF HUMAN		3e-05
1euf_A		227	Bovine Duodenase(New Serine Protease), Crystal Stru		3e-05
1twx_B		259	Crystal Structure Of The Thrombin Mutant D221aD222K		3e-05
1tq0_B		257	Crystal Structure Of The Potent Anticoagulant Throm		3e-05
3nxp_A		424	Crystal Structure Of Human Prethrombin-1 Length = 4		3e-05
2od3_B		259	Human Thrombin Chimera With Human Residues 184a, 18		3e-05
2zps_A		222	Crystal Structure Of Anionic Trypsin Isoform 3 From		3e-05
2zpq_A		222	Crystal Structure Of Anionic Trypsin Isoform 1 From		3e-05
1bbr_H		150	The Structure Of Residues 7-16 Of The A Alpha Chain		3e-05
3tvj_B		242	Catalytic Fragment Of Masp-2 In Complex With Its Sp		3e-05
1zjk_A		403	Crystal Structure Of The Zymogen Catalytic Region O		3e-05
4fxg_H		242	Complement C4 In Complex With Masp-2 Length = 242		3e-05
1sfq_B		259	Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack		4e-05
3jz1_B		259	Crystal Structure Of Human Thrombin Mutant N143p In		4e-05
2a0q_B		257	Structure Of Thrombin In 400 Mm Potassium Chloride		4e-05
2bvr_H		252	Human Thrombin Complexed With Fragment-based Small		4e-05
3gic_B		250	Structure Of Thrombin Mutant Delta(146-149e) In The		4e-05
1iau_A		227	Human Granzyme B In Complex With Ac-Iepd-Cho Length		5e-05
1fq3_A		227	Crystal Structure Of Human Granzyme B Length = 227		5e-05
4dgj_A		235	Structure Of A Human Enteropeptidase Light Chain Va		7e-05
1dlk_B		230	Crystal Structure Analysis Of Delta-Chymotrypsin Bo		7e-05
2cga_A		245	Bovine Chymotrypsinogen A. X-Ray Crystal Structure		7e-05
4igd_A		406	Crystal Structure Of The Zymogen Catalytic Region O		8e-05
2hnt_E		81	Crystallographic Structure Of Human Gamma-Thrombin		9e-05
1zhr_A		238	Crystal Structure Of The Catalytic Domain Of Coagul		9e-05
1zjd_A		237	Crystal Structure Of The Catalytic Domain Of Coagul		9e-05
1zlr_A		237	Factor Xi Catalytic Domain Complexed With 2-Guanidi		9e-05
2gp9_B		259	Crystal Structure Of The Slow Form Of Thrombin In A		1e-04
1fiw_A		290	Three-Dimensional Structure Of Beta-Acrosin From Ra		1e-04
3gov_B		251	Crystal Structure Of The Catalytic Region Of Human		1e-04
2zpr_A		222	Crystal Structure Of Anionic Trypsin Isoform 2 From		4e-04
1fi8_A		228	Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Ie		6e-04
3fzz_A		227	Structure Of Grc Length = 227		6e-04
3g01_A		227	Structure Of Grc Mutant E192rE193G Length = 227		6e-04
1mtn_B		131	Bovine Alpha-Chymotrypsin:bpti Crystallization Leng		9e-04

>pdb|1FJM|A Chain A, Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isoform, Type 1) Complexed With Microcystin-Lr Toxin Length = 330