Psyllid ID: psy17092


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
EILSPSFGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQLTEWLGVEVEEDQVVMSHTPIKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVVTVDSIRNAHPLLDCVDHRRRVSLFPRYCSRAQSLLSSELKITDRSLDHKAKIGRSEATTHTIEPQKR
ccccccEEEEEEccEEEEEccEEcccHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHHHcccccccEEEccHHHHHHHHcccccEEEEEcccHHHHHHHHccccEEEcHHHHHHHcccccccccccccccccccccHHHHHHcccccccccccccccccEEEEccccccccccc
ccccccEEEEEEccEEEEEccccccHHHHHHHHHHccccccEEEEEEEEEccccccHHHHHHHHHHHcccccccccEEEcccHHHHHHHHcccEEEEEcccHHHHHHHHcccccEEcHHHHHHHccccccccccccccccccccHHHHHHHccEEEEcccccccccEEccccccccccccccc
eilspsfglifdidgvlvrgkqvlpgvqDTFMNkltnsggrfvvPTVFVtnagnslaADKAKQLTEWLgveveedqvvmshtpikmlhkyhtkhtlisgqgpMEEIAKRLGFNKVVTVDsirnahplldcvdhrrrvslfpRYCSRAQSLLSSelkitdrsldhkakigrseatthtiepqkr
EILSPSFGLIFDIDGVLVRGKQVLPGVQDTFMNKltnsggrfVVPTVFVTNAGNSLAADKAKQLTEWLGVEVEEDQVVMSHTPIKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVVTVDSIrnahplldcvdhrrRVSLFPRYCSRAqsllsselkitdrsldhkakigrseatthtiepqkr
EILSPSFGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQLTEWLGVEVEEDQVVMSHTPIKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVVTVDSIRNAHPLLDCVDHRRRVSLFPRYCSRAQSLLSSELKITDRSLDHKAKIGRSEATTHTIEPQKR
*****SFGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQLTEWLGVEVEEDQVVMSHTPIKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVVTVDSIRNAHPLLDCVDHRRRVSLFPRYCSRAQSLL********************************
**LSPSFGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQLTEWLGVEVEEDQVVMSHTPIKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVVTVDSIRNAHPLLDCVDHRRRVSLFPRYCSRAQSLLSSELKITDRSLDHKAKIGRSEA**********
EILSPSFGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQLTEWLGVEVEEDQVVMSHTPIKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVVTVDSIRNAHPLLDCVDHRRRVSLFPRYCSRAQSLLSSELKITDRSLDHKAKIGRS************
**LSPSFGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQLTEWLGVEVEEDQVVMSHTPIKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVVTVDSIRNAHPLLDCVDHRRRVSLFPRYCSRAQSLLSSELKITDRSLDH***IG**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EILSPSFGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQLTEWLGVEVEEDQVVMSHTPIKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVVTVDSIRNAHPLLDCVDHRRRVSLFPRYCSRAQSLLSSELKITDRSLDHKAKIGRSEATTHTIEPQKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query183 2.2.26 [Sep-21-2011]
Q91WM2 419 Cat eye syndrome critical yes N/A 0.721 0.315 0.548 2e-36
Q9BXW7 423 Cat eye syndrome critical yes N/A 0.743 0.321 0.540 4e-36
P36151 352 Uncharacterized protein Y yes N/A 0.584 0.303 0.336 1e-07
O13899 570 Uncharacterized CDP-alcoh yes N/A 0.546 0.175 0.330 3e-06
>sp|Q91WM2|CECR5_MOUSE Cat eye syndrome critical region protein 5 homolog OS=Mus musculus GN=Cecr5 PE=2 SV=1 Back     alignment and function desciption
 Score =  151 bits (382), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 73/133 (54%), Positives = 100/133 (75%), Gaps = 1/133 (0%)

Query: 4   SPSFGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQ 63
           SP+FGL+FDIDGVLVRG +V+P   + F +KL NS G+  VP VFVTNAGN L  +KA++
Sbjct: 44  SPTFGLLFDIDGVLVRGHRVIPAALEAF-SKLVNSQGQLRVPVVFVTNAGNILQHNKAQE 102

Query: 64  LTEWLGVEVEEDQVVMSHTPIKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVVTVDSIRN 123
           L++ L  +V+ DQV++SH+P+K+  +YH+K  L+SGQGP+ E A+ LGF  VVT+D +R 
Sbjct: 103 LSDLLRCKVDPDQVILSHSPMKLFLQYHSKQMLVSGQGPLVENARALGFQNVVTIDELRL 162

Query: 124 AHPLLDCVDHRRR 136
           A P LD VD +RR
Sbjct: 163 AFPELDMVDLQRR 175





Mus musculus (taxid: 10090)
>sp|Q9BXW7|CECR5_HUMAN Cat eye syndrome critical region protein 5 OS=Homo sapiens GN=CECR5 PE=1 SV=1 Back     alignment and function description
>sp|P36151|YK50_YEAST Uncharacterized protein YKR070W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR070W PE=1 SV=1 Back     alignment and function description
>sp|O13899|YF38_SCHPO Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.08c PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
198435902 444 PREDICTED: similar to cat eye syndrome c 0.743 0.306 0.583 5e-41
260814239 433 hypothetical protein BRAFLDRAFT_279146 [ 0.803 0.339 0.536 1e-39
442753781 389 Hypothetical protein [Ixodes ricinus] 0.786 0.370 0.554 2e-39
321459587 387 hypothetical protein DAPPUDRAFT_309385 [ 0.759 0.359 0.530 3e-39
432865747 443 PREDICTED: cat eye syndrome critical reg 0.732 0.302 0.577 9e-39
45387683 429 uncharacterized protein LOC402927 [Danio 0.732 0.312 0.570 2e-38
118344582 449 cat eye syndrome candidate region 5 prot 0.732 0.298 0.577 5e-38
47223219 450 unnamed protein product [Tetraodon nigro 0.732 0.297 0.570 1e-37
58331875 432 cat eye syndrome chromosome region, cand 0.732 0.310 0.548 2e-37
118083002 415 PREDICTED: cat eye syndrome critical reg 0.743 0.327 0.510 3e-37
>gi|198435902|ref|XP_002129944.1| PREDICTED: similar to cat eye syndrome chromosome region, candidate 5 [Ciona intestinalis] Back     alignment and taxonomy information
 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 104/137 (75%), Gaps = 1/137 (0%)

Query: 5   PSFGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQL 64
           P FGL+FDIDGVL+RGK+ +P  Q  F N LT   G+F VPTVFVTNAGN+LA  KA+QL
Sbjct: 34  PGFGLLFDIDGVLIRGKKPIPAAQKAFRN-LTRPDGKFKVPTVFVTNAGNALARTKAEQL 92

Query: 65  TEWLGVEVEEDQVVMSHTPIKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVVTVDSIRNA 124
           +  +GVE+  +QV+MSH+P++M  +YH K  L+SGQGP+++IAK++GF   VT+D IRNA
Sbjct: 93  SNAMGVEITSEQVMMSHSPLRMFPEYHDKCVLLSGQGPVDDIAKKIGFTNYVTIDQIRNA 152

Query: 125 HPLLDCVDHRRRVSLFP 141
            P LD VDH+RR  L P
Sbjct: 153 FPNLDMVDHQRRPKLSP 169




Source: Ciona intestinalis

Species: Ciona intestinalis

Genus: Ciona

Family: Cionidae

Order: Enterogona

Class: Ascidiacea

Phylum: Chordata

Superkingdom: Eukaryota

>gi|260814239|ref|XP_002601823.1| hypothetical protein BRAFLDRAFT_279146 [Branchiostoma floridae] gi|229287125|gb|EEN57835.1| hypothetical protein BRAFLDRAFT_279146 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|442753781|gb|JAA69050.1| Hypothetical protein [Ixodes ricinus] Back     alignment and taxonomy information
>gi|321459587|gb|EFX70639.1| hypothetical protein DAPPUDRAFT_309385 [Daphnia pulex] Back     alignment and taxonomy information
>gi|432865747|ref|XP_004070593.1| PREDICTED: cat eye syndrome critical region protein 5-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|45387683|ref|NP_991194.1| uncharacterized protein LOC402927 [Danio rerio] gi|40807147|gb|AAH65350.1| Zgc:77375 [Danio rerio] Back     alignment and taxonomy information
>gi|118344582|ref|NP_001072058.1| cat eye syndrome candidate region 5 protein [Takifugu rubripes] gi|59857478|dbj|BAD89744.1| cat eye syndrome candidate region 5 protein [Takifugu rubripes] Back     alignment and taxonomy information
>gi|47223219|emb|CAG11354.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|58331875|ref|NP_001011089.1| cat eye syndrome chromosome region, candidate 5 homolog [Xenopus (Silurana) tropicalis] gi|54038490|gb|AAH84481.1| cat eye syndrome chromosome region, candidate 5 homolog (human) [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|118083002|ref|XP_416390.2| PREDICTED: cat eye syndrome critical region protein 5 [Gallus gallus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
ZFIN|ZDB-GENE-040426-1827 429 zgc:77375 "zgc:77375" [Danio r 0.732 0.312 0.570 2.2e-40
UNIPROTKB|E1BXT1 416 CECR5 "Uncharacterized protein 0.743 0.326 0.510 1.1e-38
UNIPROTKB|F1P1G5 400 LOC415969 "Uncharacterized pro 0.743 0.34 0.550 7.3e-38
ZFIN|ZDB-GENE-080220-59 447 zgc:175154 "zgc:175154" [Danio 0.704 0.288 0.530 1.2e-35
RGD|1306557 419 Cecr5 "cat eye syndrome chromo 0.754 0.329 0.55 6.5e-35
MGI|MGI:2136976 419 Cecr5 "cat eye syndrome chromo 0.721 0.315 0.548 2.2e-34
UNIPROTKB|F1Q482 383 CECR5 "Uncharacterized protein 0.743 0.355 0.540 2.8e-34
UNIPROTKB|Q9BXW7 423 CECR5 "Cat eye syndrome critic 0.743 0.321 0.540 4.6e-34
UNIPROTKB|F1MGI9 390 CECR5 "Uncharacterized protein 0.748 0.351 0.514 2.5e-33
UNIPROTKB|F1N6K5 401 CECR5 "Uncharacterized protein 0.748 0.341 0.514 2.5e-33
ZFIN|ZDB-GENE-040426-1827 zgc:77375 "zgc:77375" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 402 (146.6 bits), Expect = 2.2e-40, Sum P(2) = 2.2e-40
 Identities = 77/135 (57%), Positives = 99/135 (73%)

Query:     5 PSFGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQL 64
             PSFGL+FDIDGVLVRGK  +P  +  F  KL ++ G+F+VP VFVTNAGN L   KA QL
Sbjct:    30 PSFGLLFDIDGVLVRGKTPIPAAKRAFQ-KLVDTKGQFLVPVVFVTNAGNCLRQKKADQL 88

Query:    65 TEWLGVEVEEDQVVMSHTPIKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVVTVDSIRNA 124
             +  LGV + +DQV+MSH+P++M  KYH K  L+SGQGP+ +IAK +GF  VV++D +R +
Sbjct:    89 SHILGVPISQDQVMMSHSPLRMFKKYHDKFVLVSGQGPVLDIAKNVGFTNVVSIDMLRES 148

Query:   125 HPLLDCVDHRRRVSL 139
              PLLD VDH RR  L
Sbjct:   149 FPLLDMVDHNRRPKL 163


GO:0016787 "hydrolase activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
UNIPROTKB|E1BXT1 CECR5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1G5 LOC415969 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080220-59 zgc:175154 "zgc:175154" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1306557 Cecr5 "cat eye syndrome chromosome region, candidate 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2136976 Cecr5 "cat eye syndrome chromosome region, candidate 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q482 CECR5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BXW7 CECR5 "Cat eye syndrome critical region protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MGI9 CECR5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1N6K5 CECR5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9BXW7CECR5_HUMANNo assigned EC number0.54010.74310.3215yesN/A
Q91WM2CECR5_MOUSENo assigned EC number0.54880.72130.3150yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
TIGR01456 321 TIGR01456, CECR5, HAD-superfamily class IIA hydrol 6e-35
pfam13344101 pfam13344, Hydrolase_6, Haloacid dehalogenase-like 3e-22
TIGR01460236 TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Super 1e-17
COG0647269 COG0647, NagD, Predicted sugar phosphatases of the 3e-16
PLN02645 311 PLN02645, PLN02645, phosphoglycolate phosphatase 3e-05
cd01427139 cd01427, HAD_like, Haloacid dehalogenase-like hydr 4e-04
>gnl|CDD|200106 TIGR01456, CECR5, HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
 Score =  124 bits (313), Expect = 6e-35
 Identities = 46/140 (32%), Positives = 68/140 (48%), Gaps = 5/140 (3%)

Query: 7   FGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQLTE 66
           FG  FDIDGVL RGK+ + G  D    +L  + G+  +P +F+TN G      +A++++ 
Sbjct: 1   FGFAFDIDGVLFRGKKPIAGASDAL-RRLNRNQGQLKIPYIFLTNGGGFSERARAEEISS 59

Query: 67  WLGVEVEEDQVVMSHTPIKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVVTVDSIRNAHP 126
            LGV+V   QV+ SH+P K L   + K  L  G G +  +A+  GF  VV  D I     
Sbjct: 60  LLGVDVSPLQVIQSHSPYKSLVNKYEKRILAVGTGSVRGVAEGYGFQNVVHQDEIVRYFR 119

Query: 127 LLD----CVDHRRRVSLFPR 142
            +D      D +        
Sbjct: 120 DIDPFSGMSDEQVMEYSRDI 139


This hypothetical equivalog is a member of the Class IIA subfamily of the haloacid dehalogenase superfamily of aspartate-nucleophile hydrolases. The sequences modelled by this equivalog are all eukaryotes. One sequence (GP|13344995) is called "Cat Eye Syndrome critical region protein 5" (CECR5). This gene has been cloned from a pericentromere region of human chromosome 22 believed to be the location of the gene or genes responsible for Cat Eye Syndrome. This is one of a number of candidate genes. The Schizosaccharomyces pombe sequence (EGAD|138276) is annotated as "phosphatidyl synthase," however this is due entirely to a C-terminal region of the protein (outside the region of similarity of This model) which is highly homologous to a family of CDP-alcohol phosphatidyltransferases. (Thus, the annotation of GP|4226073 from C. elegans as similar to phosphatidyl synthase, is a mistake as this gene does not contain the C-terminal portion). The physical connection of the phosphatidyl synthase and the HAD-superfamily hydrolase domain in S. pombe may, however, be an important clue to the substrate for the hydrolases in this equivalog. Length = 321

>gnl|CDD|205524 pfam13344, Hydrolase_6, Haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|233422 TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>gnl|CDD|223720 COG0647, NagD, Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|178251 PLN02645, PLN02645, phosphoglycolate phosphatase Back     alignment and domain information
>gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 183
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 99.95
COG0647269 NagD Predicted sugar phosphatases of the HAD super 99.94
KOG1618|consensus 389 99.93
TIGR01456 321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 99.91
KOG2882|consensus306 99.91
PRK10444248 UMP phosphatase; Provisional 99.87
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 99.86
TIGR01452 279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 99.83
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 99.83
PLN02645 311 phosphoglycolate phosphatase 99.83
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 99.77
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 99.55
KOG3040|consensus262 99.46
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 98.92
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 98.68
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.56
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 98.55
PRK13288214 pyrophosphatase PpaX; Provisional 98.53
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 98.51
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 98.47
PRK06769173 hypothetical protein; Validated 98.41
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 98.38
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 98.38
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 98.36
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 98.36
PRK11587218 putative phosphatase; Provisional 98.35
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 98.35
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 98.34
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 98.34
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 98.31
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 98.29
TIGR01684301 viral_ppase viral phosphatase. These proteins also 98.26
PRK13226229 phosphoglycolate phosphatase; Provisional 98.26
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 98.25
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 98.24
PRK14988224 GMP/IMP nucleotidase; Provisional 98.23
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 98.21
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 98.2
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 98.19
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.17
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 98.15
COG0546220 Gph Predicted phosphatases [General function predi 98.14
PRK01158230 phosphoglycolate phosphatase; Provisional 98.14
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 98.13
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 98.13
PRK13225273 phosphoglycolate phosphatase; Provisional 98.12
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 98.11
COG0637221 Predicted phosphatase/phosphohexomutase [General f 98.11
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 98.11
PRK13222226 phosphoglycolate phosphatase; Provisional 98.1
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 98.09
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 98.09
PHA02530300 pseT polynucleotide kinase; Provisional 98.08
PLN02575381 haloacid dehalogenase-like hydrolase 98.07
PLN02770248 haloacid dehalogenase-like hydrolase family protei 98.06
PRK10513270 sugar phosphate phosphatase; Provisional 98.06
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 98.05
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 98.05
PHA02597197 30.2 hypothetical protein; Provisional 98.04
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 98.04
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.03
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 98.03
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 98.03
PLN02940 382 riboflavin kinase 98.02
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 98.02
PHA03398303 viral phosphatase superfamily protein; Provisional 98.02
PLN02954224 phosphoserine phosphatase 98.01
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 97.99
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 97.99
PRK10976266 putative hydrolase; Provisional 97.98
PRK15126 272 thiamin pyrimidine pyrophosphate hydrolase; Provis 97.98
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 97.98
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 97.96
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 97.96
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 97.96
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 97.95
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 97.91
PRK13223272 phosphoglycolate phosphatase; Provisional 97.88
PTZ00174247 phosphomannomutase; Provisional 97.88
PRK12702 302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 97.88
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 97.87
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 97.86
PRK09449224 dUMP phosphatase; Provisional 97.86
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 97.83
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 97.81
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 97.8
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 97.73
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 97.73
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 97.62
PLN02887 580 hydrolase family protein 97.61
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 97.6
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 97.6
PRK10563221 6-phosphogluconate phosphatase; Provisional 97.54
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 97.54
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 97.54
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 97.51
PRK11133322 serB phosphoserine phosphatase; Provisional 97.5
TIGR01675229 plant-AP plant acid phosphatase. This model explic 97.5
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.37
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 97.36
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 97.31
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 97.23
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 97.2
COG0241181 HisB Histidinol phosphatase and related phosphatas 97.19
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 97.16
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 97.1
COG2503274 Predicted secreted acid phosphatase [General funct 97.05
PRK14502 694 bifunctional mannosyl-3-phosphoglycerate synthase/ 97.02
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 97.02
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 97.0
KOG2914|consensus222 97.0
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 96.97
COG4850373 Uncharacterized conserved protein [Function unknow 96.97
PLN02423245 phosphomannomutase 96.93
COG3769274 Predicted hydrolase (HAD superfamily) [General fun 96.93
PRK08238 479 hypothetical protein; Validated 96.92
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 96.9
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 96.67
PRK13582205 thrH phosphoserine phosphatase; Provisional 96.53
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 96.5
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 96.47
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 96.37
PLN02779286 haloacid dehalogenase-like hydrolase family protei 96.35
KOG2961|consensus190 96.34
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 96.33
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 96.18
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 96.05
PRK10748238 flavin mononucleotide phosphatase; Provisional 95.96
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 95.82
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 95.79
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 95.52
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 95.4
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 95.39
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 95.37
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 95.35
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 95.2
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 95.14
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 95.13
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 94.84
PLN03017366 trehalose-phosphatase 94.71
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 94.69
COG4996164 Predicted phosphatase [General function prediction 94.57
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 94.53
PLN02382 413 probable sucrose-phosphatase 94.51
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 94.21
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 93.98
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 93.8
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 93.73
PLN02151354 trehalose-phosphatase 93.66
PLN02811220 hydrolase 93.06
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 93.03
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 92.91
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 92.87
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 92.11
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 92.06
PRK11590211 hypothetical protein; Provisional 92.0
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 91.42
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 91.25
PLN02580384 trehalose-phosphatase 90.75
PLN02779286 haloacid dehalogenase-like hydrolase family protei 90.72
PTZ00445219 p36-lilke protein; Provisional 89.87
KOG1615|consensus227 88.65
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 88.51
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 88.33
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 87.84
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 87.46
PRK10748238 flavin mononucleotide phosphatase; Provisional 86.61
PF06189264 5-nucleotidase: 5'-nucleotidase; InterPro: IPR0103 86.14
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 86.13
PF02358235 Trehalose_PPase: Trehalose-phosphatase; InterPro: 85.9
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 85.7
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 85.43
TIGR01497675 kdpB K+-transporting ATPase, B subunit. One sequen 84.46
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 84.28
COG3882 574 FkbH Predicted enzyme involved in methoxymalonyl-A 84.1
PRK10671834 copA copper exporting ATPase; Provisional 84.03
PF06437408 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0 84.01
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 83.47
COG0637221 Predicted phosphatase/phosphohexomutase [General f 83.4
PRK01122679 potassium-transporting ATPase subunit B; Provision 83.38
KOG2116|consensus738 83.35
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 83.15
PRK10563221 6-phosphogluconate phosphatase; Provisional 83.07
COG4087152 Soluble P-type ATPase [General function prediction 83.04
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 82.9
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 82.02
PRK14010673 potassium-transporting ATPase subunit B; Provision 81.01
PLN02811220 hydrolase 80.77
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
Probab=99.95  E-value=4.4e-27  Score=172.61  Aligned_cols=99  Identities=31%  Similarity=0.585  Sum_probs=87.1

Q ss_pred             EEEecCCeeeeCCccCccHHHHHHHHHHhcCCCccccEEEEeCCCCCCHHHHHHHHHHHhCCCCCccceeccHHHHH-HH
Q psy17092          9 LIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQLTEWLGVEVEEDQVVMSHTPIK-ML   87 (183)
Q Consensus         9 iifDiDGVL~~g~~~ipgA~e~l~~~l~~~ggk~~i~~~~lTNns~~~~~~~~~~L~~~lG~~~~~~~I~ts~~a~~-~l   87 (183)
                      |+||||||||+|.+++|||.++| ++|++.|    +|++|+|||+++++++++++|. .+|+++++++|+||+++++ ++
T Consensus         1 ~l~D~dGvl~~g~~~ipga~e~l-~~L~~~g----~~~~~lTNns~~s~~~~~~~L~-~~Gi~~~~~~i~ts~~~~~~~l   74 (101)
T PF13344_consen    1 FLFDLDGVLYNGNEPIPGAVEAL-DALRERG----KPVVFLTNNSSRSREEYAKKLK-KLGIPVDEDEIITSGMAAAEYL   74 (101)
T ss_dssp             EEEESTTTSEETTEE-TTHHHHH-HHHHHTT----SEEEEEES-SSS-HHHHHHHHH-HTTTT--GGGEEEHHHHHHHHH
T ss_pred             CEEeCccEeEeCCCcCcCHHHHH-HHHHHcC----CCEEEEeCCCCCCHHHHHHHHH-hcCcCCCcCEEEChHHHHHHHH
Confidence            79999999999999999999999 9999988    8999999999999999999997 6999999999999998876 67


Q ss_pred             Hh-cCCCeEEEEcChhHHHHHHHCCCc
Q psy17092         88 HK-YHTKHTLISGQGPMEEIAKRLGFN  113 (183)
Q Consensus        88 ~~-~~~k~v~viG~~~~~~~l~~~G~~  113 (183)
                      ++ +.+++||++|+++++++++++||+
T Consensus        75 ~~~~~~~~v~vlG~~~l~~~l~~~G~e  101 (101)
T PF13344_consen   75 KEHKGGKKVYVLGSDGLREELREAGFE  101 (101)
T ss_dssp             HHHTTSSEEEEES-HHHHHHHHHTTEE
T ss_pred             HhcCCCCEEEEEcCHHHHHHHHHcCCC
Confidence            65 678999999999999999999974



...

>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1618|consensus Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>KOG2882|consensus Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>KOG3040|consensus Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>KOG2914|consensus Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>COG4850 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2961|consensus Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>KOG1615|consensus Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PF06189 5-nucleotidase: 5'-nucleotidase; InterPro: IPR010394 This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (3 Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>KOG2116|consensus Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
3kc2_A 352 Crystal Structure Of Mitochondrial Had-Like Phospha 1e-08
3rf6_A 355 Crystal Structure Of Glycerol-3 Phosphate Bound Had 9e-08
1zjj_A263 Crystal Structure Of Hypothetical Protein Ph1952 Fr 4e-05
>pdb|3KC2|A Chain A, Crystal Structure Of Mitochondrial Had-Like Phosphatase From Saccharomyces Cerevisiae Length = 352 Back     alignment and structure

Iteration: 1

Score = 56.2 bits (134), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 38/113 (33%), Positives = 56/113 (49%), Gaps = 6/113 (5%) Query: 4 SPSFGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQ 63 S FDIDGVL RGK+ + G D KL N R +P + +TN G + + Sbjct: 11 SKKIAFAFDIDGVLFRGKKPIAGASDAL--KLLN---RNKIPYILLTNGGGFSERARTEF 65 Query: 64 LTEWLGVEVEEDQVVMSHTPIKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVV 116 ++ L V+V Q++ SHTP K L +++ L G + +A+ GF VV Sbjct: 66 ISSKLDVDVSPLQIIQSHTPYKSLVNKYSR-ILAVGTPSVRGVAEGYGFQDVV 117
>pdb|3RF6|A Chain A, Crystal Structure Of Glycerol-3 Phosphate Bound Had-Like Phosphatase From Saccharomyces Cerevisiae Length = 355 Back     alignment and structure
>pdb|1ZJJ|A Chain A, Crystal Structure Of Hypothetical Protein Ph1952 From Pyrococcus Horikoshii Ot3 Length = 263 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 6e-31
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 8e-14
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 2e-13
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 3e-13
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 2e-12
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 2e-12
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 3e-12
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 3e-12
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 4e-12
2oyc_A 306 PLP phosphatase, pyridoxal phosphate phosphatase; 3e-10
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 5e-10
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 1e-09
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Length = 352 Back     alignment and structure
 Score =  114 bits (285), Expect = 6e-31
 Identities = 39/140 (27%), Positives = 62/140 (44%), Gaps = 10/140 (7%)

Query: 1   EILSPSFGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADK 60
           +  S      FDIDGVL RGK+ + G  D  +  L  +     +P + +TN G      +
Sbjct: 8   QTTSKKIAFAFDIDGVLFRGKKPIAGASD-ALKLLNRNK----IPYILLTNGGGFSERAR 62

Query: 61  AKQLTEWLGVEVEEDQVVMSHTPIKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVVTVDS 120
            + ++  L V+V   Q++ SHTP K L   +++  L  G   +  +A+  GF  VV    
Sbjct: 63  TEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRI-LAVGTPSVRGVAEGYGFQDVVHQTD 121

Query: 121 I----RNAHPLLDCVDHRRR 136
           I    R+  P     D +  
Sbjct: 122 IVRYNRDIAPFSGLSDEQVM 141


>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Length = 263 Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Length = 264 Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Length = 250 Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} Length = 268 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} PDB: 1ys9_A 1wvi_A 1ydf_A Length = 264 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} Length = 266 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Length = 271 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Length = 259 Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Length = 306 Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Length = 284 Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Length = 271 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 99.91
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 99.67
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 99.67
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 99.65
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 99.64
2oyc_A 306 PLP phosphatase, pyridoxal phosphate phosphatase; 99.63
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 99.6
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 99.56
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 99.52
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 99.44
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 99.37
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 99.2
3ib6_A189 Uncharacterized protein; structural genomics, unkn 99.0
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 98.99
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 98.97
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.89
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 98.84
2o2x_A218 Hypothetical protein; structural genomics, joint c 98.83
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 98.81
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 98.72
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 98.71
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 98.63
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 98.62
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 98.62
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 98.59
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.51
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 98.51
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 98.51
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 98.5
3fvv_A232 Uncharacterized protein; unknown function, structu 98.49
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 98.48
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 98.47
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 98.46
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 98.45
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.42
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 98.42
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 98.42
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 98.37
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 98.37
3mmz_A176 Putative HAD family hydrolase; structural genomics 98.36
3mn1_A189 Probable YRBI family phosphatase; structural genom 98.36
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 98.35
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.35
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 98.32
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 98.3
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 98.25
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 98.24
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.24
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 98.21
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 98.21
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 98.18
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 98.18
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 98.18
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 98.16
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 98.15
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 98.14
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 98.14
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 98.13
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 98.13
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 98.13
3mpo_A 279 Predicted hydrolase of the HAD superfamily; SGX, P 98.12
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 98.12
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 98.12
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 98.09
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 98.09
3sd7_A240 Putative phosphatase; structural genomics, haloaci 98.08
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 98.06
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 98.06
4dw8_A 279 Haloacid dehalogenase-like hydrolase; HAD, putativ 98.05
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 98.04
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 98.03
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 98.03
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.02
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 98.01
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 98.0
1te2_A226 Putative phosphatase; structural genomics, phospha 97.99
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.99
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 97.99
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 97.99
1nrw_A 288 Hypothetical protein, haloacid dehalogenase-like h 97.97
1l6r_A227 Hypothetical protein TA0175; structural genomics, 97.97
1rkq_A 282 Hypothetical protein YIDA; two domain structure wi 97.96
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 97.95
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 97.95
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 97.95
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 97.94
2hsz_A243 Novel predicted phosphatase; structural genomics, 97.92
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 97.91
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 97.91
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 97.9
3dao_A283 Putative phosphatse; structural genomics, joint ce 97.9
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 97.89
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 97.89
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 97.89
2b30_A 301 Pvivax hypothetical protein; SGPP, structural geno 97.88
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 97.86
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 97.85
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 97.83
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 97.83
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 97.82
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 97.82
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 97.82
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 97.81
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 97.79
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 97.77
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 97.77
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 97.76
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 97.75
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 97.74
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 97.72
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 97.71
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 97.71
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 97.68
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 97.68
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 97.67
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 97.64
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 97.61
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 97.51
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 97.49
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 97.46
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 97.45
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 97.43
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 97.4
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 97.37
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 97.27
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 97.24
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 97.23
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 97.15
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 97.08
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 96.95
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 96.93
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 96.74
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 96.7
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 96.61
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 96.6
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 96.58
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 96.47
2zg6_A220 Putative uncharacterized protein ST2620, probable 96.43
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 96.39
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 96.34
2p11_A231 Hypothetical protein; putative haloacid dehalogena 96.26
1y8a_A 332 Hypothetical protein AF1437; structural genomics, 95.81
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 95.64
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 95.02
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 94.92
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 94.87
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 94.43
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 94.28
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 94.03
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 93.96
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 93.56
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 93.49
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 93.34
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 93.18
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 90.05
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 90.01
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 89.96
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 89.02
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 88.64
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 88.5
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 88.41
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 88.0
2zg6_A220 Putative uncharacterized protein ST2620, probable 87.48
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 86.57
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 86.2
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 85.39
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 84.72
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 83.33
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 82.69
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 82.26
4gxt_A385 A conserved functionally unknown protein; structur 82.25
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 81.65
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 81.05
1qyi_A 384 ZR25, hypothetical protein; structural genomics, P 80.96
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
Probab=99.91  E-value=2.1e-24  Score=187.87  Aligned_cols=121  Identities=30%  Similarity=0.467  Sum_probs=109.3

Q ss_pred             CCceEEEEecCCeeeeCCccCccHHHHHHHHHHhcCCCccccEEEEeCCCCCCHHHHHHHHHHHhCCCCCccceeccHHH
Q psy17092          4 SPSFGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQLTEWLGVEVEEDQVVMSHTP   83 (183)
Q Consensus         4 ~~~~~iifDiDGVL~~g~~~ipgA~e~l~~~l~~~ggk~~i~~~~lTNns~~~~~~~~~~L~~~lG~~~~~~~I~ts~~a   83 (183)
                      .+.++|+||||||||+|+.++|||.++| ++|++.|    ++++|+|||+++++++++++|.+.+|+++++++|++|+++
T Consensus        11 ~~~~~~l~D~DGvl~~g~~~~p~a~~~l-~~l~~~g----~~~~~vTNn~~~~~~~~~~~l~~~lgi~~~~~~i~ts~~~   85 (352)
T 3kc2_A           11 SKKIAFAFDIDGVLFRGKKPIAGASDAL-KLLNRNK----IPYILLTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTP   85 (352)
T ss_dssp             -CCEEEEECCBTTTEETTEECTTHHHHH-HHHHHTT----CCEEEECSCCSSCHHHHHHHHHHHHTSCCCGGGEECTTGG
T ss_pred             ccCCEEEEECCCeeEcCCeeCcCHHHHH-HHHHHCC----CEEEEEeCCCCCCchHHHHHHHHhcCCCCChhhEeehHHH
Confidence            3679999999999999999999999999 9999987    8999999999999999999998679999999999999988


Q ss_pred             HHHHHhcCCCeEEEEcChhHHHHHHHCCCceeeCHHHHHhhcCCCcc
Q psy17092         84 IKMLHKYHTKHTLISGQGPMEEIAKRLGFNKVVTVDSIRNAHPLLDC  130 (183)
Q Consensus        84 ~~~l~~~~~k~v~viG~~~~~~~l~~~G~~~~~t~~~l~~a~p~l~~  130 (183)
                      ++.+.+ ..++||++|+.+++++++.+||+.+.+..++..+.|.++|
T Consensus        86 ~~~~~~-~~~~v~viG~~~l~~~l~~~G~~~v~~~~d~~~~~~~~~p  131 (352)
T 3kc2_A           86 YKSLVN-KYSRILAVGTPSVRGVAEGYGFQDVVHQTDIVRYNRDIAP  131 (352)
T ss_dssp             GGGGTT-TCSEEEEESSTTHHHHHHHHTCSEEEEHHHHHHHCGGGCT
T ss_pred             HHHHHh-cCCEEEEECCHHHHHHHHhCCCeEecchhHhhhhcccccc
Confidence            764433 4689999999999999999999999999998888777654



>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 183
d1wvia_253 c.108.1.14 (A:) Putative phosphatase SMU.1415c {St 9e-10
d1yv9a1253 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {En 5e-09
d2c4na1250 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId 6e-09
d1vjra_261 c.108.1.14 (A:) Hypothetical protein TM1742 {Therm 8e-09
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Length = 253 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NagD-like
domain: Putative phosphatase SMU.1415c
species: Streptococcus mutans [TaxId: 1309]
 Score = 53.9 bits (128), Expect = 9e-10
 Identities = 17/108 (15%), Positives = 39/108 (36%), Gaps = 7/108 (6%)

Query: 8   GLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQLTEW 67
           G + D+DG + +GK  +P  +D F+ +L      +    + VTN          + L   
Sbjct: 4   GYLIDLDGTIYKGKDRIPAGED-FVKRLQERQLPY----ILVTNNTTRTPEMVQEMLATS 58

Query: 68  LGVEVEEDQVVMSHTPIKML--HKYHTKHTLISGQGPMEEIAKRLGFN 113
             ++   + +  +              K   + G+  +++     G+ 
Sbjct: 59  FNIKTPLETIYTATLATIDYMNDMKRGKTAYVIGETGLKKAVAEAGYR 106


>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Length = 253 Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Length = 261 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 99.79
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 99.78
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 99.75
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 99.7
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 98.96
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 98.8
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 98.75
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 98.56
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 98.5
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 98.5
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 98.45
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 98.39
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 98.31
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 98.3
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 98.29
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 98.29
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 98.28
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 98.28
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 98.22
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 98.18
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 98.16
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 98.13
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 98.08
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 98.07
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 98.06
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 98.03
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 97.99
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 97.97
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 97.97
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 97.96
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 97.95
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 97.94
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 97.91
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 97.9
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 97.86
d2b30a1 283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 97.84
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 97.82
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 97.8
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 97.74
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 97.73
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 97.67
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 97.62
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 97.38
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 97.37
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 97.33
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 97.13
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 97.09
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 96.89
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 96.78
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 96.75
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 96.3
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 96.25
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 95.95
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 95.92
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 94.35
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 89.21
d1qyia_ 380 Hypothetical protein MW1667 (SA1546) {Staphylococc 87.01
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NagD-like
domain: NagD
species: Escherichia coli [TaxId: 562]
Probab=99.79  E-value=5e-19  Score=142.92  Aligned_cols=102  Identities=25%  Similarity=0.417  Sum_probs=92.0

Q ss_pred             CCceEEEEecCCeeeeCCccCccHHHHHHHHHHhcCCCccccEEEEeCCCCCCHHHHHHHHHHHhCCCCCccceeccHHH
Q psy17092          4 SPSFGLIFDIDGVLVRGKQVLPGVQDTFMNKLTNSGGRFVVPTVFVTNAGNSLAADKAKQLTEWLGVEVEEDQVVMSHTP   83 (183)
Q Consensus         4 ~~~~~iifDiDGVL~~g~~~ipgA~e~l~~~l~~~ggk~~i~~~~lTNns~~~~~~~~~~L~~~lG~~~~~~~I~ts~~a   83 (183)
                      |.+|+|+||+|||||++..++|+|.++| +.|++.|    ++++|+|||+++++++++++|. .+|++++.++|+++..+
T Consensus         1 M~ik~VifDlDGTL~~~~~~i~~a~e~i-~~l~~~g----~~~~~~TN~~~~~~~~~~~~l~-~~G~~~~~~~i~~~~~~   74 (250)
T d2c4na1           1 MTIKNVICDIDGVLMHDNVAVPGAAEFL-HGIMDKG----LPLVLLTNYPSQTGQDLANRFA-TAGVDVPDSVFYTSAMA   74 (250)
T ss_dssp             CCCCEEEEECBTTTEETTEECTTHHHHH-HHHHHTT----CCEEEEESCCSCCHHHHHHHHH-HTTCCCCGGGEEEHHHH
T ss_pred             CCCCEEEEECCCeeEECCCcCccHHHHH-HHHHHCC----CcEEEEeCCCCCCHHHHHHHHh-hccccccceeEechHHH
Confidence            5689999999999999999999999999 9999987    8999999999999999999998 69999999999999877


Q ss_pred             HH-HHHhcCCCeEEEEcChhHHHHHHHCC
Q psy17092         84 IK-MLHKYHTKHTLISGQGPMEEIAKRLG  111 (183)
Q Consensus        84 ~~-~l~~~~~k~v~viG~~~~~~~l~~~G  111 (183)
                      +. +++..+.+++|++|.....+++....
T Consensus        75 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~  103 (250)
T d2c4na1          75 TADFLRRQEGKKAYVVGEGALIHELYKAG  103 (250)
T ss_dssp             HHHHHHTSSCCEEEEECCTHHHHHHHHTT
T ss_pred             HHHHHHhhhcccccccCCHHHHHHHHHhh
Confidence            65 56666788999999999888887543



>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure