Psyllid ID: psy17183


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MDTKIACDVLKLVRKEILIVSPFQIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSAGHSLRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPSVKVAL
cccEEEcccHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHcccccccccccccccccccEEccccccHHHHcccccccccEEEEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHHcccccccccccccccccccccc
cccEEEccHHHEEEHHHHHHcccEEEEEEEcccccEEEEEccccccccccccccccccccEEEccccHHHHHcccEEccccEEcEEEEEEccccEEEEEEEEcccEcccHHHHHHHHHHHHHHHHHccEEccccccccccEcccc
MDTKIACDVLKLVRKEILIVSPFQIIAVSVDSHLAHLAWTktltatssnrsaidpskivpllsdstHAISKTYGCylssaghslRAYYIIDkrgylrsmnvsdiqvGRNLKEILRQVEAFQlvdstdtqcpvnwttgqpsvkval
MDTKIACDVLKLVRKEILIVSPFQIIAVSVDSHLAHLAWTKTltatssnrsaidpSKIVPLLSDSTHAISKTYGCYLSSAGHSLRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQlvdstdtqcpvnwttgqpsvkval
MDTKIACDVLKLVRKEILIVSPFQIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSAGHSLRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPSVKVAL
****IACDVLKLVRKEILIVSPFQIIAVSVDSHLAHLAWTKTLTAT*********SKIVPLLSDSTHAISKTYGCYLSSAGHSLRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWT**********
MDTKIACDVLKLVRKEILIVSPFQIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSAGHSLRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPSV****
MDTKIACDVLKLVRKEILIVSPFQIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSAGHSLRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPSVKVAL
*DTKIACDVLKLVRKEILIVSPFQIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSAGHSLRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTKIACDVLKLVRKEILIVSPFQIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSAGHSLRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPSVKVAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query145 2.2.26 [Sep-21-2011]
Q13162271 Peroxiredoxin-4 OS=Homo s yes N/A 0.779 0.416 0.440 6e-24
O08807274 Peroxiredoxin-4 OS=Mus mu yes N/A 0.779 0.412 0.432 2e-23
Q9Z0V5273 Peroxiredoxin-4 OS=Rattus yes N/A 0.779 0.413 0.432 2e-23
Q9BGI2274 Peroxiredoxin-4 OS=Bos ta yes N/A 0.779 0.412 0.423 1e-22
Q9Z0V6257 Thioredoxin-dependent per no N/A 0.786 0.443 0.436 3e-22
P20108257 Thioredoxin-dependent per no N/A 0.786 0.443 0.436 3e-22
P35705257 Thioredoxin-dependent per no N/A 0.786 0.443 0.420 1e-21
Q5REY3256 Thioredoxin-dependent per no N/A 0.786 0.445 0.411 2e-21
P30048256 Thioredoxin-dependent per no N/A 0.786 0.445 0.411 2e-21
Q9JKY1199 Peroxiredoxin-1 OS=Cricet no N/A 0.786 0.572 0.403 3e-21
>sp|Q13162|PRDX4_HUMAN Peroxiredoxin-4 OS=Homo sapiens GN=PRDX4 PE=1 SV=1 Back     alignment and function desciption
 Score =  109 bits (272), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query: 24  QIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSAGHS 83
           +++A SVDS   HLAW  T       +  + P +I PLLSD TH ISK YG YL  +GH+
Sbjct: 144 EVVACSVDSQFTHLAWINT----PRRQGGLGPIRI-PLLSDLTHQISKDYGVYLEDSGHT 198

Query: 84  LRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPSV 141
           LR  +IID +G LR + ++D+ VGR++ E LR V+AFQ  D     CP  W  G  ++
Sbjct: 199 LRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETI 256




Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.
Homo sapiens (taxid: 9606)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 1EC: 5
>sp|O08807|PRDX4_MOUSE Peroxiredoxin-4 OS=Mus musculus GN=Prdx4 PE=1 SV=1 Back     alignment and function description
>sp|Q9Z0V5|PRDX4_RAT Peroxiredoxin-4 OS=Rattus norvegicus GN=Prdx4 PE=2 SV=1 Back     alignment and function description
>sp|Q9BGI2|PRDX4_BOVIN Peroxiredoxin-4 OS=Bos taurus GN=PRDX4 PE=2 SV=1 Back     alignment and function description
>sp|Q9Z0V6|PRDX3_RAT Thioredoxin-dependent peroxide reductase, mitochondrial OS=Rattus norvegicus GN=Prdx3 PE=1 SV=2 Back     alignment and function description
>sp|P20108|PRDX3_MOUSE Thioredoxin-dependent peroxide reductase, mitochondrial OS=Mus musculus GN=Prdx3 PE=1 SV=1 Back     alignment and function description
>sp|P35705|PRDX3_BOVIN Thioredoxin-dependent peroxide reductase, mitochondrial OS=Bos taurus GN=PRDX3 PE=1 SV=2 Back     alignment and function description
>sp|Q5REY3|PRDX3_PONAB Thioredoxin-dependent peroxide reductase, mitochondrial OS=Pongo abelii GN=PRDX3 PE=2 SV=1 Back     alignment and function description
>sp|P30048|PRDX3_HUMAN Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens GN=PRDX3 PE=1 SV=3 Back     alignment and function description
>sp|Q9JKY1|PRDX1_CRIGR Peroxiredoxin-1 OS=Cricetulus griseus GN=PRDX1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
239791403190 ACYPI004583 [Acyrthosiphon pisum] 0.779 0.594 0.542 2e-30
253735677 426 thioredoxin peroxidase 2-like [Acyrthosi 0.779 0.265 0.550 2e-30
193697661245 PREDICTED: peroxiredoxin-4-like [Acyrtho 0.765 0.453 0.475 5e-24
451899172245 peroxiredoxin-4 [Amphioctopus fangsiao] 0.772 0.457 0.470 8e-24
195375271244 GJ12891 [Drosophila virilis] gi|19415358 0.751 0.446 0.482 2e-23
195429068 248 GK16580 [Drosophila willistoni] gi|19415 0.751 0.439 0.482 3e-23
195135294243 GI16636 [Drosophila mojavensis] gi|19391 0.779 0.465 0.457 5e-23
359324139 257 PREDICTED: peroxiredoxin-4-like isoform 0.786 0.443 0.453 5e-23
195012352243 GH15986 [Drosophila grimshawi] gi|193897 0.779 0.465 0.457 6e-23
389611229 247 thioredoxin peroxidase 2 [Papilio polyte 0.772 0.453 0.453 6e-23
>gi|239791403|dbj|BAH72173.1| ACYPI004583 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 86/118 (72%), Gaps = 5/118 (4%)

Query: 24  QIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSAGHS 83
           +++A SVDS+L+H AW++TL    S+     P   +PLLSD TH ISK+YGCYLS  GHS
Sbjct: 77  EVVACSVDSYLSHQAWSRTL---RSDGGIAIPK--MPLLSDPTHVISKSYGCYLSELGHS 131

Query: 84  LRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPSV 141
           LRA+YIID RG LR + ++D+ VGRN+ EILR +EAFQ  D T+T CP +W  G+P++
Sbjct: 132 LRAHYIIDMRGILRHVTINDLPVGRNISEILRLLEAFQYTDETETLCPADWKPGEPTI 189




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|253735677|ref|NP_001156696.1| thioredoxin peroxidase 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193697661|ref|XP_001949571.1| PREDICTED: peroxiredoxin-4-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|451899172|gb|AGF80254.1| peroxiredoxin-4 [Amphioctopus fangsiao] Back     alignment and taxonomy information
>gi|195375271|ref|XP_002046425.1| GJ12891 [Drosophila virilis] gi|194153583|gb|EDW68767.1| GJ12891 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195429068|ref|XP_002062586.1| GK16580 [Drosophila willistoni] gi|194158671|gb|EDW73572.1| GK16580 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195135294|ref|XP_002012069.1| GI16636 [Drosophila mojavensis] gi|193918333|gb|EDW17200.1| GI16636 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|359324139|ref|XP_003640292.1| PREDICTED: peroxiredoxin-4-like isoform 3 [Canis lupus familiaris] Back     alignment and taxonomy information
>gi|195012352|ref|XP_001983600.1| GH15986 [Drosophila grimshawi] gi|193897082|gb|EDV95948.1| GH15986 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|389611229|dbj|BAM19226.1| thioredoxin peroxidase 2 [Papilio polytes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
FB|FBgn0040308242 Jafrac2 "thioredoxin peroxidas 0.779 0.466 0.457 2.3e-23
UNIPROTKB|H7C3T4161 PRDX4 "Peroxiredoxin-4" [Homo 0.786 0.708 0.445 2.3e-23
UNIPROTKB|E2RNL3272 PRDX4 "Uncharacterized protein 0.779 0.415 0.449 4.8e-23
UNIPROTKB|Q13162271 PRDX4 "Peroxiredoxin-4" [Homo 0.779 0.416 0.440 7.8e-23
ZFIN|ZDB-GENE-030131-1096260 prdx4 "peroxiredoxin 4" [Danio 0.779 0.434 0.440 1.3e-22
UNIPROTKB|F1SQ01272 PRDX4 "Uncharacterized protein 0.779 0.415 0.432 2.6e-22
MGI|MGI:1859815274 Prdx4 "peroxiredoxin 4" [Mus m 0.779 0.412 0.432 2.6e-22
RGD|620043273 Prdx4 "peroxiredoxin 4" [Rattu 0.779 0.413 0.432 2.6e-22
UNIPROTKB|F1NNS8288 PRDX4 "Uncharacterized protein 0.779 0.392 0.440 4.3e-22
MGI|MGI:88034257 Prdx3 "peroxiredoxin 3" [Mus m 0.786 0.443 0.436 1.5e-21
FB|FBgn0040308 Jafrac2 "thioredoxin peroxidase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 269 (99.8 bits), Expect = 2.3e-23, P = 2.3e-23
 Identities = 54/118 (45%), Positives = 72/118 (61%)

Query:    24 QIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSAGHS 83
             ++I VSVDSH  HLAW  T          +   KI PLLSD TH ISK YG YL S+GH+
Sbjct:   115 EVIGVSVDSHFTHLAWINT----PRKEGGLGDVKI-PLLSDLTHKISKDYGVYLESSGHA 169

Query:    84 LRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPSV 141
             LR  +IID+ G LR + ++D+ VGR++ E +R V+AFQ  D+    CP  W  G  ++
Sbjct:   170 LRGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTI 227




GO:0008379 "thioredoxin peroxidase activity" evidence=ISS;IDA;NAS
GO:0016209 "antioxidant activity" evidence=ISS;NAS
GO:0004601 "peroxidase activity" evidence=NAS
GO:0005576 "extracellular region" evidence=IDA;NAS
GO:0042744 "hydrogen peroxide catabolic process" evidence=IDA
GO:0006917 "induction of apoptosis" evidence=IGI;IMP;IPI
GO:0006915 "apoptotic process" evidence=TAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006974 "response to DNA damage stimulus" evidence=IMP
UNIPROTKB|H7C3T4 PRDX4 "Peroxiredoxin-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNL3 PRDX4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q13162 PRDX4 "Peroxiredoxin-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1096 prdx4 "peroxiredoxin 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQ01 PRDX4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1859815 Prdx4 "peroxiredoxin 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620043 Prdx4 "peroxiredoxin 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNS8 PRDX4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:88034 Prdx3 "peroxiredoxin 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
cd03015173 cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, 7e-38
COG0450194 COG0450, AhpC, Peroxiredoxin [Posttranslational mo 4e-31
PTZ00253199 PTZ00253, PTZ00253, tryparedoxin peroxidase; Provi 7e-29
TIGR03137187 TIGR03137, AhpC, peroxiredoxin 1e-20
PTZ00137261 PTZ00137, PTZ00137, 2-Cys peroxiredoxin; Provision 1e-19
PRK15000200 PRK15000, PRK15000, peroxidase; Provisional 2e-18
cd02971140 cd02971, PRX_family, Peroxiredoxin (PRX) family; c 2e-15
cd03016203 cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-c 3e-15
PRK13191215 PRK13191, PRK13191, putative peroxiredoxin; Provis 2e-14
pfam00578124 pfam00578, AhpC-TSA, AhpC/TSA family 4e-13
PRK13190202 PRK13190, PRK13190, putative peroxiredoxin; Provis 8e-13
PRK13189222 PRK13189, PRK13189, peroxiredoxin; Provisional 3e-12
PRK10382187 PRK10382, PRK10382, alkyl hydroperoxide reductase 3e-12
cd03018149 cd03018, PRX_AhpE_like, Peroxiredoxin (PRX) family 6e-11
PRK13599215 PRK13599, PRK13599, putative peroxiredoxin; Provis 4e-10
COG1225157 COG1225, Bcp, Peroxiredoxin [Posttranslational mod 7e-05
cd03017140 cd03017, PRX_BCP, Peroxiredoxin (PRX) family, Bact 4e-04
pfam1041740 pfam10417, 1-cysPrx_C, C-terminal domain of 1-Cys 0.004
>gnl|CDD|239313 cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
 Score =  126 bits (319), Expect = 7e-38
 Identities = 42/114 (36%), Positives = 60/114 (52%), Gaps = 5/114 (4%)

Query: 24  QIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSAGHS 83
           +++ VS DSH +HLAW  T          +      PLL+D    IS+ YG      G +
Sbjct: 65  EVLGVSTDSHFSHLAWRNT----PRKEGGLGKINF-PLLADPKKKISRDYGVLDEEEGVA 119

Query: 84  LRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTG 137
           LR  +IID  G +R + V+D+ VGR++ E LR ++A Q V+     CP NW  G
Sbjct: 120 LRGTFIIDPEGIIRHITVNDLPVGRSVDETLRVLDALQFVEEHGEVCPANWKPG 173


The functional unit of typical 2-cys PRX is a homodimer. A unique intermolecular redox-active disulfide center is utilized for its activity. Upon reaction with peroxides, its peroxidatic cysteine is oxidized into a sulfenic acid intermediate which is resolved by bonding with the resolving cysteine from the other subunit of the homodimer. This intermolecular disulfide bond is then reduced by thioredoxin, tryparedoxin or AhpF. Typical 2-cys PRXs, like 1-cys PRXs, form decamers which are stabilized by reduction of the active site cysteine. Typical 2-cys PRX interacts through beta strands at one edge of the monomer (B-type interface) to form the functional homodimer, and uses an A-type interface (similar to the dimeric interface in atypical 2-cys PRX and PRX5) at the opposite end of the monomer to form the stable decameric (pentamer of dimers) structure. Length = 173

>gnl|CDD|223527 COG0450, AhpC, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|140280 PTZ00253, PTZ00253, tryparedoxin peroxidase; Provisional Back     alignment and domain information
>gnl|CDD|211789 TIGR03137, AhpC, peroxiredoxin Back     alignment and domain information
>gnl|CDD|173427 PTZ00137, PTZ00137, 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|184962 PRK15000, PRK15000, peroxidase; Provisional Back     alignment and domain information
>gnl|CDD|239269 cd02971, PRX_family, Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>gnl|CDD|239314 cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>gnl|CDD|183885 PRK13191, PRK13191, putative peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|216002 pfam00578, AhpC-TSA, AhpC/TSA family Back     alignment and domain information
>gnl|CDD|106159 PRK13190, PRK13190, putative peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|237297 PRK13189, PRK13189, peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|182423 PRK10382, PRK10382, alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>gnl|CDD|239316 cd03018, PRX_AhpE_like, Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>gnl|CDD|106544 PRK13599, PRK13599, putative peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|224146 COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239315 cd03017, PRX_BCP, Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>gnl|CDD|220741 pfam10417, 1-cysPrx_C, C-terminal domain of 1-Cys peroxiredoxin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 145
COG0450194 AhpC Peroxiredoxin [Posttranslational modification 100.0
PRK15000200 peroxidase; Provisional 100.0
KOG0852|consensus196 100.0
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 100.0
PRK13191215 putative peroxiredoxin; Provisional 100.0
PRK13190202 putative peroxiredoxin; Provisional 100.0
PTZ00137261 2-Cys peroxiredoxin; Provisional 100.0
PRK13189222 peroxiredoxin; Provisional 100.0
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 100.0
PRK13599215 putative peroxiredoxin; Provisional 99.98
PTZ00253199 tryparedoxin peroxidase; Provisional 99.97
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 99.97
KOG0854|consensus224 99.96
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 99.95
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 99.93
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 99.79
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 99.79
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 99.76
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 99.73
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 99.71
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 99.69
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 99.69
KOG0855|consensus211 99.68
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 99.67
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 99.67
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 99.66
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 99.63
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 99.57
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 99.48
PLN02412167 probable glutathione peroxidase 99.48
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 99.45
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 99.44
PRK03147173 thiol-disulfide oxidoreductase; Provisional 99.44
PTZ00256183 glutathione peroxidase; Provisional 99.43
PTZ00056199 glutathione peroxidase; Provisional 99.37
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 99.36
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 99.35
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 99.31
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 99.3
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 99.26
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 99.23
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 99.22
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 99.19
cd02967114 mauD Methylamine utilization (mau) D family; mauD 99.13
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 99.13
COG2077158 Tpx Peroxiredoxin [Posttranslational modification, 99.08
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 99.07
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.01
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 98.93
PRK13728181 conjugal transfer protein TrbB; Provisional 98.92
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 98.89
COG0678165 AHP1 Peroxiredoxin [Posttranslational modification 98.87
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 98.84
KOG0541|consensus171 98.74
PRK10606183 btuE putative glutathione peroxidase; Provisional 98.73
PF13911115 AhpC-TSA_2: AhpC/TSA antioxidant enzyme 98.72
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 98.67
PF1041740 1-cysPrx_C: C-terminal domain of 1-Cys peroxiredox 98.63
TIGR02740271 TraF-like TraF-like protein. This protein is relat 97.79
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 97.61
COG0386162 BtuE Glutathione peroxidase [Posttranslational mod 97.53
PF02630174 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam 97.45
PF09695160 YtfJ_HI0045: Bacterial protein of unknown function 97.33
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 97.31
PF05988211 DUF899: Bacterial protein of unknown function (DUF 97.25
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 97.1
COG1999207 Uncharacterized protein SCO1/SenC/PrrC, involved i 97.07
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 96.97
PF13728215 TraF: F plasmid transfer operon protein 96.76
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 96.43
TIGR02739256 TraF type-F conjugative transfer system pilin asse 95.97
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 95.82
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 95.66
COG3054184 Predicted transcriptional regulator [General funct 95.53
PF00837237 T4_deiodinase: Iodothyronine deiodinase; InterPro: 95.33
PRK13703248 conjugal pilus assembly protein TraF; Provisional 95.32
PRK09381109 trxA thioredoxin; Provisional 95.31
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 95.16
PF05176252 ATP-synt_10: ATP10 protein; InterPro: IPR007849 Th 94.91
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 94.83
KOG4498|consensus197 94.75
KOG2501|consensus157 94.44
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 94.11
KOG1651|consensus171 93.73
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 93.73
cd02958114 UAS UAS family; UAS is a domain of unknown functio 93.46
COG4312247 Uncharacterized protein conserved in bacteria [Fun 93.3
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 93.06
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 92.79
PF13778118 DUF4174: Domain of unknown function (DUF4174) 92.58
KOG2792|consensus280 91.74
cd02962152 TMX2 TMX2 family; composed of proteins similar to 91.62
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 91.44
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 91.38
PF04592238 SelP_N: Selenoprotein P, N terminal region; InterP 91.35
PRK10996139 thioredoxin 2; Provisional 90.27
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 90.21
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 90.09
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 89.76
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 89.69
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 89.22
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 89.2
PRK00293571 dipZ thiol:disulfide interchange protein precursor 88.68
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 88.41
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 88.34
PF00255108 GSHPx: Glutathione peroxidase; InterPro: IPR000889 87.29
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 86.96
cd02955124 SSP411 TRX domain, SSP411 protein family; members 86.54
KOG0910|consensus150 84.47
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 83.8
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 83.79
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 83.71
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 81.62
TIGR03765105 ICE_PFL_4695 integrating conjugative element prote 81.4
KOG0907|consensus106 81.07
PHA02278103 thioredoxin-like protein 81.05
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 80.48
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=1.5e-40  Score=252.15  Aligned_cols=138  Identities=30%  Similarity=0.528  Sum_probs=132.5

Q ss_pred             ChhHHHHHHHHHhhhhhhhcCCcEEEEEeCCCHHHHHHHHHHHhhcCCCCCCCCCCCCccEEecCchHHHHHhCCCccCC
Q psy17183          1 MDTKIACDVLKLVRKEILIVSPFQIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSA   80 (145)
Q Consensus         1 ~~t~e~~~~~~~~~~~~f~~~gv~vi~VS~D~~~~~~~~~~~~~~~~~~~~~~~~~~~fpllsD~~~~va~~yg~~~~~~   80 (145)
                      .|++|+-+|+++|  ++|+++|++|||||+|+.++|.+|.+.+++..  |+.++   +|||++|.++++++.||+..++.
T Consensus        48 VCpTEi~af~~~y--~eF~~~g~eVigvS~Ds~fsH~aW~~~~~~~~--gi~~i---~~PmiaD~~~~vs~~ygvl~~~~  120 (194)
T COG0450          48 VCPTEIIAFAKRY--EEFQKRGVEVIGVSTDSVFSHKAWKATIREAG--GIGKI---KFPMIADPKGEIARAYGVLHPEE  120 (194)
T ss_pred             cCcchHHHHHhhh--HHHHHcCCEEEEEecCcHHHHHHHHhcHHhcC--Cccce---ecceEEcCchhHHHHcCCcccCC
Confidence            4999999999999  79999999999999999999999999988776  88778   99999999999999999999888


Q ss_pred             CCcceEEEEECCCCcEEEEEeecCCCCCCHHHHHHHHHhccccccCCcccCCCCCCCCCccccCC
Q psy17183         81 GHSLRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPSVKVAL  145 (145)
Q Consensus        81 g~~~p~tfIID~dG~I~~~~~~~~~~~~~~~ell~~i~~l~~~~~~~~~~p~~w~~~~~~~~~~~  145 (145)
                      |.+.|++|||||+|+|++..+++.++||+.+|+++.|++||++++|+++||+||++|+++|+|++
T Consensus       121 g~a~R~~FIIDp~g~ir~~~v~~~~iGRn~dEilR~idAlq~~~~hg~vcPanW~~G~~~i~p~~  185 (194)
T COG0450         121 GLALRGTFIIDPDGVIRHILVNPLTIGRNVDEILRVIDALQFVAKHGEVCPANWKPGDKTIKPSP  185 (194)
T ss_pred             CcceeEEEEECCCCeEEEEEEecCCCCcCHHHHHHHHHHHHHHHHhCCCccCCCCCCCccccCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999874



>PRK15000 peroxidase; Provisional Back     alignment and domain information
>KOG0852|consensus Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>KOG0854|consensus Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>KOG0855|consensus Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>COG2077 Tpx Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>COG0678 AHP1 Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>KOG0541|consensus Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>PF13911 AhpC-TSA_2: AhpC/TSA antioxidant enzyme Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>PF10417 1-cysPrx_C: C-terminal domain of 1-Cys peroxiredoxin; InterPro: IPR019479 This entry represents the C-terminal domain of 1-Cys peroxiredoxin, a member of the peroxiredoxin superfamily which protect cells against membrane oxidation through glutathione (GSH)-dependent reduction of phospholipid hydroperoxides to corresponding alcohols [] Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>COG0386 BtuE Glutathione peroxidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems Back     alignment and domain information
>PF09695 YtfJ_HI0045: Bacterial protein of unknown function (YtfJ_HI0045); InterPro: IPR006513 These are sequences from gammaproteobacteria that are related to the Escherichia coli protein, YtfJ Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>PF05988 DUF899: Bacterial protein of unknown function (DUF899); InterPro: IPR010296 This family consists of uncharacterised bacterial proteins of unknown function which are thioredoxin-like Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>COG3054 Predicted transcriptional regulator [General function prediction only] Back     alignment and domain information
>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>PF05176 ATP-synt_10: ATP10 protein; InterPro: IPR007849 This entry represents the ATPase assembly factor ATP10 found in mitochondria, which is essential for the assembly of the mitochondrial F1-F0 complex Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>KOG4498|consensus Back     alignment and domain information
>KOG2501|consensus Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>KOG1651|consensus Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>COG4312 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>PF13778 DUF4174: Domain of unknown function (DUF4174) Back     alignment and domain information
>KOG2792|consensus Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>PF04592 SelP_N: Selenoprotein P, N terminal region; InterPro: IPR007671 SelP is the only known eukaryotic selenoprotein that contains multiple selenocysteine (Sec) residues, and accounts for more than 50% of the selenium content of rat and human plasma [] Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>PF00255 GSHPx: Glutathione peroxidase; InterPro: IPR000889 Glutathione peroxidase (GSHPx) (1 Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>KOG0910|consensus Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>TIGR03765 ICE_PFL_4695 integrating conjugative element protein, PFL_4695 family Back     alignment and domain information
>KOG0907|consensus Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
3qpm_A240 Crystal Structure Of Peroxiredoxin Prx4 From Pseudo 3e-25
2pn8_A211 Crystal Structure Of Human Peroxiredoxin 4 (Thiored 4e-25
3tjf_A254 Crystal Structure Of Human Peroxiredoxin Iv C51a Mu 6e-25
3tks_A246 Crystal Structure Of Full-Length Human Peroxiredoxi 6e-25
3tkr_A246 Crystal Structure Of Full-Length Human Peroxiredoxi 7e-25
3tjb_A254 Crystal Structure Of Wild-Type Human Peroxiredoxin 7e-25
3tkp_A246 Crystal Structure Of Full-Length Human Peroxiredoxi 7e-25
3tjj_A254 Crystal Structure Of Human Peroxiredoxin Iv C245a M 7e-24
3tjk_A254 Crystal Structure Of Human Peroxiredoxin Iv C245a M 7e-24
1qq2_A199 Crystal Structure Of A Mammalian 2-Cys Peroxiredoxi 2e-22
2z9s_A199 Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXI 3e-22
3zvj_A219 Crystal Structure Of High Molecular Weight (Hmw) Fo 1e-21
1zye_A220 Crystal Strucutre Analysis Of Bovine Mitochondrial 1e-21
3tue_A219 The Structure Of Tryparedoxin Peroxidase I From Lei 1e-21
3ztl_A222 Crystal Structure Of Decameric Form Of Peroxiredoxi 1e-21
3sbc_A216 Crystal Structure Of Saccharomyces Cerevisiae Tsa1c 1e-21
3zvj_D219 Crystal Structure Of High Molecular Weight (Hmw) Fo 2e-21
2rii_A199 Crystal Structure Of Human Peroxiredoxin I In Compl 8e-21
1qmv_A197 Thioredoxin Peroxidase B From Red Blood Cells Lengt 4e-20
3hy2_A206 Crystal Structure Of Sulfiredoxin In Complex With P 9e-20
1uul_A202 Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cr 3e-19
1e2y_A188 Tryparedoxin Peroxidase From Crithidia Fasciculata 4e-19
2c0d_A221 Structure Of The Mitochondrial 2-Cys Peroxiredoxin 2e-16
2h66_A213 The Crystal Structure Of Plasmodium Vivax 2-Cys Per 3e-14
2h01_A192 Py00414- Plasmodium Yoelii Thioredoxin Peroxidase I 8e-14
1zof_A198 Crystal Structure Of Alkyl Hydroperoxide-Reductase 4e-13
2e2m_A250 Crystal Structure Of Archaeal Peroxiredoxin, Thiore 2e-11
2zct_A249 Oxidation Of Archaeal Peroxiredoxin Involves A Hype 2e-11
3a5w_A249 Peroxiredoxin (Wild Type) From Aeropyrum Pernix K1 2e-11
2e2g_A250 Crystal Structure Of Archaeal Peroxiredoxin, Thiore 2e-11
3a2w_A249 Peroxiredoxin (C50s) From Aeropytum Pernix K1 (Pero 2e-11
3a2v_A249 Peroxiredoxin (C207s) From Aeropyrum Pernix K1 Comp 2e-11
2cv4_A250 Crystal Structure Of An Archaeal Peroxiredoxin From 2e-10
1x0r_A249 Thioredoxin Peroxidase From Aeropyrum Pernix K1 Len 2e-10
2bmx_A195 Mycobacterium Tuberculosis Ahpc Length = 195 7e-10
1yf1_A186 Structural And Biochemical Analysis Of The Link Bet 1e-09
1n8j_A186 Crystal Structure Of Ahpc With Active Site Cysteine 1e-09
1yep_A186 Structural And Biochemical Analysis Of The Link Bet 1e-09
1yex_A186 Structural And Biochemical Analysis Of The Link Bet 2e-09
1yf0_A186 Structural And Biochemical Analysis Of The Link Bet 2e-09
1we0_A187 Crystal Structure Of Peroxiredoxin (Ahpc) From Amph 7e-09
3emp_A186 Crystal Structure Of The S-Acetanilide Modified For 2e-08
1prx_A224 Horf6 A Novel Human Peroxidase Enzyme Length = 224 1e-05
2v2g_A233 Crystal Structure Of The C45s Mutant Of The Peroxir 4e-05
>pdb|3QPM|A Chain A, Crystal Structure Of Peroxiredoxin Prx4 From Pseudosciaena Crocea Length = 240 Back     alignment and structure

Iteration: 1

Score = 110 bits (275), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 53/118 (44%), Positives = 71/118 (60%), Gaps = 5/118 (4%) Query: 24 QIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSAGHS 83 +++A SVDS HLAW T + + P KI PLLSD TH ISK YG YL GH+ Sbjct: 113 EVVACSVDSQFTHLAWI----ITPRKQGGLGPMKI-PLLSDLTHQISKDYGVYLEDQGHT 167 Query: 84 LRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPSV 141 LR +IID++G LR + ++D+ VGR++ E LR V+AFQ D CP W G ++ Sbjct: 168 LRGLFIIDEKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSDTI 225
>pdb|2PN8|A Chain A, Crystal Structure Of Human Peroxiredoxin 4 (Thioredoxin Peroxidase) Length = 211 Back     alignment and structure
>pdb|3TJF|A Chain A, Crystal Structure Of Human Peroxiredoxin Iv C51a Mutant In Reduced Form Length = 254 Back     alignment and structure
>pdb|3TKS|A Chain A, Crystal Structure Of Full-Length Human Peroxiredoxin 4 In Three Different Redox States Length = 246 Back     alignment and structure
>pdb|3TKR|A Chain A, Crystal Structure Of Full-Length Human Peroxiredoxin 4 With T118e Mutation Length = 246 Back     alignment and structure
>pdb|3TJB|A Chain A, Crystal Structure Of Wild-Type Human Peroxiredoxin Iv Length = 254 Back     alignment and structure
>pdb|3TKP|A Chain A, Crystal Structure Of Full-Length Human Peroxiredoxin 4 In The Reduced Form Length = 246 Back     alignment and structure
>pdb|3TJJ|A Chain A, Crystal Structure Of Human Peroxiredoxin Iv C245a Mutant In Sulfenylated Form Length = 254 Back     alignment and structure
>pdb|3TJK|A Chain A, Crystal Structure Of Human Peroxiredoxin Iv C245a Mutant In Reduced Form Length = 254 Back     alignment and structure
>pdb|1QQ2|A Chain A, Crystal Structure Of A Mammalian 2-Cys Peroxiredoxin, Hbp23. Length = 199 Back     alignment and structure
>pdb|2Z9S|A Chain A, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant Length = 199 Back     alignment and structure
>pdb|3ZVJ|A Chain A, Crystal Structure Of High Molecular Weight (Hmw) Form Of Peroxiredoxin I From Schistosoma Mansoni Length = 219 Back     alignment and structure
>pdb|1ZYE|A Chain A, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii Length = 220 Back     alignment and structure
>pdb|3TUE|A Chain A, The Structure Of Tryparedoxin Peroxidase I From Leishmania Major Length = 219 Back     alignment and structure
>pdb|3ZTL|A Chain A, Crystal Structure Of Decameric Form Of Peroxiredoxin I From Schistosoma Mansoni Length = 222 Back     alignment and structure
>pdb|3SBC|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Tsa1c47s Mutant Protein Length = 216 Back     alignment and structure
>pdb|3ZVJ|D Chain D, Crystal Structure Of High Molecular Weight (Hmw) Form Of Peroxiredoxin I From Schistosoma Mansoni Length = 219 Back     alignment and structure
>pdb|2RII|A Chain A, Crystal Structure Of Human Peroxiredoxin I In Complex With Sulfiredoxin Length = 199 Back     alignment and structure
>pdb|1QMV|A Chain A, Thioredoxin Peroxidase B From Red Blood Cells Length = 197 Back     alignment and structure
>pdb|3HY2|A Chain A, Crystal Structure Of Sulfiredoxin In Complex With Peroxiredoxin I And Atp:mg2+ Length = 206 Back     alignment and structure
>pdb|1UUL|A Chain A, Tryparedoxin Peroxidase (Txnpx) From Trypanosoma Cruzi In The Reduced State Length = 202 Back     alignment and structure
>pdb|1E2Y|A Chain A, Tryparedoxin Peroxidase From Crithidia Fasciculata Length = 188 Back     alignment and structure
>pdb|2C0D|A Chain A, Structure Of The Mitochondrial 2-Cys Peroxiredoxin From Plasmodium Falciparum Length = 221 Back     alignment and structure
>pdb|2H66|A Chain A, The Crystal Structure Of Plasmodium Vivax 2-Cys Peroxiredoxin Length = 213 Back     alignment and structure
>pdb|2H01|A Chain A, Py00414- Plasmodium Yoelii Thioredoxin Peroxidase I Length = 192 Back     alignment and structure
>pdb|1ZOF|A Chain A, Crystal Structure Of Alkyl Hydroperoxide-Reductase (Ahpc) From Helicobacter Pylori Length = 198 Back     alignment and structure
>pdb|2E2M|A Chain A, Crystal Structure Of Archaeal Peroxiredoxin, Thioredoxin Peroxidase From Aeropyrum Pernix K1 (Sulfinic Acid Form) Length = 250 Back     alignment and structure
>pdb|2ZCT|A Chain A, Oxidation Of Archaeal Peroxiredoxin Involves A Hypervalent Sulfur Intermediate Length = 249 Back     alignment and structure
>pdb|3A5W|A Chain A, Peroxiredoxin (Wild Type) From Aeropyrum Pernix K1 (Reduced Form) Length = 249 Back     alignment and structure
>pdb|2E2G|A Chain A, Crystal Structure Of Archaeal Peroxiredoxin, Thioredoxin Peroxidase From Aeropyrum Pernix K1 (Pre-Oxidation Form) Length = 250 Back     alignment and structure
>pdb|3A2W|A Chain A, Peroxiredoxin (C50s) From Aeropytum Pernix K1 (Peroxide-Bound Form) Length = 249 Back     alignment and structure
>pdb|3A2V|A Chain A, Peroxiredoxin (C207s) From Aeropyrum Pernix K1 Complexed With Hydrogen Peroxide Length = 249 Back     alignment and structure
>pdb|2CV4|A Chain A, Crystal Structure Of An Archaeal Peroxiredoxin From The Aerobic Hyperthermophilic Crenarchaeon Aeropyrum Pernix K1 Length = 250 Back     alignment and structure
>pdb|1X0R|A Chain A, Thioredoxin Peroxidase From Aeropyrum Pernix K1 Length = 249 Back     alignment and structure
>pdb|2BMX|A Chain A, Mycobacterium Tuberculosis Ahpc Length = 195 Back     alignment and structure
>pdb|1YF1|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Oligomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 Back     alignment and structure
>pdb|1N8J|A Chain A, Crystal Structure Of Ahpc With Active Site Cysteine Mutated To Serine (C46s) Length = 186 Back     alignment and structure
>pdb|1YEP|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Olgomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 Back     alignment and structure
>pdb|1YEX|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Oligomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 Back     alignment and structure
>pdb|1YF0|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Oligomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 Back     alignment and structure
>pdb|1WE0|A Chain A, Crystal Structure Of Peroxiredoxin (Ahpc) From Amphibacillus Xylanus Length = 187 Back     alignment and structure
>pdb|3EMP|A Chain A, Crystal Structure Of The S-Acetanilide Modified Form Of C165s Ahpc Length = 186 Back     alignment and structure
>pdb|1PRX|A Chain A, Horf6 A Novel Human Peroxidase Enzyme Length = 224 Back     alignment and structure
>pdb|2V2G|A Chain A, Crystal Structure Of The C45s Mutant Of The Peroxiredoxin 6 Of Arenicola Marina. Monoclinic Form Length = 233 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
1e2y_A188 TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin 1e-42
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 2e-42
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 4e-42
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 4e-42
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 5e-42
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 5e-42
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 8e-42
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 2e-41
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 3e-41
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 3e-40
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 2e-39
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 7e-39
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 1e-38
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 2e-38
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 2e-38
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 3e-34
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 6e-30
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 2e-29
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 2e-29
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 1e-28
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 6e-22
2cx4_A164 Bacterioferritin comigratory protein; oxidoreducta 6e-07
1psq_A163 Probable thiol peroxidase; structural genomics, NY 4e-06
2ywn_A157 Peroxiredoxin-like protein; redox protein, structu 4e-06
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2lrn_A152 Thiol:disulfide interchange protein; structural ge 1e-04
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 3e-04
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 3e-04
2jsy_A167 Probable thiol peroxidase; solution structure, ant 5e-04
>1e2y_A TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin, oxidoreductase; 3.2A {Crithidia fasciculata} SCOP: c.47.1.10 Length = 188 Back     alignment and structure
 Score =  138 bits (350), Expect = 1e-42
 Identities = 43/119 (36%), Positives = 66/119 (55%), Gaps = 5/119 (4%)

Query: 24  QIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSAGHS 83
           ++I+ S DS  +HL WT         +  + P  I P+L+D T AI++ YG     +G +
Sbjct: 72  EVISCSCDSEYSHLQWTSV----DRKKGGLGPMAI-PMLADKTKAIARAYGVLDEDSGVA 126

Query: 84  LRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPSVK 142
            R  +IID  G LR + ++D+ +GRN++E++R VEA Q V+     CP NW  G    K
Sbjct: 127 YRGVFIIDPNGKLRQIIINDMPIGRNVEEVIRLVEALQFVEEHGEVCPANWKKGDAKKK 185


>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Length = 202 Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Length = 216 Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Length = 220 Back     alignment and structure
>1qmv_A Human thioredoxin peroxidase-B; peroxiredoxin, sulphinic acid; 1.7A {Homo sapiens} SCOP: c.47.1.10 PDB: 1qq2_A 2z9s_A 2rii_A 3hy2_A* Length = 197 Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Length = 222 Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 211 Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Length = 240 Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Length = 254 Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Length = 198 Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Length = 221 Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Length = 186 Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Length = 192 Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Length = 213 Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Length = 187 Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Length = 195 Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Length = 233 Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Length = 224 Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Length = 220 Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Length = 249 Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Length = 160 Back     alignment and structure
>2cx4_A Bacterioferritin comigratory protein; oxidoreductase, antioxidant enzyme, reactive oxygen species, thioredoxin fold, structural genomics; 2.30A {Aeropyrum pernix} SCOP: c.47.1.10 PDB: 2cx3_A Length = 164 Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Length = 163 Back     alignment and structure
>2ywn_A Peroxiredoxin-like protein; redox protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.60A {Sulfolobus tokodaii} PDB: 3hjp_A Length = 157 Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} Length = 166 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Length = 152 Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Length = 171 Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Length = 152 Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Length = 167 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 100.0
3tue_A219 Tryparedoxin peroxidase; thioredoxin fold, peroxir 100.0
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 99.97
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 99.97
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 99.97
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 99.97
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 99.97
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 99.97
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 99.97
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 99.96
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 99.96
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 99.96
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 99.95
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 99.95
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 99.95
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 99.95
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 99.95
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 99.93
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 99.92
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 99.91
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 99.88
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 99.87
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 99.87
4f82_A176 Thioredoxin reductase; structural genomics, niaid, 99.85
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin 99.84
4eo3_A 322 Bacterioferritin comigratory protein/NADH dehydro; 99.83
2xhf_A171 Peroxiredoxin 5; oxidoreductase, antioxidant enzym 99.81
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 99.8
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 99.79
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 99.79
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 99.79
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 99.78
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 99.78
3keb_A224 Probable thiol peroxidase; structural genomics, AP 99.77
1psq_A163 Probable thiol peroxidase; structural genomics, NY 99.77
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 99.76
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 99.76
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 99.76
2ywi_A196 Hypothetical conserved protein; uncharacterized co 99.76
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 99.75
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 99.75
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 99.73
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 99.72
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 99.71
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 99.71
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 99.68
2jsy_A167 Probable thiol peroxidase; solution structure, ant 99.63
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 99.59
3raz_A151 Thioredoxin-related protein; structural genomics, 99.59
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 99.58
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 99.58
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 99.58
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 99.57
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 99.56
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 99.53
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 99.53
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 99.52
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 99.5
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 99.49
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 99.49
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 99.48
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 99.48
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 99.48
2l5o_A153 Putative thioredoxin; structural genomics, unknown 99.47
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 99.46
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 99.46
2lrn_A152 Thiol:disulfide interchange protein; structural ge 99.46
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 99.46
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 99.45
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 99.44
2lrt_A152 Uncharacterized protein; structural genomics, thio 99.43
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 99.42
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 99.42
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 99.42
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 99.42
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 99.42
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 99.41
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 99.41
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 99.41
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 99.4
4h86_A199 Peroxiredoxin type-2; oxidoreductase; 2.00A {Sacch 99.39
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 99.38
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 99.38
4evm_A138 Thioredoxin family protein; structural genomics, n 99.36
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 99.36
3me7_A170 Putative uncharacterized protein; electron transfe 99.35
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 99.35
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 99.34
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 99.33
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 99.33
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 99.32
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 99.3
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 99.3
2ls5_A159 Uncharacterized protein; structural genomics, unkn 98.96
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 99.29
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 99.28
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 99.28
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 99.25
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 99.24
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 99.23
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 99.14
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 99.01
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 99.0
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 98.98
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 98.51
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 98.9
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 98.26
2l57_A126 Uncharacterized protein; structural genomics, unkn 98.1
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 97.71
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 97.29
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 97.27
2kuc_A130 Putative disulphide-isomerase; structural genomics 97.15
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 97.13
2l5l_A136 Thioredoxin; structural genomics, electron transpo 97.09
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 97.08
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 97.08
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 97.08
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 97.07
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 97.04
3f9u_A172 Putative exported cytochrome C biogenesis-related; 96.97
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 96.96
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 96.88
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 96.87
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 96.82
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 96.77
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 96.76
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 96.76
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 96.74
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 96.74
2yzu_A109 Thioredoxin; redox protein, electron transport, st 96.72
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 96.68
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 96.62
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 96.62
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 96.61
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 96.59
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 96.59
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 96.58
4euy_A105 Uncharacterized protein; structural genomics, PSI- 96.58
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 96.56
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 96.56
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 96.55
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 96.53
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 96.51
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 96.48
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 96.37
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 96.26
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 96.26
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 96.25
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 96.2
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 96.19
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 96.18
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 96.17
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 96.1
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 96.08
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 96.04
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 96.01
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 95.94
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 95.94
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 95.93
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 95.92
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 95.85
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 95.83
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 95.82
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 95.73
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 95.68
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 95.66
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 95.51
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 95.37
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 95.36
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 95.36
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 95.3
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 95.29
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 95.28
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 95.21
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 95.2
1zma_A118 Bacterocin transport accessory protein; alpha-beta 95.06
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 94.97
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 94.88
2qsi_A137 Putative hydrogenase expression/formation protein; 94.32
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 94.18
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 94.18
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 94.05
3ira_A173 Conserved protein; methanosarcina mazei,structural 93.99
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 93.66
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 93.28
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 93.26
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 92.2
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 93.02
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 92.56
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 91.8
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 90.8
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 91.4
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 91.32
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 91.17
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 90.81
1mek_A120 Protein disulfide isomerase; electron transport, r 90.68
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 90.19
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 90.16
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 89.96
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 89.39
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 88.89
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 88.84
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 88.23
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 87.62
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 86.83
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 86.48
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 86.34
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 85.96
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 85.77
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 84.99
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 84.51
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 84.35
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredo 84.33
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 84.29
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 84.0
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 83.68
1wmj_A130 Thioredoxin H-type; structural genomics, program f 82.7
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 82.5
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 80.25
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=2e-39  Score=251.09  Aligned_cols=137  Identities=33%  Similarity=0.557  Sum_probs=128.7

Q ss_pred             hhHHHHHHHHHhhhhhhhcCCcEEEEEeCCCHHHHHHHHHHHhhcCCCCCCCCCCCCccEEecCchHHHHHhCCCccCCC
Q psy17183          2 DTKIACDVLKLVRKEILIVSPFQIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSAG   81 (145)
Q Consensus         2 ~t~e~~~~~~~~~~~~f~~~gv~vi~VS~D~~~~~~~~~~~~~~~~~~~~~~~~~~~fpllsD~~~~va~~yg~~~~~~g   81 (145)
                      ||.|+|.|++.+  ++|+++|++|||||.|++++|++|+++.+..+  |+..+   +||+|+|++++++++||+..+..|
T Consensus        68 Ct~E~~~f~~~~--~~f~~~g~~vigiS~Ds~~sh~aw~~~~~~~~--~~~~l---~fpllsD~~~~vak~YGv~~~~~g  140 (216)
T 3sbc_A           68 SPTEIIAFSEAA--KKFEEQGAQVLFASTDSEYSLLAWTNIPRKEG--GLGPI---NIPLLADTNHSLSRDYGVLIEEEG  140 (216)
T ss_dssp             HHHHHHHHHHHH--HHHHHTTEEEEEEESSCHHHHHHHHTSCGGGT--CCCSC---SSCEEECTTSHHHHHHTCEETTTT
T ss_pred             CchhhhHHHHhH--HhhccCCceEEEeecCchhhHHHHHHHHHHhC--CccCc---ccceEeCCCCHHHHHcCCeeccCC
Confidence            999999999999  69999999999999999999999998755444  55558   999999999999999999988789


Q ss_pred             CcceEEEEECCCCcEEEEEeecCCCCCCHHHHHHHHHhccccccCCcccCCCCCCCCCccccCC
Q psy17183         82 HSLRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPSVKVAL  145 (145)
Q Consensus        82 ~~~p~tfIID~dG~I~~~~~~~~~~~~~~~ell~~i~~l~~~~~~~~~~p~~w~~~~~~~~~~~  145 (145)
                      ++.|++||||++|+|++..+++.+++|+++|+|++|++||++++|+++||+||++|+++|+|++
T Consensus       141 ~~~R~tFiID~~G~Ir~~~v~~~~~grn~dEiLr~l~AlQ~~~~~~~~~Pa~W~~G~~~i~p~~  204 (216)
T 3sbc_A          141 VALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATIKPTV  204 (216)
T ss_dssp             EECEEEEEECTTSBEEEEEEECTTBCCCHHHHHHHHHHHHHHHHHCCBBCTTCCTTSCCBCCST
T ss_pred             ceeeEEEEECCCCeEEEEEEcCCCCCCCHHHHHHHHHHhhhHhhcCCCcCCCCCCCCceecCCH
Confidence            9999999999999999999999999999999999999999999999999999999999999974



>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>4h86_A Peroxiredoxin type-2; oxidoreductase; 2.00A {Saccharomyces cerevisiae} PDB: 4dsq_A 4dsr_A 4dss_A Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 145
d1qmva_197 c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredox 1e-21
d1uula_194 c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxi 1e-20
d2h01a1170 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thio 8e-18
d1zyea1158 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) 2e-17
d1e2ya_167 c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxi 1e-15
d1n8ja_186 c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC 3e-15
d1xcca_219 c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoe 1e-14
d1we0a1166 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase 3e-14
d2zcta1237 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum perni 4e-14
d1prxa_220 c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sa 4e-14
d1zofa1170 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {He 5e-13
d2bmxa1169 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase 2e-09
d1psqa_163 c.47.1.10 (A:) Probable thiol peroxidase PsaD {Str 3e-07
d2a4va1156 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's y 9e-07
d1xvwa1153 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c 4e-05
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Length = 197 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 83.7 bits (206), Expect = 1e-21
 Identities = 46/121 (38%), Positives = 65/121 (53%), Gaps = 5/121 (4%)

Query: 22  PFQIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSAG 81
             +++ VSVDS   HLAW  T          + P  I PLL+D T  +S+ YG   +  G
Sbjct: 68  GCEVLGVSVDSQFTHLAWINT----PRKEGGLGPLNI-PLLADVTRRLSEDYGVLKTDEG 122

Query: 82  HSLRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPSV 141
            + R  +IID +G LR + V+D+ VGR++ E LR V+AFQ  D     CP  W  G  ++
Sbjct: 123 IAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTI 182

Query: 142 K 142
           K
Sbjct: 183 K 183


>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Length = 194 Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Length = 170 Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Length = 158 Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Length = 167 Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Length = 186 Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 219 Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Length = 166 Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Length = 237 Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Length = 220 Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Length = 170 Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Length = 169 Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Length = 163 Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 156 Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 100.0
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 100.0
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 100.0
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 100.0
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 100.0
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 100.0
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.97
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 99.96
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 99.95
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 99.94
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.92
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 99.91
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 99.86
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 99.81
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 99.78
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 99.72
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 99.71
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 99.69
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 99.66
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 99.66
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 99.65
d1hd2a_161 Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 99.63
d1tp9a1162 Plant peroxiredoxin {Western balsam poplar(Populus 99.58
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 99.57
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 99.55
d1nm3a2163 N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus 99.52
d1xiya1179 1-Cys peroxiredoxin {Malaria parasite (Plasmodium 99.51
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 99.47
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 99.45
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 99.44
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 99.32
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 99.29
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 98.99
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 98.93
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 98.91
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 98.63
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 98.11
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 98.05
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 97.79
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 95.86
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 95.45
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 95.39
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 95.3
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 95.09
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 94.93
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 94.73
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 94.64
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 94.54
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 94.43
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 94.34
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 92.95
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 92.61
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 92.23
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 92.17
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 91.84
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 91.68
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 91.14
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 90.85
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 90.74
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 90.32
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 90.21
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 90.01
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 88.69
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 87.59
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 85.48
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: 1-Cys peroxiredoxin
species: Plasmodium yoelii yoelii [TaxId: 73239]
Probab=100.00  E-value=5.4e-38  Score=241.71  Aligned_cols=136  Identities=20%  Similarity=0.324  Sum_probs=124.6

Q ss_pred             hhHHHHHHHHHhhhhhhhcCCcEEEEEeCCCHHHHHHHHHHHhhcCCCCCCCCCCCCccEEecCchHHHHHhCCCccCC-
Q psy17183          2 DTKIACDVLKLVRKEILIVSPFQIIAVSVDSHLAHLAWTKTLTATSSNRSAIDPSKIVPLLSDSTHAISKTYGCYLSSA-   80 (145)
Q Consensus         2 ~t~e~~~~~~~~~~~~f~~~gv~vi~VS~D~~~~~~~~~~~~~~~~~~~~~~~~~~~fpllsD~~~~va~~yg~~~~~~-   80 (145)
                      ||.|++.|++++  ++|+++|++|+|||+|++++|++|++++++.+  |..++   +||||+|.+++++++||+..+.. 
T Consensus        46 CttEl~~f~~~~--~eF~~~~~~vigiS~Ds~~sh~~w~~~~~~~~--~~~~l---~fpllsD~~~~va~~ygv~~~~~~  118 (219)
T d1xcca_          46 CTTELAELGKMH--EDFLKLNCKLIGFSCNSKESHDKWIEDIKYYG--KLNKW---EIPIVCDESRELANKLKIMDEQEK  118 (219)
T ss_dssp             HHHHHHHHHHTH--HHHHTTTEEEEEEESSCHHHHHHHHHHHHHHH--TCSCC---CCCEEECTTSHHHHHHTCEEEEEE
T ss_pred             cchhHHHHHHhh--hhhcccceEEEeecCccHhHHhHHhhhhHhhc--ccCCC---CcccccccccHHHHHhCCcccccc
Confidence            999999999999  79999999999999999999999999876654  44458   99999999999999999986532 


Q ss_pred             -----CCcceEEEEECCCCcEEEEEeecCCCCCCHHHHHHHHHhccccccCCcccCCCCCCCCCccccC
Q psy17183         81 -----GHSLRAYYIIDKRGYLRSMNVSDIQVGRNLKEILRQVEAFQLVDSTDTQCPVNWTTGQPSVKVA  144 (145)
Q Consensus        81 -----g~~~p~tfIID~dG~I~~~~~~~~~~~~~~~ell~~i~~l~~~~~~~~~~p~~w~~~~~~~~~~  144 (145)
                           +.+.|++||||++|+|++.++++..++|+++|+|+.|++||++++|+.+||+||++|+++++|+
T Consensus       119 ~~~~~~~~~R~tFiIDp~g~Ir~~~~~~~~~gr~~~EiLr~l~aLQ~~~~~~~~~PanW~~G~~~~~~p  187 (219)
T d1xcca_         119 DITGLPLTCRCLFFISPEKKIKATVLYPATTGRNAHEILRVLKSLQLTYTTPVATPVNWNEGDKCCVIP  187 (219)
T ss_dssp             CTTSCEEECEEEEEECTTSBEEEEEEECTTBCCCHHHHHHHHHHHHHHHHSSEEBCTTCCTTSCEEECT
T ss_pred             cCcccceeeeeeEEEcCcceEEEEEEeCCCcccCHHHHHHHHHHHHHHHhCCCCcCCCCCCCCceeeCC
Confidence                 2478999999999999999999999999999999999999999999999999999999998853



>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nm3a2 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xiya1 c.47.1.10 (A:2-180) 1-Cys peroxiredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure