Psyllid ID: psy17199

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
FGFFPTFYIGIDHLFIIFTHLQLLHFLLCHFQVPLCCLPGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRNKTRKRVILKIAFVWLLSVAMSLPLSLMYSQVIQLLHLDFGLIMILGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRYFP
ccEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHcccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHccccccHHHccccccEEEEccEEEcccccEEEHHEHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHccccccHHHHHHHHHHHHHHHHHHcccHHHccccccccccccccccccccccccccHHEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
fgffptfyigidHLFIIFTHLQLLHFLLCHfqvplcclpgyfplppvycltwICLDVLFCTASIMHLCTISVDRylslkypikfgrnktRKRVILKIAFVWLLSVAMSLPLSLMYSQVIQLLHLDFGLIMilgyfplppvycltwICLDVLFCTASIMHLCTISVDRylslkypikfgryfp
FGFFPTFYIGIDHLFIIFTHLQLLHFLLCHFQVPLCCLPGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPikfgrnktrkrVILKIAFVWLLSVAMSLPLSLMYSQVIQLLHLDFGLIMILGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVdrylslkypikfgryfp
FGFFPTFYIGIDhlfiifthlqllhfllchfqVPLCCLPGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRNKTRKRVILKIAFVWLLSVAMSLPLSLMYSQVIQLLHLDFGLIMILGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRYFP
**FFPTFYIGIDHLFIIFTHLQLLHFLLCHFQVPLCCLPGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRNKTRKRVILKIAFVWLLSVAMSLPLSLMYSQVIQLLHLDFGLIMILGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRYF*
FGFFPTFYIGIDHLFIIFTHLQLLHFLLCHFQVPLCCLPGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRNKTRKRVILKIAFVWLLSVAMSLPLSLMYSQVIQLLHLDFGLIMILGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRY**
FGFFPTFYIGIDHLFIIFTHLQLLHFLLCHFQVPLCCLPGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRNKTRKRVILKIAFVWLLSVAMSLPLSLMYSQVIQLLHLDFGLIMILGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRYFP
FGFFPTFYIGIDHLFIIFTHLQLLHFLLCHFQVPLCCLPGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRNKTRKRVILKIAFVWLLSVAMSLPLSLMYSQVIQLLHLDFGLIMILGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKY*********
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
oooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FGFFPTFYIGIDHLFIIFTHLQLLHFLLCHFQVPLCCLPGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRNKTRKRVILKIAFVWLLSVAMSLPLSLMYSQVIQLLHLDFGLIMILGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRYFP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query182 2.2.26 [Sep-21-2011]
Q5IS66 458 5-hydroxytryptamine recep yes N/A 0.357 0.141 0.528 3e-16
P08909 460 5-hydroxytryptamine recep yes N/A 0.357 0.141 0.528 3e-16
P28335 458 5-hydroxytryptamine recep yes N/A 0.357 0.141 0.528 3e-16
P34968 459 5-hydroxytryptamine recep yes N/A 0.357 0.141 0.528 3e-16
Q60F97 458 5-hydroxytryptamine recep yes N/A 0.357 0.141 0.514 5e-16
Q8UUG8 471 5-hydroxytryptamine recep N/A N/A 0.373 0.144 0.542 5e-16
P18599 471 5-hydroxytryptamine recep no N/A 0.423 0.163 0.525 3e-15
P50128 471 5-hydroxytryptamine recep no N/A 0.423 0.163 0.525 3e-15
P28223 471 5-hydroxytryptamine recep no N/A 0.423 0.163 0.525 3e-15
P35363 471 5-hydroxytryptamine recep no N/A 0.423 0.163 0.525 3e-15
>sp|Q5IS66|5HT2C_PANTR 5-hydroxytryptamine receptor 2C OS=Pan troglodytes GN=HTR2C PE=2 SV=1 Back     alignment and function desciption
 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 52/70 (74%)

Query: 42  FPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRNKTRKRVILKIAFVW 101
           +PLP   C  WI LDVLF TASIMHLC IS+DRY++++ PI+  R  +R + I+KIA VW
Sbjct: 120 WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVW 179

Query: 102 LLSVAMSLPL 111
            +S+ +S+P+
Sbjct: 180 AISIGVSVPI 189
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Pan troglodytes (taxid: 9598)
>sp|P08909|5HT2C_RAT 5-hydroxytryptamine receptor 2C OS=Rattus norvegicus GN=Htr2c PE=1 SV=1 Back     alignment and function description
>sp|P28335|5HT2C_HUMAN 5-hydroxytryptamine receptor 2C OS=Homo sapiens GN=HTR2C PE=1 SV=1 Back     alignment and function description
>sp|P34968|5HT2C_MOUSE 5-hydroxytryptamine receptor 2C OS=Mus musculus GN=Htr2c PE=2 SV=2 Back     alignment and function description
>sp|Q60F97|5HT2C_CANFA 5-hydroxytryptamine receptor 2C OS=Canis familiaris GN=HTR2C PE=2 SV=1 Back     alignment and function description
>sp|Q8UUG8|5HT2B_TETFL 5-hydroxytryptamine receptor 2B OS=Tetraodon fluviatilis GN=htr2b PE=2 SV=1 Back     alignment and function description
>sp|P18599|5HT2A_CRIGR 5-hydroxytryptamine receptor 2A OS=Cricetulus griseus GN=HTR2A PE=2 SV=1 Back     alignment and function description
>sp|P50128|5HT2A_MACMU 5-hydroxytryptamine receptor 2A OS=Macaca mulatta GN=HTR2A PE=2 SV=1 Back     alignment and function description
>sp|P28223|5HT2A_HUMAN 5-hydroxytryptamine receptor 2A OS=Homo sapiens GN=HTR2A PE=1 SV=2 Back     alignment and function description
>sp|P35363|5HT2A_MOUSE 5-hydroxytryptamine receptor 2A OS=Mus musculus GN=Htr2a PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
328698045 1098 PREDICTED: hypothetical protein LOC10057 0.576 0.095 0.661 5e-38
347967429 942 AGAP002229-PA [Anopheles gambiae str. PE 0.714 0.138 0.582 2e-37
340719998 741 PREDICTED: 5-hydroxytryptamine receptor 0.423 0.103 0.819 5e-36
270008194 700 hypothetical protein TcasGA2_TC013982 [T 0.423 0.11 0.831 1e-35
195395979 926 GJ10131 [Drosophila virilis] gi|19414332 0.560 0.110 0.663 2e-35
195111751 942 GI22528 [Drosophila mojavensis] gi|19391 0.560 0.108 0.663 2e-35
350408117 736 PREDICTED: hypothetical protein LOC10074 0.423 0.104 0.819 2e-35
442617996 947 CG42796, isoform E [Drosophila melanogas 0.560 0.107 0.663 2e-35
320542529 904 CG42796, isoform D [Drosophila melanogas 0.560 0.112 0.663 2e-35
198453018 918 GA20762 [Drosophila pseudoobscura pseudo 0.560 0.111 0.663 2e-35
>gi|328698045|ref|XP_003240524.1| PREDICTED: hypothetical protein LOC100575043 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 78/118 (66%), Positives = 91/118 (77%), Gaps = 13/118 (11%)

Query: 32  QVPLCCLPGY-----FPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGR 86
           Q+P+   PG+     FP  PVYCL WICLDVLFCTASIMHLCTISVDRYLSL+YP+KFGR
Sbjct: 300 QLPIKKSPGHDLIREFPFAPVYCLAWICLDVLFCTASIMHLCTISVDRYLSLRYPMKFGR 359

Query: 87  NKTRKRVILKIAFVWLLSVAMSLPLSLMYSQVIQLLHLDFGLIMILGYFPLP-PVYCL 143
           NKTR+RVILKI FVWLLS+AMSLPLSLMYS+       DF  +++ G   +P P+Y L
Sbjct: 360 NKTRRRVILKIVFVWLLSIAMSLPLSLMYSK-------DFNSVLVNGSCQIPDPLYKL 410

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|347967429|ref|XP_001687830.2| AGAP002229-PA [Anopheles gambiae str. PEST] gi|333466300|gb|EDO64817.2| AGAP002229-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|340719998|ref|XP_003398431.1| PREDICTED: 5-hydroxytryptamine receptor 1A-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|270008194|gb|EFA04642.1| hypothetical protein TcasGA2_TC013982 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195395979|ref|XP_002056611.1| GJ10131 [Drosophila virilis] gi|194143320|gb|EDW59723.1| GJ10131 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195111751|ref|XP_002000441.1| GI22528 [Drosophila mojavensis] gi|193917035|gb|EDW15902.1| GI22528 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|350408117|ref|XP_003488309.1| PREDICTED: hypothetical protein LOC100748213 [Bombus impatiens] Back     alignment and taxonomy information
>gi|442617996|ref|NP_001262373.1| CG42796, isoform E [Drosophila melanogaster] gi|440217199|gb|AGB95755.1| CG42796, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|320542529|ref|NP_649806.2| CG42796, isoform D [Drosophila melanogaster] gi|318068736|gb|AAN13390.2| CG42796, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|198453018|ref|XP_001359030.2| GA20762 [Drosophila pseudoobscura pseudoobscura] gi|198132179|gb|EAL28173.2| GA20762 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
FB|FBgn0261929 778 CG42796 [Drosophila melanogast 0.532 0.124 0.685 2.1e-33
UNIPROTKB|Q50DZ8 434 5HT2B "Uncharacterized protein 0.395 0.165 0.5 3.8e-18
UNIPROTKB|F1RWT6 351 HTR2C "Uncharacterized protein 0.439 0.227 0.506 5.6e-18
UNIPROTKB|Q8UUG8 471 htr2b "5-hydroxytryptamine rec 0.395 0.152 0.527 3.1e-17
ZFIN|ZDB-GENE-120215-109 355 htr2cl2 "5-hydroxytryptamine ( 0.489 0.250 0.415 1.5e-16
UNIPROTKB|J9PBP0 458 HTR2C "5-hydroxytryptamine rec 0.439 0.174 0.493 1.7e-16
UNIPROTKB|P28335 458 HTR2C "5-hydroxytryptamine rec 0.439 0.174 0.493 1.7e-16
MGI|MGI:96281 459 Htr2c "5-hydroxytryptamine (se 0.439 0.174 0.493 1.7e-16
RGD|2848 460 Htr2c "5-hydroxytryptamine (se 0.439 0.173 0.493 1.7e-16
ZFIN|ZDB-GENE-081104-48 518 htr2cl1 "5-hydroxytryptamine ( 0.598 0.210 0.398 1.7e-16
FB|FBgn0261929 CG42796 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 363 (132.8 bits), Expect = 2.1e-33, Sum P(2) = 2.1e-33
 Identities = 72/105 (68%), Positives = 84/105 (80%)

Query:    40 GYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRNKTRKRVILKIAF 99
             GYFPL   +CLTWICLDVLFCTASIMHLCTISVDRYLSL+YP++FGRNKTR+RV LKI F
Sbjct:    11 GYFPLGSEHCLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTRRRVTLKIVF 70

Query:   100 VWLLSVAMSLPLSLMYSQVIQLLHLDFGLIMILGYFPLP-PVYCL 143
             VWLLS+AMSLPLSLMYS+       +   +++ G   +P PVY L
Sbjct:    71 VWLLSIAMSLPLSLMYSK-------NHASVLVNGTCQIPDPVYKL 108
GO:0007210 "serotonin receptor signaling pathway" evidence=ISS
GO:0016021 "integral to membrane" evidence=ISS
GO:0004993 "serotonin receptor activity" evidence=ISS
UNIPROTKB|Q50DZ8 5HT2B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWT6 HTR2C "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q8UUG8 htr2b "5-hydroxytryptamine receptor 2B" [Tetraodon fluviatilis (taxid:47145)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120215-109 htr2cl2 "5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled-like 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9PBP0 HTR2C "5-hydroxytryptamine receptor 2C" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P28335 HTR2C "5-hydroxytryptamine receptor 2C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:96281 Htr2c "5-hydroxytryptamine (serotonin) receptor 2C" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2848 Htr2c "5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081104-48 htr2cl1 "5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q75Z895HT2A_BOVINNo assigned EC number0.52560.42300.1638yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
pfam00001251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 2e-13
pfam00001 251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 7e-07
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information 
 Score = 66.2 bits (162), Expect = 2e-13
 Identities = 27/78 (34%), Positives = 44/78 (56%)

Query: 40  GYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRNKTRKRVILKIAF 99
           G +P     C     L V+   ASI+ L  IS+DRYL++ +P+++ R +T +R  + I  
Sbjct: 42  GDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAIVHPLRYRRIRTPRRAKVLILV 101

Query: 100 VWLLSVAMSLPLSLMYSQ 117
           VW+L++ +SLP  L    
Sbjct: 102 VWVLALLLSLPPLLFSWL 119

This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 182
KOG4219|consensus 423 99.75
KOG4220|consensus 503 99.7
PHA03234 338 DNA packaging protein UL33; Provisional 99.69
PHA02834323 chemokine receptor-like protein; Provisional 99.62
PHA02638 417 CC chemokine receptor-like protein; Provisional 99.62
PHA03235 409 DNA packaging protein UL33; Provisional 99.55
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 99.55
PHA03087335 G protein-coupled chemokine receptor-like protein; 99.51
KOG4220|consensus 503 99.11
KOG2087|consensus 363 98.9
PHA03234 338 DNA packaging protein UL33; Provisional 98.77
KOG4219|consensus 423 98.56
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 98.55
PHA02834 323 chemokine receptor-like protein; Provisional 98.52
PHA02638 417 CC chemokine receptor-like protein; Provisional 98.29
PF00001 257 7tm_1: 7 transmembrane receptor (rhodopsin family) 98.28
PHA03235 409 DNA packaging protein UL33; Provisional 98.13
PHA03087 335 G protein-coupled chemokine receptor-like protein; 98.05
PF10328274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 97.8
PF10324 318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 97.76
PF11710201 Git3: G protein-coupled glucose receptor regulatin 97.17
PF10323283 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept 96.88
PF10320 257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 96.81
PF03402265 V1R: Vomeronasal organ pheromone receptor family, 95.63
PF05462303 Dicty_CAR: Slime mold cyclic AMP receptor 94.29
KOG2087|consensus 363 94.12
PF10317292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 81.81
>KOG4219|consensus Back     alignment and domain information 
Probab=99.75  E-value=1.8e-18  Score=135.66  Aligned_cols=106  Identities=19%  Similarity=0.324  Sum_probs=96.1

Q ss_pred             chhhHhHHHHHHHHHHHHHhhhhhh---ccccccccccchhHHhHHHHHHHHHHHHHHHHHHHhhhheeeccccccccee
Q psy17199         13 HLFIIFTHLQLLHFLLCHFQVPLCC---LPGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRNKT   89 (182)
Q Consensus        13 ~~n~~l~~La~~Dl~~~~~~~p~~~---~~~~~~~~~~~C~~~~~~~~~~~~~s~~~l~~iav~Ry~ai~~pl~~~~~~t   89 (182)
                      -+|+|+.|||+||+..+.+..|+..   +...|.+|+..|++..++....+.+|+++++++|+|||.||.||++.+  .+
T Consensus        69 vtnyfL~NLAfADl~~s~Fn~~f~f~yal~~~W~~G~f~C~f~nf~~itav~vSVfTlvAiA~DRy~AIi~Pl~~r--~s  146 (423)
T KOG4219|consen   69 VTNYFLVNLAFADLSMSIFNTVFNFQYALHQEWYFGSFYCRFVNFFPITAVFVSVFTLVAIAIDRYMAIIHPLQPR--PS  146 (423)
T ss_pred             hHHHHHHHHHHHHHHHHHHhhHHHHHHHHHhccccccceeeeccccchhhhhHhHHHHHHHHHHHHHHHhhhcccC--CC
Confidence            4799999999999999999999974   367899999999999999999999999999999999999999999864  88


Q ss_pred             cceeeeeehHhHHHHHHHHhhhHhhccceee
Q psy17199         90 RKRVILKIAFVWLLSVAMSLPLSLMYSQVIQ  120 (182)
Q Consensus        90 ~~~~~~~l~~~wi~s~~~~~p~~~~~~~~~~  120 (182)
                      ++...+.+..+|+++++++.|..+.....+.
T Consensus       147 ~r~sk~iIllIW~lA~l~a~P~~l~s~v~~~  177 (423)
T KOG4219|consen  147 RRSSKIIILLIWALALLLALPQLLYSSVEEL  177 (423)
T ss_pred             CcceeehhHHHHHHHHHHhccceeeeeeEEe
Confidence            8888999999999999999998777665443

>KOG4220|consensus Back     alignment and domain information
>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>KOG4219|consensus Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF03402 V1R: Vomeronasal organ pheromone receptor family, V1R; InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
3uon_A 467 Structure Of The Human M2 Muscarinic Acetylcholine 8e-09
3uon_A 467 Structure Of The Human M2 Muscarinic Acetylcholine 4e-06
3pbl_A 481 Structure Of The Human Dopamine D3 Receptor In Comp 1e-08
3pbl_A 481 Structure Of The Human Dopamine D3 Receptor In Comp 1e-04
2vt4_A313 Turkey Beta1 Adrenergic Receptor With Stabilising M 1e-06
2vt4_A 313 Turkey Beta1 Adrenergic Receptor With Stabilising M 8e-05
2y00_B315 Turkey Beta1 Adrenergic Receptor With Stabilising M 1e-06
2y00_B 315 Turkey Beta1 Adrenergic Receptor With Stabilising M 8e-05
4daj_A 479 Structure Of The M3 Muscarinic Acetylcholine Recept 2e-06
3pds_A 458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 3e-06
3pds_A 458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 6e-04
4gbr_A309 N-terminal T4 Lysozyme Fusion Facilitates Crystalli 4e-06
4gbr_A 309 N-terminal T4 Lysozyme Fusion Facilitates Crystalli 7e-04
3kj6_A 366 Crystal Structure Of A Methylated Beta2 Adrenergic 4e-06
3kj6_A 366 Crystal Structure Of A Methylated Beta2 Adrenergic 5e-04
2r4r_A 365 Crystal Structure Of The Human Beta2 Adrenoceptor L 4e-06
2r4r_A 365 Crystal Structure Of The Human Beta2 Adrenoceptor L 6e-04
2r4s_A 342 Crystal Structure Of The Human Beta2 Adrenoceptor L 5e-06
2r4s_A 342 Crystal Structure Of The Human Beta2 Adrenoceptor L 6e-04
2rh1_A 500 High Resolution Crystal Structure Of Human B2-Adren 7e-06
2rh1_A 500 High Resolution Crystal Structure Of Human B2-Adren 5e-04
3p0g_A 501 Structure Of A Nanobody-Stabilized Active State Of 7e-06
3p0g_A 501 Structure Of A Nanobody-Stabilized Active State Of 5e-04
3sn6_R 514 Crystal Structure Of The Beta2 Adrenergic Receptor- 8e-06
3sn6_R 514 Crystal Structure Of The Beta2 Adrenergic Receptor- 5e-04
3d4s_A 490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 9e-06
3d4s_A 490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 8e-04
4dkl_A 464 Crystal Structure Of The Mu-Opioid Receptor Bound T 1e-04
3rze_A 452 Structure Of The Human Histamine H1 Receptor In Com 2e-04
4ea3_B 434 Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WI 3e-04
>pdb|3UON|A Chain A, Structure Of The Human M2 Muscarinic Acetylcholine Receptor Bound To An Antagonist Length = 467 Back     alignment and structure 
Iteration: 1

 Score = 56.6 bits (135), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 48/88 (54%)
Query: 40  GYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRNKTRKRVILKIAF 99
           GY+PL PV C  W+ LD +   AS+M+L  IS DRY  +  P+ +   +T K   + IA 
Sbjct: 87  GYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAA 146
Query: 100 VWLLSVAMSLPLSLMYSQVIQLLHLDFG 127
            W+LS  +  P  L +  ++ +  ++ G
Sbjct: 147 AWVLSFILWAPAILFWQFIVGVRTVEDG 174
>pdb|3UON|A Chain A, Structure Of The Human M2 Muscarinic Acetylcholine Receptor Bound To An Antagonist Length = 467 Back     alignment and structure
>pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>pdb|2VT4|A Chain A, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Cyanopindolol Length = 313 Back     alignment and structure
>pdb|2VT4|A Chain A, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Cyanopindolol Length = 313 Back     alignment and structure
>pdb|2Y00|B Chain B, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Partial Agonist Dobutamine (Crystal Dob92) Length = 315 Back     alignment and structure
>pdb|2Y00|B Chain B, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Partial Agonist Dobutamine (Crystal Dob92) Length = 315 Back     alignment and structure
>pdb|4DAJ|A Chain A, Structure Of The M3 Muscarinic Acetylcholine Receptor Length = 479 Back     alignment and structure
>pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>pdb|4GBR|A Chain A, N-terminal T4 Lysozyme Fusion Facilitates Crystallization Of A G Protein Coupled Receptor Length = 309 Back     alignment and structure
>pdb|4GBR|A Chain A, N-terminal T4 Lysozyme Fusion Facilitates Crystallization Of A G Protein Coupled Receptor Length = 309 Back     alignment and structure
>pdb|3KJ6|A Chain A, Crystal Structure Of A Methylated Beta2 Adrenergic Receptor- Fab Complex Length = 366 Back     alignment and structure
>pdb|3KJ6|A Chain A, Crystal Structure Of A Methylated Beta2 Adrenergic Receptor- Fab Complex Length = 366 Back     alignment and structure
>pdb|2R4R|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 365 Back     alignment and structure
>pdb|2R4R|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 365 Back     alignment and structure
>pdb|2R4S|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 342 Back     alignment and structure
>pdb|2R4S|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 342 Back     alignment and structure
>pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein- Coupled Receptor Length = 500 Back     alignment and structure
>pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein- Coupled Receptor Length = 500 Back     alignment and structure
>pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>pdb|3SN6|R Chain R, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 514 Back     alignment and structure
>pdb|3SN6|R Chain R, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 514 Back     alignment and structure
>pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>pdb|4DKL|A Chain A, Crystal Structure Of The Mu-Opioid Receptor Bound To A Morphinan Antagonist Length = 464 Back     alignment and structure
>pdb|3RZE|A Chain A, Structure Of The Human Histamine H1 Receptor In Complex With Doxepin Length = 452 Back     alignment and structure
>pdb|4EA3|B Chain B, Structure Of The NOFQ OPIOID RECEPTOR IN COMPLEX WITH A PEPTIDE Mimetic Length = 434 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 5e-26
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 5e-17
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 9e-25
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 2e-16
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 1e-24
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 2e-15
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 1e-24
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 9e-16
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 7e-24
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 1e-15
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 7e-24
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 3e-15
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 2e-22
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 1e-14
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 3e-18
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 2e-11
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 4e-17
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 5e-11
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 1e-10
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 1e-04
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 1e-10
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 7e-04
1hll_A32 Alpha-2A adrenergic receptor; helix-linker-helix, 1e-08
1hll_A32 Alpha-2A adrenergic receptor; helix-linker-helix, 3e-06
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 1e-08
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 2e-08
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 3e-08
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 2e-07
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
 Score =  102 bits (255), Expect = 5e-26
 Identities = 22/76 (28%), Positives = 37/76 (48%)

Query: 40  GYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRNKTRKRVILKIAF 99
             F      CL   C  ++   +SI  L  I++DRY++++ P+++    T  R    IA 
Sbjct: 83  TGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAI 142

Query: 100 VWLLSVAMSLPLSLMY 115
            W+LS A+ L   L +
Sbjct: 143 CWVLSFAIGLTPMLGW 158
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A Length = 32 Back     alignment and structure
>1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A Length = 32 Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.78
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.69
2lnl_A296 C-X-C chemokine receptor type 1; G protein coupled 99.67
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 99.67
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 99.66
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.65
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.65
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 99.65
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.65
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.64
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.64
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 99.63
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.62
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 99.62
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.61
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 99.58
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 99.58
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.55
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 98.91
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 98.86
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 98.78
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 98.76
2lnl_A 296 C-X-C chemokine receptor type 1; G protein coupled 98.71
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 98.68
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 98.67
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 98.63
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 98.61
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 98.59
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 98.57
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 98.56
1hll_A32 Alpha-2A adrenergic receptor; helix-linker-helix, 98.55
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 98.54
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 98.54
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 98.53
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 98.52
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 98.52
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 98.47
1hll_A32 Alpha-2A adrenergic receptor; helix-linker-helix, 98.11
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.78  E-value=8.4e-20  Score=150.94  Aligned_cols=108  Identities=19%  Similarity=0.301  Sum_probs=98.8

Q ss_pred             cchhhHhHHHHHHHHHHHHHhhhhhhc-----cccccccccchhHHhHHHHHHHHHHHHHHHHHHHhhhheeeccccccc
Q psy17199         12 DHLFIIFTHLQLLHFLLCHFQVPLCCL-----PGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGR   86 (182)
Q Consensus        12 ~~~n~~l~~La~~Dl~~~~~~~p~~~~-----~~~~~~~~~~C~~~~~~~~~~~~~s~~~l~~iav~Ry~ai~~pl~~~~   86 (182)
                      +..|+|++|||++|++++++.+|+.+.     .+.|.+|+..|++..++..+...+|++++++|++|||.||++|+++++
T Consensus        68 ~~~n~~i~~La~aDll~~~~~~p~~~~~~~~~~~~w~~g~~~C~~~~~~~~~~~~~S~~~l~~is~dRy~ai~~P~~~~~  147 (510)
T 4grv_A           68 STVHYHLGSLALSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVARYLAICHPFKAKT  147 (510)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCCSSCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCCCC
T ss_pred             ChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCEEhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHheEEEeccccccc
Confidence            356999999999999999999998753     467999999999999999999999999999999999999999999999


Q ss_pred             ceecceeeeeehHhHHHHHHHHhhhHhhcccee
Q psy17199         87 NKTRKRVILKIAFVWLLSVAMSLPLSLMYSQVI  119 (182)
Q Consensus        87 ~~t~~~~~~~l~~~wi~s~~~~~p~~~~~~~~~  119 (182)
                      .+|++++...++++|++++++++|+.+.+....
T Consensus       148 ~~t~~~~~~~i~~~W~~s~~~~~p~~~~~~~~~  180 (510)
T 4grv_A          148 LMSRSRTKKFISAIWLASALLAIPMLFTMGLQN  180 (510)
T ss_dssp             CCCCSCCHHHHHHHHHHHHHHHTTHHHHEEEEE
T ss_pred             cccccccceeehHHHHHHHHHHHHHHHhhcccc
Confidence            999999999999999999999999988776443
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
d1u19a_ 348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.39
d1u19a_ 348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 97.99
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.39  E-value=8e-14  Score=107.05  Aligned_cols=108  Identities=20%  Similarity=0.338  Sum_probs=90.3

Q ss_pred             cchhhHhHHHHHHHHHHHHHhhhhhhc---cccccccccchhHHhHHHHHHHHHHHHHHHHHHHhhhheeecccccccce
Q psy17199         12 DHLFIIFTHLQLLHFLLCHFQVPLCCL---PGYFPLPPVYCLTWICLDVLFCTASIMHLCTISVDRYLSLKYPIKFGRNK   88 (182)
Q Consensus        12 ~~~n~~l~~La~~Dl~~~~~~~p~~~~---~~~~~~~~~~C~~~~~~~~~~~~~s~~~l~~iav~Ry~ai~~pl~~~~~~   88 (182)
                      +..|+++.|||++|++.++...|..+.   .+.|..+...|+...+.......++.++++++++|||.++++|++++.. 
T Consensus        70 ~~~~~~l~nLaiaDll~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~s~~~l~~is~~R~~~i~~p~~~~~~-  148 (348)
T d1u19a_          70 TPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRF-  148 (348)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHTSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCSSSCCC-
T ss_pred             CHhHHHHHHHHHHHHHHHHHHHHHhhhhhccCccccCchhhhhhhhccccceeeecchhhhhhcccceeeecccccccc-
Confidence            467999999999999999888887653   5678888999999999999999999999999999999999999998654 


Q ss_pred             ecceeeeeehHhHHHHHHHHhhhHhhccceee
Q psy17199         89 TRKRVILKIAFVWLLSVAMSLPLSLMYSQVIQ  120 (182)
Q Consensus        89 t~~~~~~~l~~~wi~s~~~~~p~~~~~~~~~~  120 (182)
                      ++++.......+|..+.....|+.+.......
T Consensus       149 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  180 (348)
T d1u19a_         149 GENHAIMGVAFTWVMALACAAPPLVGWSRYIP  180 (348)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHSGGGTTSSCCEE
T ss_pred             ccccccccceeeehhhhheecccccccceecc
Confidence            55566667777888888888887776655443
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure