Psyllid ID: psy1719


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70---
MPYDICEAEAALDHIEAEMAARGVTQALIDETRAAPETRMLEDLAAEAARGQDLEYKDPASGATPSVNGLRYK
ccccccccHHHHHHHHHHHHHccccHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccccccccccccccc
ccccccccHHHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHcccccccccccccccccHcccccc
MPYDICEAEAALDHIEAEMAARGVTQALIDETRAAPETRMLEDLAAEAARgqdleykdpasgatpsvnglryk
MPYDICEAEAALDHIEAEMAARGVTQALIDETRAAPETRMLEDLAAEAArgqdleykdpasgatpsvnglryk
MPYDICEAEAALDHIEAEMAARGVTQALIDETRAAPETRMLEDLAAEAARGQDLEYKDPASGATPSVNGLRYK
**********ALDHIE*******V*************************************************
MPYDICEAEAALDHIEAEMAARGVTQALIDETRAAPETRMLEDLAAEAARGQDLEYKDPASGATPSVNGLR**
MPYDICEAEAALDHIEAEMAARGVTQALIDETRAAPETRMLEDLAAEAARGQDLEYKDPASGATPSVNGLRYK
*PYDICEAEAALDHIEAEMAARGVTQALIDETRAAPETRMLEDLAAEAARGQDLE******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooo
iiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPYDICEAEAALDHIEAEMAARGVTQALIDETRAAPETRMLEDLAAEAARGQDLEYKDPASGATPSVNGLRYK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query73 2.2.26 [Sep-21-2011]
Q95N27 568 Protein phosphatase 1 reg yes N/A 0.863 0.110 0.546 2e-11
Q8VHQ3 568 Protein phosphatase 1 reg yes N/A 0.863 0.110 0.531 3e-11
Q96T49 567 Protein phosphatase 1 reg no N/A 0.863 0.111 0.531 8e-11
Q96I34 528 Protein phosphatase 1 reg no N/A 0.753 0.104 0.490 5e-08
Q923M0 524 Protein phosphatase 1 reg no N/A 0.849 0.118 0.476 2e-06
>sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 Back     alignment and function desciption
 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 1   MPYDICEAEAALDHIEAEMAARGVTQALIDETRAAPETRMLEDLAAEAARGQDLEYKDPA 60
           MPYD+CE E  LD IE  MA +G+TQ  I+E RAAPE +M+ D+    A GQDL++ D A
Sbjct: 169 MPYDLCEDEPTLDVIETCMAYQGITQEKINEMRAAPEQQMISDIHCMIAAGQDLDWVD-A 227

Query: 61  SGAT 64
            GAT
Sbjct: 228 QGAT 231




Regulator of protein phosphatase 1 (PP1) that acts as a positive regulator of pulmonary endothelial cell (EC) barrier function. Involved in PKA-mediated moesin dephosphorylation which is important in EC barrier protection against thrombin stimulation. Promotes the interaction of PPP1CA with RPSA/LAMR1 and in turn facilitates the dephosphorylation of RPSA/LAMR1. Involved in the regulation of endothelial cell filopodia extension. May be a downstream target for TGF-beta1 signaling cascade in endothelial cells.
Bos taurus (taxid: 9913)
>sp|Q8VHQ3|PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=2 SV=1 Back     alignment and function description
>sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 Back     alignment and function description
>sp|Q96I34|PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 Back     alignment and function description
>sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
157120187 400 protein phosphatase 1 regulatory inhibit 0.931 0.17 0.657 1e-15
242012241 502 protein phosphatase 1 regulatory subunit 0.876 0.127 0.692 1e-15
158300667 459 AGAP012006-PA [Anopheles gambiae str. PE 0.931 0.148 0.657 2e-15
312382791 381 hypothetical protein AND_04315 [Anophele 0.876 0.167 0.692 2e-15
307212026 528 Protein phosphatase 1 regulatory subunit 0.931 0.128 0.643 6e-15
332024457 527 Protein phosphatase 1 regulatory subunit 0.876 0.121 0.676 6e-15
345486606 580 PREDICTED: protein phosphatase 1 regulat 0.931 0.117 0.643 7e-15
350407183 524 PREDICTED: protein phosphatase 1 regulat 0.876 0.122 0.676 1e-14
340709382 524 PREDICTED: protein phosphatase 1 regulat 0.876 0.122 0.676 1e-14
391344173 388 PREDICTED: protein phosphatase 1 regulat 0.876 0.164 0.646 1e-14
>gi|157120187|ref|XP_001653539.1| protein phosphatase 1 regulatory inhibitor subunit 16a [Aedes aegypti] gi|108883052|gb|EAT47277.1| AAEL001546-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/73 (65%), Positives = 55/73 (75%), Gaps = 5/73 (6%)

Query: 1   MPYDICEAEAALDHIEAEMAARGVTQALIDETRAAPETRMLEDLAAEAARGQDLEYKDPA 60
           MPYDIC+ E ALD+IEAEM+ RGVTQ LIDETRAA ET+ML+DL   AA+G DLE  D +
Sbjct: 177 MPYDICDDEEALDYIEAEMSKRGVTQELIDETRAATETQMLKDLQDTAAQGGDLEVPD-S 235

Query: 61  SGATP----SVNG 69
            GATP    S NG
Sbjct: 236 QGATPLHIASANG 248




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242012241|ref|XP_002426842.1| protein phosphatase 1 regulatory subunit 16A, putative [Pediculus humanus corporis] gi|212511055|gb|EEB14104.1| protein phosphatase 1 regulatory subunit 16A, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|158300667|ref|XP_552222.3| AGAP012006-PA [Anopheles gambiae str. PEST] gi|157013271|gb|EAL38805.3| AGAP012006-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312382791|gb|EFR28118.1| hypothetical protein AND_04315 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|307212026|gb|EFN87919.1| Protein phosphatase 1 regulatory subunit 16A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332024457|gb|EGI64655.1| Protein phosphatase 1 regulatory subunit 16A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345486606|ref|XP_001605376.2| PREDICTED: protein phosphatase 1 regulatory subunit 16A-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350407183|ref|XP_003488011.1| PREDICTED: protein phosphatase 1 regulatory subunit 16A-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340709382|ref|XP_003393289.1| PREDICTED: protein phosphatase 1 regulatory subunit 16A-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|391344173|ref|XP_003746377.1| PREDICTED: protein phosphatase 1 regulatory inhibitor subunit 16B-like [Metaseiulus occidentalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
WB|WBGene00001582 480 gfi-2 [Caenorhabditis elegans 0.863 0.131 0.531 6.8e-12
UNIPROTKB|Q95N27 568 PPP1R16B "Protein phosphatase 0.863 0.110 0.546 2.5e-11
FB|FBgn0036801 741 MYPT-75D "MYPT-75D" [Drosophil 0.876 0.086 0.584 2.9e-11
UNIPROTKB|F1SDW9 568 PPP1R16B "Uncharacterized prot 0.863 0.110 0.546 3.2e-11
UNIPROTKB|E2QST8 568 PPP1R16B "Uncharacterized prot 0.863 0.110 0.546 4.1e-11
MGI|MGI:2151841 568 Ppp1r16b "protein phosphatase 0.863 0.110 0.531 6.7e-11
RGD|1589460 568 Ppp1r16b "protein phosphatase 0.863 0.110 0.531 6.7e-11
UNIPROTKB|Q96T49 567 PPP1R16B "Protein phosphatase 0.863 0.111 0.531 1.1e-10
UNIPROTKB|F1RSP4 525 PPP1R16A "Uncharacterized prot 0.753 0.104 0.545 1.2e-09
UNIPROTKB|Q5ZHY3 571 PPP1R16B "Uncharacterized prot 0.863 0.110 0.546 1.3e-09
WB|WBGene00001582 gfi-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 169 (64.5 bits), Expect = 6.8e-12, P = 6.8e-12
 Identities = 34/64 (53%), Positives = 46/64 (71%)

Query:     1 MPYDICEAEAALDHIEAEMAARGVTQALIDETRAAPETRMLEDLAAEAARGQDLEYKDPA 60
             MPYDIC+ E  LD IE+EMAARG+TQ+ IDE R APE  ML+D+     +G++L+ + P 
Sbjct:   158 MPYDICDHEETLDVIESEMAARGITQSYIDEMRGAPEKAMLDDMKMLHQQGRELDARAP- 216

Query:    61 SGAT 64
              G+T
Sbjct:   217 DGST 220




GO:0002009 "morphogenesis of an epithelium" evidence=IMP
GO:0008340 "determination of adult lifespan" evidence=IMP
GO:0010171 "body morphogenesis" evidence=IMP
GO:0009792 "embryo development ending in birth or egg hatching" evidence=IMP
GO:0040007 "growth" evidence=IMP
GO:0002119 "nematode larval development" evidence=IMP
GO:0040010 "positive regulation of growth rate" evidence=IMP
GO:0040018 "positive regulation of multicellular organism growth" evidence=IMP
GO:0006898 "receptor-mediated endocytosis" evidence=IMP
GO:0000003 "reproduction" evidence=IMP
GO:0040035 "hermaphrodite genitalia development" evidence=IMP
UNIPROTKB|Q95N27 PPP1R16B "Protein phosphatase 1 regulatory inhibitor subunit 16B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0036801 MYPT-75D "MYPT-75D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1SDW9 PPP1R16B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QST8 PPP1R16B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2151841 Ppp1r16b "protein phosphatase 1, regulatory (inhibitor) subunit 16B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1589460 Ppp1r16b "protein phosphatase 1, regulatory subunit 16B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q96T49 PPP1R16B "Protein phosphatase 1 regulatory inhibitor subunit 16B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RSP4 PPP1R16A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZHY3 PPP1R16B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q95N27PP16B_BOVINNo assigned EC number0.54680.86300.1109yesN/A
Q8VHQ3PP16B_MOUSENo assigned EC number0.53120.86300.1109yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 73
KOG0505|consensus 527 99.59
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.15
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 98.96
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 98.93
KOG0515|consensus 752 98.84
PHA02730 672 ankyrin-like protein; Provisional 98.7
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 98.6
PHA02878 477 ankyrin repeat protein; Provisional 98.6
KOG0509|consensus 600 98.58
PHA02946 446 ankyin-like protein; Provisional 98.54
PHA03095 471 ankyrin-like protein; Provisional 98.49
KOG4177|consensus 1143 98.49
PHA02876 682 ankyrin repeat protein; Provisional 98.48
KOG4412|consensus226 98.46
KOG0512|consensus228 98.45
KOG0509|consensus 600 98.43
PHA02795 437 ankyrin-like protein; Provisional 98.42
PHA02791 284 ankyrin-like protein; Provisional 98.42
PHA02736154 Viral ankyrin protein; Provisional 98.4
KOG4412|consensus226 98.39
PHA02875 413 ankyrin repeat protein; Provisional 98.38
PHA02743166 Viral ankyrin protein; Provisional 98.37
KOG0505|consensus 527 98.37
PHA02741169 hypothetical protein; Provisional 98.37
PHA02989 494 ankyrin repeat protein; Provisional 98.37
PHA02884 300 ankyrin repeat protein; Provisional 98.35
PHA02795 437 ankyrin-like protein; Provisional 98.32
PHA02878 477 ankyrin repeat protein; Provisional 98.31
PLN03192 823 Voltage-dependent potassium channel; Provisional 98.31
PHA02875 413 ankyrin repeat protein; Provisional 98.31
PHA02736154 Viral ankyrin protein; Provisional 98.29
PHA03100 480 ankyrin repeat protein; Provisional 98.29
PLN03192 823 Voltage-dependent potassium channel; Provisional 98.28
PHA02917 661 ankyrin-like protein; Provisional 98.27
PHA02791284 ankyrin-like protein; Provisional 98.27
PHA03095 471 ankyrin-like protein; Provisional 98.27
PHA02874 434 ankyrin repeat protein; Provisional 98.26
PHA02884 300 ankyrin repeat protein; Provisional 98.26
PHA02798 489 ankyrin-like protein; Provisional 98.23
PHA02946 446 ankyin-like protein; Provisional 98.23
PHA02859209 ankyrin repeat protein; Provisional 98.21
PHA02743166 Viral ankyrin protein; Provisional 98.2
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.19
PHA02741169 hypothetical protein; Provisional 98.17
PHA02917 661 ankyrin-like protein; Provisional 98.16
PHA03100 480 ankyrin repeat protein; Provisional 98.16
PHA02798 489 ankyrin-like protein; Provisional 98.13
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 98.13
KOG0195|consensus 448 98.11
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.09
PHA02874 434 ankyrin repeat protein; Provisional 98.09
PHA02989 494 ankyrin repeat protein; Provisional 98.08
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 98.06
KOG0818|consensus 669 98.05
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 98.03
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 98.0
PHA02730 672 ankyrin-like protein; Provisional 97.98
PHA02859209 ankyrin repeat protein; Provisional 97.97
PHA02876 682 ankyrin repeat protein; Provisional 97.93
KOG0510|consensus 929 97.9
KOG0783|consensus 1267 97.89
KOG0508|consensus 615 97.87
KOG0514|consensus452 97.85
KOG4177|consensus 1143 97.81
KOG0510|consensus 929 97.79
KOG1710|consensus 396 97.75
KOG0508|consensus 615 97.74
PHA02792 631 ankyrin-like protein; Provisional 97.7
COG0666 235 Arp FOG: Ankyrin repeat [General function predicti 97.69
KOG0512|consensus228 97.61
KOG4214|consensus117 97.59
TIGR00870 743 trp transient-receptor-potential calcium channel p 97.58
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 97.55
TIGR00870 743 trp transient-receptor-potential calcium channel p 97.51
PHA02792 631 ankyrin-like protein; Provisional 97.49
PF1360630 Ank_3: Ankyrin repeat 97.49
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 97.45
KOG0195|consensus 448 97.42
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 97.4
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 97.37
PF1360630 Ank_3: Ankyrin repeat 97.33
KOG0502|consensus296 96.99
KOG0522|consensus 560 96.9
KOG0502|consensus296 96.77
KOG0506|consensus622 96.73
KOG0511|consensus 516 96.53
KOG4214|consensus117 96.39
KOG3676|consensus 782 96.32
KOG0514|consensus 452 96.05
KOG0520|consensus 975 96.02
KOG0521|consensus785 95.78
KOG0818|consensus 669 95.41
KOG0507|consensus 854 95.24
KOG0507|consensus 854 93.94
KOG0705|consensus749 93.55
KOG0705|consensus749 93.32
KOG0506|consensus622 92.39
KOG4369|consensus 2131 90.29
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 88.36
KOG0522|consensus 560 87.85
KOG2384|consensus 223 87.38
KOG1710|consensus 396 87.22
KOG0783|consensus 1267 86.52
KOG0782|consensus1004 85.79
KOG0515|consensus 752 83.42
KOG2505|consensus 591 82.56
>KOG0505|consensus Back     alignment and domain information
Probab=99.59  E-value=1.8e-15  Score=117.17  Aligned_cols=69  Identities=38%  Similarity=0.556  Sum_probs=63.3

Q ss_pred             CccccccchhHHHHHHHHHHHcCCCHHhHHHHHhCchhccHHHHHHHHHcCCCCCCCCCCCCchHHHHhhhcC
Q psy1719           1 MPYDICEAEAALDHIEAEMAARGVTQALIDETRAAPETRMLEDLAAEAARGQDLEYKDPASGATPSVNGLRYK   73 (73)
Q Consensus         1 mp~Diaede~~~~~ie~~m~~~Gi~~~~~~~~r~a~e~~~l~~v~~ll~~Gadvn~~d~~~G~TpLH~Aa~~~   73 (73)
                      ||||+||++.|+++|+.+|..+||+   +++.|.++++.|+.|++.|+..|.+.++++. .|+|+||+|+..|
T Consensus       141 ~P~dl~e~ea~~~~l~~~~~r~gi~---iea~R~~~e~~ml~D~~q~l~~G~~~d~~~~-rG~T~lHvAaa~G  209 (527)
T KOG0505|consen  141 MPYDLAEDEATLDVLETEMARQGID---IEAARKAEEQTMLDDARQWLNAGAELDARHA-RGATALHVAAANG  209 (527)
T ss_pred             CccccccCcchhHHHHHHHHHhccc---HHHHhhhhHHHHHHHHHHHHhcccccccccc-ccchHHHHHHhhh
Confidence            8999999999999999999999999   8999999999999999998888888888888 5888888887765



>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.03
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.01
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.01
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 98.98
4gpm_A 169 Engineered protein OR264; de novo protein, structu 98.96
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 98.89
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 98.85
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 98.83
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 98.81
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 98.81
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 98.79
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 98.77
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 98.76
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 98.76
2rfa_A232 Transient receptor potential cation channel subfa 98.76
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 98.75
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 98.75
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 98.75
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 98.75
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 98.74
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 98.74
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 98.73
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 98.72
3jxi_A 260 Vanilloid receptor-related osmotically activated p 98.72
3jxi_A260 Vanilloid receptor-related osmotically activated p 98.72
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 98.71
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 98.71
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 98.71
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 98.71
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 98.71
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 98.71
1awc_B153 Protein (GA binding protein beta 1); complex (tran 98.71
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 98.71
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 98.7
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 98.7
3deo_A183 Signal recognition particle 43 kDa protein; chloro 98.69
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 98.69
1sw6_A327 Regulatory protein SWI6; transcription regulation, 98.69
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 98.68
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 98.67
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 98.67
1awc_B153 Protein (GA binding protein beta 1); complex (tran 98.67
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 98.67
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 98.67
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 98.66
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 98.66
3hra_A201 Ankyrin repeat family protein; structural protein; 98.66
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 98.66
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 98.66
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 98.65
3deo_A183 Signal recognition particle 43 kDa protein; chloro 98.65
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 98.65
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 98.64
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 98.64
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 98.63
3v30_A172 DNA-binding protein rfxank; structural genomics co 98.63
3v31_A167 Ankyrin repeat family A protein 2; structural geno 98.63
3v31_A167 Ankyrin repeat family A protein 2; structural geno 98.63
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 98.62
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 98.62
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.62
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.62
3v30_A172 DNA-binding protein rfxank; structural genomics co 98.61
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 98.61
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 98.6
2pnn_A 273 Transient receptor potential cation channel subfa 98.6
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 98.6
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 98.59
2etb_A 256 Transient receptor potential cation channel subfam 98.59
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 98.58
2pnn_A273 Transient receptor potential cation channel subfa 98.58
2rfa_A 232 Transient receptor potential cation channel subfa 98.58
3hra_A 201 Ankyrin repeat family protein; structural protein; 98.58
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 98.58
2etb_A256 Transient receptor potential cation channel subfam 98.57
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 98.57
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 98.57
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 98.57
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 98.57
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 98.56
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 98.55
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 98.55
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 98.55
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 98.54
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 98.54
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 98.54
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 98.54
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 98.53
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 98.53
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 98.52
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 98.52
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 98.52
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 98.51
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 98.51
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 98.51
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 98.51
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 98.51
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 98.5
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 98.5
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 98.49
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 98.49
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 98.49
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 98.49
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 98.48
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 98.47
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 98.43
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 98.42
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 98.36
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 98.34
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 98.32
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 98.28
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 98.16
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 97.71
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 82.74
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
Probab=99.03  E-value=4.1e-10  Score=75.40  Aligned_cols=71  Identities=25%  Similarity=0.279  Sum_probs=57.9

Q ss_pred             ccccccchhHHHHHHHHHHHcCCCHHhH-------------------------------HHHHhCchhccHHHHHHHHHc
Q psy1719           2 PYDICEAEAALDHIEAEMAARGVTQALI-------------------------------DETRAAPETRMLEDLAAEAAR   50 (73)
Q Consensus         2 p~Diaede~~~~~ie~~m~~~Gi~~~~~-------------------------------~~~r~a~e~~~l~~v~~ll~~   50 (73)
                      |+.+|......++++..+.+.|++....                               ..++.|+..|..+.|++|+++
T Consensus       142 ~l~~A~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~  221 (299)
T 1s70_B          142 PLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQA  221 (299)
T ss_dssp             HHHHCCSHHHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHTCCCCCCCTTTCCCHHHHHHHHTCHHHHHHHHTT
T ss_pred             HHHHHHhcchHHHHHHHHhhcCCCchhhhhhhhhHHHHHHHHHHhccCcchhhhcCCCCCHHHHHHHCCcHHHHHHHHHc
Confidence            5666666677777777777777764332                               237788899999999999999


Q ss_pred             CCCCCCCCCCCCchHHHHhhhcC
Q psy1719          51 GQDLEYKDPASGATPSVNGLRYK   73 (73)
Q Consensus        51 Gadvn~~d~~~G~TpLH~Aa~~~   73 (73)
                      |+|+|.+|. .|.||||+|+.+|
T Consensus       222 g~d~~~~d~-~g~tpL~~A~~~~  243 (299)
T 1s70_B          222 RYDVNIKDY-DGWTPLHAAAHWG  243 (299)
T ss_dssp             TCCTTCCCT-TCCCHHHHHHHTT
T ss_pred             CCCCCCcCC-CCCcHHHHHHhcC
Confidence            999999999 9999999999875



>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1ihba_ 156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 98.99
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 98.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 98.97
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 98.94
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 98.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 98.93
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 98.88
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 98.86
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 98.86
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 98.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 98.84
d1wdya_ 285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 98.83
d1awcb_ 153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 98.83
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 98.82
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 98.82
d1k1aa_ 228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 98.73
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 98.72
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 98.72
d1sw6a_ 301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 98.71
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 98.66
d1bd8a_ 156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 98.65
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 98.65
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 98.63
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 98.6
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 98.58
d1ixva_ 229 26S proteasome non-ATPase regulatory subunit 10, g 98.57
d1oy3d_ 255 Transcription factor inhibitor I-kappa-B-beta, IKB 98.51
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 98.41
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 98.4
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 98.39
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 98.37
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 98.35
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 98.32
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 98.3
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 98.03
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 53BP2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.04  E-value=3.9e-11  Score=73.19  Aligned_cols=41  Identities=17%  Similarity=0.051  Sum_probs=33.4

Q ss_pred             HHhCchhccHHHHHHHHHcCCCCCCCCCCCCchHHHHhhhcC
Q psy1719          32 TRAAPETRMLEDLAAEAARGQDLEYKDPASGATPSVNGLRYK   73 (73)
Q Consensus        32 ~r~a~e~~~l~~v~~ll~~Gadvn~~d~~~G~TpLH~Aa~~~   73 (73)
                      ++.|...+..+.+++|++.|+|+|.+|. +|+||||+|+.+|
T Consensus        38 Lh~A~~~~~~~~~~~ll~~g~~~~~~d~-~g~tpLh~A~~~g   78 (130)
T d1ycsb1          38 LHNAVCAGHTEIVKFLVQFGVNVNAADS-DGWTPLHCAASCN   78 (130)
T ss_dssp             HHHHHHHTCHHHHHHHHHHTCCTTCCCT-TCCCHHHHHHHTT
T ss_pred             cccccccccccccccccccccccccccc-cCcccccccchhh
Confidence            6777778888888888888888888888 8888888888765



>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure