Psyllid ID: psy17284

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MKAELIIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTLDGANVEMAEEMGNDNIFIFGMTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWDRPGAIPLKGPVPTTQLVLRWASSGRWPVTFMEHFRGSSHRDISTSTSSSGQVESSFPETGQKFAALITIFLIEERTAKGKWHTRTIMIGGKAAPGYYTAKKIIKLICSVARVVNNDPDVGDKLKVVFLENYRVTLAELIIPAADLSEQISTAGTEASGTGNMKFMIP
ccccEEEcccccHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHccccEEEEcccHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccEEccccccHHHHHccccccccccccccccc
ccHHHHHHHccEEEEccccccccccHHHHHHHHHccEEEEccccHHHHHHHHHcHHHcEEccccHHHHHHHcccccccHHHHHHcHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHccEEEEccccccccccHHHHHHHHc
mkaeliipaadlseqistagteasgtgnMKFMLNGALtigtldgaNVEMAEEMGNDNIFIFGMTVDQVEELKkkgydapsyynanpeLKLVVDQItngffspenpdefkDLSDILlkwdrpgaiplkgpvpttQLVLRWassgrwpvtfmehfrgsshrdiststsssgqvessfpetGQKFAALITIFLIEERtakgkwhtrtimiggkaapgyytAKKIIKLICSVARvvnndpdvgdkLKVVFLENYRVTLAELIIpaadlseqistagteasgtgnmkfmip
mkaeliipaadlseqistAGTEASGTGNMKFMLNGALTIGTLDGANVEMAEEMGNDNIFIFGMTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWDRPGAiplkgpvpttqLVLRWASSGRWPVTFMEHFRGSSHRDISTSTSSSGQVESSFPETGQKFAALITIFLIEErtakgkwhtrtimiggkaapgyyTAKKIIKLICSVARVVNndpdvgdklKVVFLENYRVTLAELIIPAADLSEQIstagteasgtgnmkfmip
MKAELIIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTLDGANVEMAEEMGNDNIFIFGMTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWDRPGAIPLKGPVPTTQLVLRWASSGRWPVTFMEHFRGsshrdiststsssgqvessFPETGQKFAALITIFLIEERTAKGKWHTRTIMIGGKAAPGYYTAKKIIKLICSVARVVNNDPDVGDKLKVVFLENYRVTLAELIIPAADLSEQISTAGTEASGTGNMKFMIP
****************************MKFMLNGALTIGTLDGANVEMAEEMGNDNIFIFGMTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWDRPGAIPLKGPVPTTQLVLRWASSGRWPVTFMEHF***************************KFAALITIFLIEERTAKGKWHTRTIMIGGKAAPGYYTAKKIIKLICSVARVVNNDPDVGDKLKVVFLENYRVTLAELIIPAADL**********************
***ELIIPAADLSEQIS*********GNMKFMLNGALTIGTLDGANVEMAEEMGNDNIFIFGMTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWDRPGAIPLKGPVPTTQLVLRWASSGRWPVTFMEHFRGSSHRDISTSTSSSGQVESSFPETGQKFAALITIFLIEERTAKGKWHTRTIMIGGKAAPGYYTAKKIIKLICSVARVVNNDPDVGDKLKVVFLENYRVTLAELIIPAADLSEQISTAGTEASGTGNMKFMIP
MKAELIIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTLDGANVEMAEEMGNDNIFIFGMTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWDRPGAIPLKGPVPTTQLVLRWASSGRWPVTFMEHFR**********************ETGQKFAALITIFLIEERTAKGKWHTRTIMIGGKAAPGYYTAKKIIKLICSVARVVNNDPDVGDKLKVVFLENYRVTLAELIIPAADLSEQISTAGTEASGTGNMKFMIP
*KAELIIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTLDGANVEMAEEMGNDNIFIFGMTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWDRPGAIPLKGPVPTTQLVLRWASSGRWPVTFMEHFRGSSHRDISTSTSSSGQVESSFPETGQKFAALITIFLIEERTAKGKWHTRTIMIGGKAAPGYYTAKKIIKLICSVARVVNNDPDVGDKLKVVFLENYRVTLAELIIPAADLSEQIST****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAELIIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTLDGANVEMAEEMGNDNIFIFGMTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWDRPGAIPLKGPVPTTQLVLRWASSGRWPVTFMEHFRGSSHRDISTSTSSSGQVESSFPETGQKFAALITIFLIEERTAKGKWHTRTIMIGGKAAPGYYTAKKIIKLICSVARVVNNDPDVGDKLKVVFLENYRVTLAELIIPAADLSEQISTAGTEASGTGNMKFMIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query286 2.2.26 [Sep-21-2011]
Q9XTL9844 Glycogen phosphorylase OS yes N/A 0.412 0.139 0.822 1e-50
P09811850 Glycogen phosphorylase, l yes N/A 0.412 0.138 0.745 4e-45
Q9ET01850 Glycogen phosphorylase, l yes N/A 0.412 0.138 0.745 4e-45
P06737847 Glycogen phosphorylase, l yes N/A 0.412 0.139 0.737 4e-45
P79334842 Glycogen phosphorylase, m yes N/A 0.412 0.140 0.703 7e-44
O18751842 Glycogen phosphorylase, m N/A N/A 0.412 0.140 0.694 9e-44
Q0VCM4851 Glycogen phosphorylase, l no N/A 0.412 0.138 0.720 1e-43
Q5MIB6843 Glycogen phosphorylase, b N/A N/A 0.412 0.139 0.711 2e-43
P11216843 Glycogen phosphorylase, b no N/A 0.412 0.139 0.703 3e-43
P09812842 Glycogen phosphorylase, m no N/A 0.412 0.140 0.677 4e-43
>sp|Q9XTL9|PYG_DROME Glycogen phosphorylase OS=Drosophila melanogaster GN=GlyP PE=2 SV=2 Back     alignment and function desciption
 Score =  199 bits (507), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 107/118 (90%)

Query: 3   AELIIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTLDGANVEMAEEMGNDNIFIFG 62
           AE I+PAADLSEQISTAGTEASGTGNMKF LNGALTIGTLDGANVEMAEEMG DNIFIFG
Sbjct: 654 AEKIMPAADLSEQISTAGTEASGTGNMKFQLNGALTIGTLDGANVEMAEEMGLDNIFIFG 713

Query: 63  MTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWDR 120
           MTVD+VE LKKKGY+A  YYNANPE+K V+DQI  GFFSP NP+EFK+++DILLK+D 
Sbjct: 714 MTVDEVEALKKKGYNAYDYYNANPEVKQVIDQIQGGFFSPGNPNEFKNIADILLKYDH 771
Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1
>sp|P09811|PYGL_RAT Glycogen phosphorylase, liver form OS=Rattus norvegicus GN=Pygl PE=1 SV=5 Back     alignment and function description
>sp|Q9ET01|PYGL_MOUSE Glycogen phosphorylase, liver form OS=Mus musculus GN=Pygl PE=1 SV=4 Back     alignment and function description
>sp|P06737|PYGL_HUMAN Glycogen phosphorylase, liver form OS=Homo sapiens GN=PYGL PE=1 SV=4 Back     alignment and function description
>sp|P79334|PYGM_BOVIN Glycogen phosphorylase, muscle form OS=Bos taurus GN=PYGM PE=1 SV=3 Back     alignment and function description
>sp|O18751|PYGM_SHEEP Glycogen phosphorylase, muscle form OS=Ovis aries GN=PYGM PE=2 SV=3 Back     alignment and function description
>sp|Q0VCM4|PYGL_BOVIN Glycogen phosphorylase, liver form OS=Bos taurus GN=PYGL PE=2 SV=1 Back     alignment and function description
>sp|Q5MIB6|PYGB_SHEEP Glycogen phosphorylase, brain form OS=Ovis aries GN=PYGB PE=2 SV=3 Back     alignment and function description
>sp|P11216|PYGB_HUMAN Glycogen phosphorylase, brain form OS=Homo sapiens GN=PYGB PE=1 SV=5 Back     alignment and function description
>sp|P09812|PYGM_RAT Glycogen phosphorylase, muscle form OS=Rattus norvegicus GN=Pygm PE=2 SV=5 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
91081301 849 PREDICTED: similar to AGAP007939-PA [Tri 0.412 0.138 0.872 4e-53
443682290 844 glycogen phosphorylase, partial [Cotesia 0.412 0.139 0.830 2e-51
328781343 1302 PREDICTED: LOW QUALITY PROTEIN: glycogen 0.412 0.090 0.838 2e-51
350410146 1302 PREDICTED: glycogen phosphorylase-like [ 0.412 0.090 0.838 4e-51
380012845 1306 PREDICTED: LOW QUALITY PROTEIN: glycogen 0.412 0.090 0.830 9e-51
383864340 1322 PREDICTED: LOW QUALITY PROTEIN: glycogen 0.412 0.089 0.830 1e-50
193695245 851 PREDICTED: glycogen phosphorylase-like i 0.412 0.138 0.822 6e-50
193695249 846 PREDICTED: glycogen phosphorylase-like i 0.412 0.139 0.822 7e-50
157108521 845 glycogen phosphorylase [Aedes aegypti] g 0.412 0.139 0.796 1e-49
170037076 842 glycogen phosphorylase [Culex quinquefas 0.412 0.140 0.805 2e-49
>gi|91081301|ref|XP_968960.1| PREDICTED: similar to AGAP007939-PA [Tribolium castaneum] gi|270006093|gb|EFA02541.1| hypothetical protein TcasGA2_TC008246 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  214 bits (545), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 111/118 (94%)

Query: 3   AELIIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTLDGANVEMAEEMGNDNIFIFG 62
           AE IIPAADLSEQISTAGTEASGTGNMKF LNGALTIGTLDGANVEMAEEMG +NIFIFG
Sbjct: 654 AEKIIPAADLSEQISTAGTEASGTGNMKFQLNGALTIGTLDGANVEMAEEMGRENIFIFG 713

Query: 63  MTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWDR 120
           MTV++VEELK+KGY+A  YYNANPELKLVVDQI NGFF+P NPDEFKDL+DILLK+DR
Sbjct: 714 MTVEEVEELKRKGYNAYDYYNANPELKLVVDQIQNGFFTPNNPDEFKDLADILLKYDR 771

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|443682290|gb|AGC97435.1| glycogen phosphorylase, partial [Cotesia vestalis] Back     alignment and taxonomy information
>gi|328781343|ref|XP_623386.2| PREDICTED: LOW QUALITY PROTEIN: glycogen phosphorylase isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|350410146|ref|XP_003488962.1| PREDICTED: glycogen phosphorylase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380012845|ref|XP_003690485.1| PREDICTED: LOW QUALITY PROTEIN: glycogen phosphorylase-like [Apis florea] Back     alignment and taxonomy information
>gi|383864340|ref|XP_003707637.1| PREDICTED: LOW QUALITY PROTEIN: glycogen phosphorylase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|193695245|ref|XP_001950760.1| PREDICTED: glycogen phosphorylase-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193695249|ref|XP_001950782.1| PREDICTED: glycogen phosphorylase-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|157108521|ref|XP_001650265.1| glycogen phosphorylase [Aedes aegypti] gi|108884025|gb|EAT48250.1| AAEL000703-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170037076|ref|XP_001846386.1| glycogen phosphorylase [Culex quinquefasciatus] gi|167880093|gb|EDS43476.1| glycogen phosphorylase [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
FB|FBgn0004507844 GlyP "Glycogen phosphorylase" 0.409 0.138 0.829 6.3e-47
UNIPROTKB|F1PB77870 PYGL "Phosphorylase" [Canis lu 0.412 0.135 0.754 5.6e-42
UNIPROTKB|E9PK47819 PYGL "Phosphorylase" [Homo sap 0.412 0.144 0.737 9.5e-42
UNIPROTKB|P06737847 PYGL "Glycogen phosphorylase, 0.412 0.139 0.737 1.1e-41
MGI|MGI:97829850 Pygl "liver glycogen phosphory 0.412 0.138 0.745 1.1e-41
RGD|620687850 Pygl "phosphorylase, glycogen, 0.412 0.138 0.745 1.1e-41
ZFIN|ZDB-GENE-040426-1206842 pygmb "phosphorylase, glycogen 0.412 0.140 0.720 4.7e-41
UNIPROTKB|F1RQQ7730 PYGB "Phosphorylase" [Sus scro 0.412 0.161 0.728 7e-41
ZFIN|ZDB-GENE-040928-2843 pygb "phosphorylase, glycogen; 0.412 0.139 0.711 1.3e-40
UNIPROTKB|F1SFF8854 PYGL "Phosphorylase" [Sus scro 0.412 0.138 0.728 1.7e-40
FB|FBgn0004507 GlyP "Glycogen phosphorylase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 498 (180.4 bits), Expect = 6.3e-47, P = 6.3e-47
 Identities = 97/117 (82%), Positives = 107/117 (91%)

Query:     3 AELIIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTLDGANVEMAEEMGNDNIFIFG 62
             AE I+PAADLSEQISTAGTEASGTGNMKF LNGALTIGTLDGANVEMAEEMG DNIFIFG
Sbjct:   654 AEKIMPAADLSEQISTAGTEASGTGNMKFQLNGALTIGTLDGANVEMAEEMGLDNIFIFG 713

Query:    63 MTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWD 119
             MTVD+VE LKKKGY+A  YYNANPE+K V+DQI  GFFSP NP+EFK+++DILLK+D
Sbjct:   714 MTVDEVEALKKKGYNAYDYYNANPEVKQVIDQIQGGFFSPGNPNEFKNIADILLKYD 770
GO:0008184 "glycogen phosphorylase activity" evidence=IMP;IDA
GO:0043234 "protein complex" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0030170 "pyridoxal phosphate binding" evidence=IDA
GO:0005980 "glycogen catabolic process" evidence=IMP
GO:0060361 "flight" evidence=IMP
UNIPROTKB|F1PB77 PYGL "Phosphorylase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PK47 PYGL "Phosphorylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P06737 PYGL "Glycogen phosphorylase, liver form" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:97829 Pygl "liver glycogen phosphorylase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620687 Pygl "phosphorylase, glycogen, liver" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1206 pygmb "phosphorylase, glycogen (muscle) b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQQ7 PYGB "Phosphorylase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040928-2 pygb "phosphorylase, glycogen; brain" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SFF8 PYGL "Phosphorylase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ET01PYGL_MOUSE2, ., 4, ., 1, ., 10.74570.41250.1388yesN/A
P06737PYGL_HUMAN2, ., 4, ., 1, ., 10.73720.41250.1393yesN/A
P0AC87PHSG_SHIFL2, ., 4, ., 1, ., 10.64650.40550.1423yesN/A
Q9XTL9PYG_DROME2, ., 4, ., 1, ., 10.82200.41250.1398yesN/A
P79334PYGM_BOVIN2, ., 4, ., 1, ., 10.70330.41250.1401yesN/A
P09811PYGL_RAT2, ., 4, ., 1, ., 10.74570.41250.1388yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.10.691
4th Layer2.4.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
cd04300797 cd04300, GT1_Glycogen_Phosphorylase, This is a fam 8e-76
TIGR02093794 TIGR02093, P_ylase, glycogen/starch/alpha-glucan p 2e-65
pfam00343712 pfam00343, Phosphorylase, Carbohydrate phosphoryla 8e-63
cd04300 797 cd04300, GT1_Glycogen_Phosphorylase, This is a fam 2e-61
TIGR02093 794 TIGR02093, P_ylase, glycogen/starch/alpha-glucan p 1e-53
COG0058750 COG0058, GlgP, Glucan phosphorylase [Carbohydrate 3e-53
PRK14985798 PRK14985, PRK14985, maltodextrin phosphorylase; Pr 1e-52
PRK14986815 PRK14986, PRK14986, glycogen phosphorylase; Provis 2e-52
pfam00343 712 pfam00343, Phosphorylase, Carbohydrate phosphoryla 1e-50
PRK14985 798 PRK14985, PRK14985, maltodextrin phosphorylase; Pr 3e-40
COG0058 750 COG0058, GlgP, Glucan phosphorylase [Carbohydrate 2e-39
PRK14986 815 PRK14986, PRK14986, glycogen phosphorylase; Provis 6e-38
TIGR02094601 TIGR02094, more_P_ylases, alpha-glucan phosphoryla 6e-06
cd04299 778 cd04299, GT1_Glycogen_Phosphorylase_like, This fam 7e-05
>gnl|CDD|99996 cd04300, GT1_Glycogen_Phosphorylase, This is a family of oligosaccharide phosphorylases Back     alignment and domain information 
 Score =  245 bits (629), Expect = 8e-76
 Identities = 82/118 (69%), Positives = 96/118 (81%)

Query: 2   KAELIIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTLDGANVEMAEEMGNDNIFIF 61
            AE IIPAADLSEQISTAG EASGTGNMKFMLNGALTIGTLDGANVE+AEE+G +NIFIF
Sbjct: 621 LAEKIIPAADLSEQISTAGKEASGTGNMKFMLNGALTIGTLDGANVEIAEEVGEENIFIF 680

Query: 62  GMTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWD 119
           G+T ++VE L+  GY    YY A+PEL+ V+DQI +GFFSP +P EF+ L D LL  +
Sbjct: 681 GLTAEEVEALRANGYYPADYYEADPELRRVLDQIASGFFSPGDPGEFRPLVDSLLNGN 738

It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. Length = 797
>gnl|CDD|233722 TIGR02093, P_ylase, glycogen/starch/alpha-glucan phosphorylases Back     alignment and domain information
>gnl|CDD|215868 pfam00343, Phosphorylase, Carbohydrate phosphorylase Back     alignment and domain information
>gnl|CDD|99996 cd04300, GT1_Glycogen_Phosphorylase, This is a family of oligosaccharide phosphorylases Back     alignment and domain information
>gnl|CDD|233722 TIGR02093, P_ylase, glycogen/starch/alpha-glucan phosphorylases Back     alignment and domain information
>gnl|CDD|223136 COG0058, GlgP, Glucan phosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237881 PRK14985, PRK14985, maltodextrin phosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|184948 PRK14986, PRK14986, glycogen phosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|215868 pfam00343, Phosphorylase, Carbohydrate phosphorylase Back     alignment and domain information
>gnl|CDD|237881 PRK14985, PRK14985, maltodextrin phosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|223136 COG0058, GlgP, Glucan phosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184948 PRK14986, PRK14986, glycogen phosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|233723 TIGR02094, more_P_ylases, alpha-glucan phosphorylases Back     alignment and domain information
>gnl|CDD|99995 cd04299, GT1_Glycogen_Phosphorylase_like, This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 286
cd04300 797 GT1_Glycogen_Phosphorylase This is a family of oli 100.0
TIGR02093 794 P_ylase glycogen/starch/alpha-glucan phosphorylase 100.0
PRK14985 798 maltodextrin phosphorylase; Provisional 100.0
PRK14986 815 glycogen phosphorylase; Provisional 100.0
PF00343 713 Phosphorylase: Carbohydrate phosphorylase; InterPr 100.0
KOG2099|consensus843 100.0
TIGR02093794 P_ylase glycogen/starch/alpha-glucan phosphorylase 100.0
PRK14985798 maltodextrin phosphorylase; Provisional 100.0
cd04300797 GT1_Glycogen_Phosphorylase This is a family of oli 100.0
PRK14986815 glycogen phosphorylase; Provisional 100.0
KOG2099|consensus 843 100.0
PF00343713 Phosphorylase: Carbohydrate phosphorylase; InterPr 100.0
COG0058 750 GlgP Glucan phosphorylase [Carbohydrate transport 100.0
COG0058750 GlgP Glucan phosphorylase [Carbohydrate transport 100.0
cd04299 778 GT1_Glycogen_Phosphorylase_like This family is mos 100.0
TIGR02094601 more_P_ylases alpha-glucan phosphorylases. This fa 100.0
cd04299778 GT1_Glycogen_Phosphorylase_like This family is mos 99.91
TIGR02094601 more_P_ylases alpha-glucan phosphorylases. This fa 99.86
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 98.12
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 97.71
PRK00654466 glgA glycogen synthase; Provisional 97.52
PRK14098489 glycogen synthase; Provisional 97.17
PRK14099485 glycogen synthase; Provisional 96.81
COG0297487 GlgA Glycogen synthase [Carbohydrate transport and 96.02
PLN023161036 synthase/transferase 95.83
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 95.43
PLN02939977 transferase, transferring glycosyl groups 94.85
cd03805392 GT1_ALG2_like This family is most closely related 93.59
PRK00654466 glgA glycogen synthase; Provisional 91.79
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 91.65
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 91.02
PRK14098489 glycogen synthase; Provisional 90.19
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 89.69
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 89.28
cd03821375 GT1_Bme6_like This family is most closely related 88.72
cd03795357 GT1_like_4 This family is most closely related to 87.25
TIGR02470 784 sucr_synth sucrose synthase. This model represents 87.17
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 87.08
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 86.55
cd03788460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a 83.78
KOG2074|consensus 548 82.4
PRK14099485 glycogen synthase; Provisional 81.41
PLN00142 815 sucrose synthase 81.29
cd03809365 GT1_mtfB_like This family is most closely related 80.77
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 80.44
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 80.38
>cd04300 GT1_Glycogen_Phosphorylase This is a family of oligosaccharide phosphorylases Back     alignment and domain information 
Probab=100.00  E-value=2.3e-57  Score=465.63  Aligned_cols=219  Identities=41%  Similarity=0.534  Sum_probs=183.2

Q ss_pred             eehhhhhhcCccEEEecCCHHHHHHHHHc-----------------------CCCCCcccc-CChhHHHHHHHHhc-CCC
Q psy17284         46 NVEMAEEMGNDNIFIFGMTVDQVEELKKK-----------------------GYDAPSYYN-ANPELKLVVDQITN-GFF  100 (286)
Q Consensus        46 nvEi~e~vg~eN~fiFG~~~~eV~~l~~~-----------------------gy~p~~~~~-~np~L~~vlD~i~~-G~f  100 (286)
                      -|.|+..+     .+.++++++|++||++                       |++||+|.. +||+|++.++..++ +|.
T Consensus       407 ~v~Ma~LA-----i~~S~~vNGVS~lH~ei~k~~~~~df~~l~P~kf~n~TNGVt~rrWl~~~np~L~~Li~~~ig~~W~  481 (797)
T cd04300         407 QVRMAHLA-----IVGSHSVNGVAALHSELLKETVFKDFYELYPEKFNNKTNGITPRRWLLQANPGLSALITETIGDDWV  481 (797)
T ss_pred             EEehHHHH-----HhcCcchhhhHHHHHHHHHHhhHHHHHhhCCCccCCcCCCCCcchhhhhcCHHHHHHHHHhcCchhh
Confidence            47777776     7889999999999974                       899999986 89999999998877 544


Q ss_pred             CCCChhhHHHHHHHHhcCCCCeeeccCCchHHHHHHHHHHhcCCcchhHHHHHhhccCCCCCCCCcccccccCCCCcccc
Q psy17284        101 SPENPDEFKDLSDILLKWDRPGAIPLKGPVPTTQLVLRWASSGRWPVTFMEHFRGSSHRDISTSTSSSGQVESSFPETGQ  180 (286)
Q Consensus       101 ~~~d~~~f~~Lyd~L~~~D~ylvlaY~d~~~W~k~~i~IA~~g~FSSDi~eY~~~~tG~~~~~~~~~~~~~rR~~~YKR~  180 (286)
                        .+++..+.|-. + ..|.-++     .+-|..+.....       ++.+|+++.+|+.++|++|||+|||||||||||
T Consensus       482 --~d~~~l~~l~~-~-~~D~~f~-----~~l~~~K~~nK~-------~L~~~i~~~~g~~ldp~slfdvq~KR~heYKRq  545 (797)
T cd04300         482 --TDLDQLKKLEP-F-ADDPAFL-----KEFRAIKQANKE-------RLAAYIKKTTGVEVDPDSLFDVQVKRIHEYKRQ  545 (797)
T ss_pred             --hChHHHHHHHh-c-CCCHHHH-----HHHHHHHHHHHH-------HHHHHHHHHhCCccCCCccEEEEeeechhhhhh
Confidence              45655544422 1 1111111     222333322211       167999999999999999999999999999999


Q ss_pred             chhhHHhhHHHHHHhhc--CCccceEEEEeecCCCCCHHHHHHHHHHHHHHHHHcCCcCCCCceeEEEEcCCChhhhhhh
Q psy17284        181 KFAALITIFLIEERTAK--GKWHTRTIMIGGKAAPGYYTAKKIIKLICSVARVVNNDPDVGDKLKVVFLENYRVTLAELI  258 (286)
Q Consensus       181 ~l~~l~~i~~~~~~~~~--~~~~p~~~i~~GKa~P~d~~~k~~i~~i~~~~~~~~~d~~~~~~~~vvfl~nY~~~~a~~l  258 (286)
                      +||+||++.+|.+.+.+  ...+|+||||||||||+|..||+|||+|++++++|||||+++++|||||||||+|++|++|
T Consensus       546 ~LNil~ii~~y~~i~~~p~~~~~P~~~IFaGKAaP~y~~aK~iIklI~~va~~in~Dp~v~~~lkVVFlenY~VslAe~i  625 (797)
T cd04300         546 LLNVLHIIHLYNRIKENPNADIVPRTFIFGGKAAPGYYMAKLIIKLINAVADVVNNDPDVGDKLKVVFLPNYNVSLAEKI  625 (797)
T ss_pred             hhHHHhhHHHHHHHHhCCCcCCCCeEEEEeccCCCCcHHHHHHHHHHHHHHHHhccChhcCCceEEEEeCCCChHHHHHh
Confidence            99999999999887653  3458999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccccCCCCCCCccCcccccccC
Q psy17284        259 IPAADLSEQISTAGTEASGTGNMKFMI  285 (286)
Q Consensus       259 ~~~~Dv~~~~p~~~~EAsGTs~MK~~~  285 (286)
                      +||||||+|||++|+||||||||||||
T Consensus       626 ipaaDvseqis~ag~EASGTsnMK~~l  652 (797)
T cd04300         626 IPAADLSEQISTAGKEASGTGNMKFML  652 (797)
T ss_pred             hhhhhhhhhCCCCCccccCCchhhHHh
Confidence            999999999999999999999999998

It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
>TIGR02093 P_ylase glycogen/starch/alpha-glucan phosphorylases Back     alignment and domain information
>PRK14985 maltodextrin phosphorylase; Provisional Back     alignment and domain information
>PRK14986 glycogen phosphorylase; Provisional Back     alignment and domain information
>PF00343 Phosphorylase: Carbohydrate phosphorylase; InterPro: IPR000811 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>KOG2099|consensus Back     alignment and domain information
>TIGR02093 P_ylase glycogen/starch/alpha-glucan phosphorylases Back     alignment and domain information
>PRK14985 maltodextrin phosphorylase; Provisional Back     alignment and domain information
>cd04300 GT1_Glycogen_Phosphorylase This is a family of oligosaccharide phosphorylases Back     alignment and domain information
>PRK14986 glycogen phosphorylase; Provisional Back     alignment and domain information
>KOG2099|consensus Back     alignment and domain information
>PF00343 Phosphorylase: Carbohydrate phosphorylase; InterPro: IPR000811 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>COG0058 GlgP Glucan phosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0058 GlgP Glucan phosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences Back     alignment and domain information
>TIGR02094 more_P_ylases alpha-glucan phosphorylases Back     alignment and domain information
>cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences Back     alignment and domain information
>TIGR02094 more_P_ylases alpha-glucan phosphorylases Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>KOG2074|consensus Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
1xoi_A846 Human Liver Glycogen Phosphorylase A Complexed With 6e-46
1xoi_A 846 Human Liver Glycogen Phosphorylase A Complexed With 2e-33
1em6_A847 Human Liver Glycogen Phosphorylase A Complexed With 6e-46
1em6_A 847 Human Liver Glycogen Phosphorylase A Complexed With 2e-33
1fa9_A846 Human Liver Glycogen Phosphorylase A Complexed With 6e-46
1fa9_A 846 Human Liver Glycogen Phosphorylase A Complexed With 2e-33
1fc0_A846 Human Liver Glycogen Phosphorylase Complexed With N 7e-46
1fc0_A 846 Human Liver Glycogen Phosphorylase Complexed With N 2e-33
3dds_A848 Crystal Structure Of Glycogen Phosphorylase Complex 7e-46
3dds_A 848 Crystal Structure Of Glycogen Phosphorylase Complex 2e-33
3ceh_A809 Human Liver Glycogen Phosphorylase (Tense State) In 7e-46
3ceh_A 809 Human Liver Glycogen Phosphorylase (Tense State) In 2e-33
2qll_A847 Human Liver Glycogen Phosphorylase- Gl Complex Leng 7e-46
2qll_A 847 Human Liver Glycogen Phosphorylase- Gl Complex Leng 2e-33
2zb2_A849 Human Liver Glycogen Phosphorylase A Complexed With 7e-46
2zb2_A 849 Human Liver Glycogen Phosphorylase A Complexed With 2e-33
2gm9_A825 Structure Of Rabbit Muscle Glycogen Phosphorylase I 1e-43
2gm9_A 825 Structure Of Rabbit Muscle Glycogen Phosphorylase I 4e-33
2ffr_A825 Crystallographic Studies On N-Azido-Beta-D-Glucopyr 1e-43
2ffr_A 825 Crystallographic Studies On N-Azido-Beta-D-Glucopyr 4e-33
1abb_A828 Control Of Phosphorylase B Conformation By A Modifi 1e-43
1abb_A 828 Control Of Phosphorylase B Conformation By A Modifi 4e-33
2gj4_A824 Structure Of Rabbit Muscle Glycogen Phosphorylase I 1e-43
2gj4_A 824 Structure Of Rabbit Muscle Glycogen Phosphorylase I 4e-33
7gpb_A842 Structural Mechanism For Glycogen Phosphorylase Con 1e-43
7gpb_A 842 Structural Mechanism For Glycogen Phosphorylase Con 4e-33
1c8l_A842 Synergistic Inhibition Of Glycogen Phosphorylase A 1e-43
1c8l_A 842 Synergistic Inhibition Of Glycogen Phosphorylase A 4e-33
1noi_A842 Complex Of Glycogen Phosphorylase With A Transition 1e-43
1noi_A 842 Complex Of Glycogen Phosphorylase With A Transition 2e-32
1gpa_A842 Structural Mechanism For Glycogen Phosphorylase Con 1e-43
1gpa_A 842 Structural Mechanism For Glycogen Phosphorylase Con 4e-33
1pyg_A842 Structural Basis For The Activation Of Glycogen Pho 1e-43
1pyg_A 842 Structural Basis For The Activation Of Glycogen Pho 4e-33
1c50_A830 Identification And Structural Characterization Of A 2e-43
1c50_A 830 Identification And Structural Characterization Of A 5e-33
1z8d_A842 Crystal Structure Of Human Muscle Glycogen Phosphor 4e-43
1z8d_A 842 Crystal Structure Of Human Muscle Glycogen Phosphor 3e-32
4ej2_A825 Crystal Structure Of Gpb In Complex With Dk10 Lengt 6e-43
4ej2_A 825 Crystal Structure Of Gpb In Complex With Dk10 Lengt 2e-32
1z6p_A842 Glycogen Phosphorylase Amp Site Inhibitor Complex L 6e-43
1z6p_A 842 Glycogen Phosphorylase Amp Site Inhibitor Complex L 2e-32
3nc4_A841 The Binding Of Beta-D-Glucopyranosyl-Thiosemicarbaz 6e-43
3nc4_A 841 The Binding Of Beta-D-Glucopyranosyl-Thiosemicarbaz 2e-32
2pyd_A843 The Crystal Structure Of Glycogen Phosphorylase In 6e-43
2pyd_A 843 The Crystal Structure Of Glycogen Phosphorylase In 2e-32
2g9q_A842 The Crystal Structure Of The Glycogen Phosphorylase 6e-43
2g9q_A 842 The Crystal Structure Of The Glycogen Phosphorylase 2e-32
1ygp_B879 Phosphorylated Form Of Yeast Glycogen Phosphorylase 3e-29
1ygp_B 879 Phosphorylated Form Of Yeast Glycogen Phosphorylase 3e-24
1qm5_A796 Phosphorylase Recognition And Phosphorylysis Of Its 3e-28
1qm5_A 796 Phosphorylase Recognition And Phosphorylysis Of Its 1e-25
1l5v_A796 Crystal Structure Of The Maltodextrin Phosphorylase 3e-28
1l5v_A 796 Crystal Structure Of The Maltodextrin Phosphorylase 1e-25
2ecp_A796 The Crystal Structure Of The E. Coli Maltodextrin P 4e-28
2ecp_A 796 The Crystal Structure Of The E. Coli Maltodextrin P 1e-25
1ahp_A797 Oligosaccharide Substrate Binding In Escherichia Co 4e-28
1ahp_A 797 Oligosaccharide Substrate Binding In Escherichia Co 2e-25
2c4m_A 796 Starch Phosphorylase: Structural Studies Explain Ox 2e-26
>pdb|1XOI|A Chain A, Human Liver Glycogen Phosphorylase A Complexed With Chloroindoloyl Glycine Amide Length = 846 Back     alignment and structure 
Iteration: 1

 Score =  180 bits (457), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 87/118 (73%), Positives = 98/118 (83%)
Query: 3   AELIIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTLDGANVEMAEEMGNDNIFIFG 62
           AE +IPA DLSEQISTAGTEASGTGNMKFMLNGALTIGT+DGANVEMAEE G +N+FIFG
Sbjct: 653 AEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFG 712
Query: 63  MTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWDR 120
           M +D V  L KKGY+A  YY A PELKLV+DQI NGFFSP+ PD FKD+ ++L   DR
Sbjct: 713 MRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDR 770
>pdb|1XOI|A Chain A, Human Liver Glycogen Phosphorylase A Complexed With Chloroindoloyl Glycine Amide Length = 846 Back     alignment and structure
>pdb|1EM6|A Chain A, Human Liver Glycogen Phosphorylase A Complexed With Glcnac And Cp-526, 423 Length = 847 Back     alignment and structure
>pdb|1EM6|A Chain A, Human Liver Glycogen Phosphorylase A Complexed With Glcnac And Cp-526, 423 Length = 847 Back     alignment and structure
>pdb|1FA9|A Chain A, Human Liver Glycogen Phosphorylase A Complexed With Amp Length = 846 Back     alignment and structure
>pdb|1FA9|A Chain A, Human Liver Glycogen Phosphorylase A Complexed With Amp Length = 846 Back     alignment and structure
>pdb|1FC0|A Chain A, Human Liver Glycogen Phosphorylase Complexed With N-Acetyl-Beta-D- Glucopyranosylamine Length = 846 Back     alignment and structure
>pdb|1FC0|A Chain A, Human Liver Glycogen Phosphorylase Complexed With N-Acetyl-Beta-D- Glucopyranosylamine Length = 846 Back     alignment and structure
>pdb|3DDS|A Chain A, Crystal Structure Of Glycogen Phosphorylase Complexed With An Anthranilimide Based Inhibitor Gsk261 Length = 848 Back     alignment and structure
>pdb|3DDS|A Chain A, Crystal Structure Of Glycogen Phosphorylase Complexed With An Anthranilimide Based Inhibitor Gsk261 Length = 848 Back     alignment and structure
>pdb|3CEH|A Chain A, Human Liver Glycogen Phosphorylase (Tense State) In Complex With The Allosteric Inhibitor Ave5688 Length = 809 Back     alignment and structure
>pdb|3CEH|A Chain A, Human Liver Glycogen Phosphorylase (Tense State) In Complex With The Allosteric Inhibitor Ave5688 Length = 809 Back     alignment and structure
>pdb|2QLL|A Chain A, Human Liver Glycogen Phosphorylase- Gl Complex Length = 847 Back     alignment and structure
>pdb|2QLL|A Chain A, Human Liver Glycogen Phosphorylase- Gl Complex Length = 847 Back     alignment and structure
>pdb|2ZB2|A Chain A, Human Liver Glycogen Phosphorylase A Complexed With Glcose And 5- Chloro-N-[4-(1, 2-Dihydroxyethyl)phenyl]-1h-Indole-2-Carboxamide Length = 849 Back     alignment and structure
>pdb|2ZB2|A Chain A, Human Liver Glycogen Phosphorylase A Complexed With Glcose And 5- Chloro-N-[4-(1, 2-Dihydroxyethyl)phenyl]-1h-Indole-2-Carboxamide Length = 849 Back     alignment and structure
>pdb|2GM9|A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Thienopyrrole Length = 825 Back     alignment and structure
>pdb|2GM9|A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Thienopyrrole Length = 825 Back     alignment and structure
>pdb|2FFR|A Chain A, Crystallographic Studies On N-Azido-Beta-D-Glucopyranosylamine, An Inhibitor Of Glycogen Phosphorylase: Comparison With N-Acetyl-Beta-D- Glucopyranosylamine Length = 825 Back     alignment and structure
>pdb|2FFR|A Chain A, Crystallographic Studies On N-Azido-Beta-D-Glucopyranosylamine, An Inhibitor Of Glycogen Phosphorylase: Comparison With N-Acetyl-Beta-D- Glucopyranosylamine Length = 825 Back     alignment and structure
>pdb|1ABB|A Chain A, Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate Length = 828 Back     alignment and structure
>pdb|1ABB|A Chain A, Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate Length = 828 Back     alignment and structure
>pdb|2GJ4|A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Ligand Length = 824 Back     alignment and structure
>pdb|2GJ4|A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Ligand Length = 824 Back     alignment and structure
>pdb|7GPB|A Chain A, Structural Mechanism For Glycogen Phosphorylase Control By Phosphorylation And Amp Length = 842 Back     alignment and structure
>pdb|7GPB|A Chain A, Structural Mechanism For Glycogen Phosphorylase Control By Phosphorylation And Amp Length = 842 Back     alignment and structure
>pdb|1C8L|A Chain A, Synergistic Inhibition Of Glycogen Phosphorylase A By A Potential Antidiabetic Drug And Caffeine Length = 842 Back     alignment and structure
>pdb|1C8L|A Chain A, Synergistic Inhibition Of Glycogen Phosphorylase A By A Potential Antidiabetic Drug And Caffeine Length = 842 Back     alignment and structure
>pdb|1NOI|A Chain A, Complex Of Glycogen Phosphorylase With A Transition State Analogue Nojirimycin Tetrazole And Phosphate In The T And R States Length = 842 Back     alignment and structure
>pdb|1NOI|A Chain A, Complex Of Glycogen Phosphorylase With A Transition State Analogue Nojirimycin Tetrazole And Phosphate In The T And R States Length = 842 Back     alignment and structure
>pdb|1GPA|A Chain A, Structural Mechanism For Glycogen Phosphorylase Control By Phosphorylation And Amp Length = 842 Back     alignment and structure
>pdb|1GPA|A Chain A, Structural Mechanism For Glycogen Phosphorylase Control By Phosphorylation And Amp Length = 842 Back     alignment and structure
>pdb|1PYG|A Chain A, Structural Basis For The Activation Of Glycogen Phosphorylase B By Adenosine Monophosphate Length = 842 Back     alignment and structure
>pdb|1PYG|A Chain A, Structural Basis For The Activation Of Glycogen Phosphorylase B By Adenosine Monophosphate Length = 842 Back     alignment and structure
>pdb|1C50|A Chain A, Identification And Structural Characterization Of A Novel Allosteric Binding Site Of Glycogen Phosphorylase B Length = 830 Back     alignment and structure
>pdb|1C50|A Chain A, Identification And Structural Characterization Of A Novel Allosteric Binding Site Of Glycogen Phosphorylase B Length = 830 Back     alignment and structure
>pdb|1Z8D|A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose Length = 842 Back     alignment and structure
>pdb|1Z8D|A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose Length = 842 Back     alignment and structure
>pdb|4EJ2|A Chain A, Crystal Structure Of Gpb In Complex With Dk10 Length = 825 Back     alignment and structure
>pdb|4EJ2|A Chain A, Crystal Structure Of Gpb In Complex With Dk10 Length = 825 Back     alignment and structure
>pdb|1Z6P|A Chain A, Glycogen Phosphorylase Amp Site Inhibitor Complex Length = 842 Back     alignment and structure
>pdb|1Z6P|A Chain A, Glycogen Phosphorylase Amp Site Inhibitor Complex Length = 842 Back     alignment and structure
>pdb|3NC4|A Chain A, The Binding Of Beta-D-Glucopyranosyl-Thiosemicarbazone Derivatives To Glycogen Phosphorylase: A New Class Of Inhibitors Length = 841 Back     alignment and structure
>pdb|3NC4|A Chain A, The Binding Of Beta-D-Glucopyranosyl-Thiosemicarbazone Derivatives To Glycogen Phosphorylase: A New Class Of Inhibitors Length = 841 Back     alignment and structure
>pdb|2PYD|A Chain A, The Crystal Structure Of Glycogen Phosphorylase In Complex With Glucose At 100 K Length = 843 Back     alignment and structure
>pdb|2PYD|A Chain A, The Crystal Structure Of Glycogen Phosphorylase In Complex With Glucose At 100 K Length = 843 Back     alignment and structure
>pdb|2G9Q|A Chain A, The Crystal Structure Of The Glycogen Phosphorylase B- 1ab Complex Length = 842 Back     alignment and structure
>pdb|2G9Q|A Chain A, The Crystal Structure Of The Glycogen Phosphorylase B- 1ab Complex Length = 842 Back     alignment and structure
>pdb|1QM5|A Chain A, Phosphorylase Recognition And Phosphorylysis Of Its Oligosaccharide Substrate: Answers To A Long Outstanding Question Length = 796 Back     alignment and structure
>pdb|1QM5|A Chain A, Phosphorylase Recognition And Phosphorylysis Of Its Oligosaccharide Substrate: Answers To A Long Outstanding Question Length = 796 Back     alignment and structure
>pdb|1L5V|A Chain A, Crystal Structure Of The Maltodextrin Phosphorylase Complexed With Glucose-1-Phosphate Length = 796 Back     alignment and structure
>pdb|1L5V|A Chain A, Crystal Structure Of The Maltodextrin Phosphorylase Complexed With Glucose-1-Phosphate Length = 796 Back     alignment and structure
>pdb|2ECP|A Chain A, The Crystal Structure Of The E. Coli Maltodextrin Phosphorylase Complex Length = 796 Back     alignment and structure
>pdb|2ECP|A Chain A, The Crystal Structure Of The E. Coli Maltodextrin Phosphorylase Complex Length = 796 Back     alignment and structure
>pdb|1AHP|A Chain A, Oligosaccharide Substrate Binding In Escherichia Coli Maltodextrin Phsphorylase Length = 797 Back     alignment and structure
>pdb|1AHP|A Chain A, Oligosaccharide Substrate Binding In Escherichia Coli Maltodextrin Phsphorylase Length = 797 Back     alignment and structure
>pdb|2C4M|A Chain A, Starch Phosphorylase: Structural Studies Explain Oxyanion- Dependent Kinetic Stability And Regulatory Control. Length = 796 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
2gj4_A824 Glycogen phosphorylase, muscle form; transferase; 8e-75
2gj4_A 824 Glycogen phosphorylase, muscle form; transferase; 4e-62
1l5w_A796 Maltodextrin phosphorylase; enzymatic catalysis, s 2e-74
1l5w_A 796 Maltodextrin phosphorylase; enzymatic catalysis, s 7e-62
2c4m_A796 Glycogen phosphorylase; allosteric control, phosph 5e-72
2c4m_A 796 Glycogen phosphorylase; allosteric control, phosph 5e-62
1ygp_A879 Yeast glycogen phosphorylase; phosphorylated form, 1e-68
1ygp_A 879 Yeast glycogen phosphorylase; phosphorylated form, 6e-61
>2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH; 1.60A {Oryctolagus cuniculus} SCOP: c.87.1.4 PDB: 2gm9_A* 1abb_A* 3nc4_A* 3l79_A* 2pyd_A* 2pyi_A* 3l7a_A* 3l7b_A* 3l7c_A* 3l7d_A* 2qnb_A* 1c8l_A* 1axr_A* 1gpy_A* 1e1y_A* 1lwo_A* 1pyg_A* 1uzu_A* 1lwn_A* 1xkx_A* ... Length = 824 Back     alignment and structure
 Score =  243 bits (622), Expect = 8e-75
 Identities = 79/119 (66%), Positives = 100/119 (84%)

Query: 2   KAELIIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTLDGANVEMAEEMGNDNIFIF 61
            AE +IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGT+DGANVEMAEE G +N FIF
Sbjct: 641 LAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIF 700

Query: 62  GMTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWDR 120
           GM V+ V+ L ++GY+A  YY+  PEL+ +++Q+++GFFSP+ PD FKD+ ++L+  DR
Sbjct: 701 GMRVEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDR 759
>2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH; 1.60A {Oryctolagus cuniculus} SCOP: c.87.1.4 PDB: 2gm9_A* 1abb_A* 3nc4_A* 3l79_A* 2pyd_A* 2pyi_A* 3l7a_A* 3l7b_A* 3l7c_A* 3l7d_A* 2qnb_A* 1c8l_A* 1axr_A* 1gpy_A* 1e1y_A* 1lwo_A* 1pyg_A* 1uzu_A* 1lwn_A* 1xkx_A* ... Length = 824 Back     alignment and structure
>1l5w_A Maltodextrin phosphorylase; enzymatic catalysis, substrate complex, trans; HET: GLC PLP; 1.80A {Escherichia coli} SCOP: c.87.1.4 PDB: 1l5v_A* 1l6i_A* 2asv_A* 2av6_A* 2aw3_A* 2azd_A* 1qm5_A* 1e4o_A* 2ecp_A* 1ahp_A* Length = 796 Back     alignment and structure
>1l5w_A Maltodextrin phosphorylase; enzymatic catalysis, substrate complex, trans; HET: GLC PLP; 1.80A {Escherichia coli} SCOP: c.87.1.4 PDB: 1l5v_A* 1l6i_A* 2asv_A* 2av6_A* 2aw3_A* 2azd_A* 1qm5_A* 1e4o_A* 2ecp_A* 1ahp_A* Length = 796 Back     alignment and structure
>2c4m_A Glycogen phosphorylase; allosteric control, phosphate dependence, starch degrading, transferase, glycosyltransferase; HET: PLP; 1.9A {Corynebacterium callunae} Length = 796 Back     alignment and structure
>2c4m_A Glycogen phosphorylase; allosteric control, phosphate dependence, starch degrading, transferase, glycosyltransferase; HET: PLP; 1.9A {Corynebacterium callunae} Length = 796 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
1ygp_A 879 Yeast glycogen phosphorylase; phosphorylated form, 100.0
1ygp_A879 Yeast glycogen phosphorylase; phosphorylated form, 100.0
2c4m_A 796 Glycogen phosphorylase; allosteric control, phosph 100.0
1l5w_A 796 Maltodextrin phosphorylase; enzymatic catalysis, s 100.0
2gj4_A 824 Glycogen phosphorylase, muscle form; transferase; 100.0
1l5w_A796 Maltodextrin phosphorylase; enzymatic catalysis, s 100.0
2c4m_A796 Glycogen phosphorylase; allosteric control, phosph 100.0
2gj4_A824 Glycogen phosphorylase, muscle form; transferase; 100.0
3vue_A 536 GBSS-I, granule-bound starch synthase 1, chloropla 96.9
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 91.44
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 90.98
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 89.62
3vue_A536 GBSS-I, granule-bound starch synthase 1, chloropla 89.29
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 88.65
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 88.09
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 85.35
>2c4m_A Glycogen phosphorylase; allosteric control, phosphate dependence, starch degrading, transferase, glycosyltransferase; HET: PLP; 1.9A {Corynebacterium callunae} Back     alignment and structure
>1l5w_A Maltodextrin phosphorylase; enzymatic catalysis, substrate complex, trans; HET: GLC PLP; 1.80A {Escherichia coli} SCOP: c.87.1.4 PDB: 1l5v_A* 1l6i_A* 2asv_A* 2av6_A* 2aw3_A* 2azd_A* 1qm5_A* 1e4o_A* 2ecp_A* 1ahp_A* Back     alignment and structure
>2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH; 1.60A {Oryctolagus cuniculus} SCOP: c.87.1.4 PDB: 2gm9_A* 1abb_A* 3nc4_A* 3l79_A* 2pyd_A* 2pyi_A* 3l7a_A* 3l7b_A* 3l7c_A* 3l7d_A* 2qnb_A* 1c8l_A* 1axr_A* 1gpy_A* 1e1y_A* 1lwo_A* 1pyg_A* 1uzu_A* 1lwn_A* 1xkx_A* ... Back     alignment and structure
>1l5w_A Maltodextrin phosphorylase; enzymatic catalysis, substrate complex, trans; HET: GLC PLP; 1.80A {Escherichia coli} SCOP: c.87.1.4 PDB: 1l5v_A* 1l6i_A* 2asv_A* 2av6_A* 2aw3_A* 2azd_A* 1qm5_A* 1e4o_A* 2ecp_A* 1ahp_A* Back     alignment and structure
>2c4m_A Glycogen phosphorylase; allosteric control, phosphate dependence, starch degrading, transferase, glycosyltransferase; HET: PLP; 1.9A {Corynebacterium callunae} Back     alignment and structure
>2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH; 1.60A {Oryctolagus cuniculus} SCOP: c.87.1.4 PDB: 2gm9_A* 1abb_A* 3nc4_A* 3l79_A* 2pyd_A* 2pyi_A* 3l7a_A* 3l7b_A* 3l7c_A* 3l7d_A* 2qnb_A* 1c8l_A* 1axr_A* 1gpy_A* 1e1y_A* 1lwo_A* 1pyg_A* 1uzu_A* 1lwn_A* 1xkx_A* ... Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 286
d2gj4a1824 c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit 1e-55
d2gj4a1 824 c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit 2e-40
d1ygpa_876 c.87.1.4 (A:) Glycogen phosphorylase {Baker's yeas 7e-51
d1ygpa_ 876 c.87.1.4 (A:) Glycogen phosphorylase {Baker's yeas 2e-39
d1l5wa_796 c.87.1.4 (A:) Maltodextrin phosphorylase (MALP) {E 4e-49
d1l5wa_ 796 c.87.1.4 (A:) Maltodextrin phosphorylase (MALP) {E 2e-34
>d2gj4a1 c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 824 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Oligosaccharide phosphorylase
domain: Glycogen phosphorylase
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  189 bits (482), Expect = 1e-55
 Identities = 79/118 (66%), Positives = 100/118 (84%)

Query: 3   AELIIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTLDGANVEMAEEMGNDNIFIFG 62
           AE +IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGT+DGANVEMAEE G +N FIFG
Sbjct: 642 AEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFG 701

Query: 63  MTVDQVEELKKKGYDAPSYYNANPELKLVVDQITNGFFSPENPDEFKDLSDILLKWDR 120
           M V+ V+ L ++GY+A  YY+  PEL+ +++Q+++GFFSP+ PD FKD+ ++L+  DR
Sbjct: 702 MRVEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDR 759
>d2gj4a1 c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 824 Back     information, alignment and structure
>d1l5wa_ c.87.1.4 (A:) Maltodextrin phosphorylase (MALP) {Escherichia coli [TaxId: 562]} Length = 796 Back     information, alignment and structure
>d1l5wa_ c.87.1.4 (A:) Maltodextrin phosphorylase (MALP) {Escherichia coli [TaxId: 562]} Length = 796 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
d2gj4a1 824 Glycogen phosphorylase {Rabbit (Oryctolagus cunicu 100.0
d1l5wa_ 796 Maltodextrin phosphorylase (MALP) {Escherichia col 100.0
d1ygpa_ 876 Glycogen phosphorylase {Baker's yeast (Saccharomyc 100.0
d2gj4a1824 Glycogen phosphorylase {Rabbit (Oryctolagus cunicu 100.0
d1l5wa_796 Maltodextrin phosphorylase (MALP) {Escherichia col 100.0
d1ygpa_876 Glycogen phosphorylase {Baker's yeast (Saccharomyc 100.0
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 96.88
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 94.94
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 91.86
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 83.41
>d2gj4a1 c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Oligosaccharide phosphorylase
domain: Glycogen phosphorylase
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

Probab=100.00  E-value=6.7e-55  Score=447.43  Aligned_cols=192  Identities=42%  Similarity=0.573  Sum_probs=160.6

Q ss_pred             CCCCCcccc-CChhHHHHHHHHhc-CCCCCCChhhHHHHHHHHhcCCCCeeeccCCchHHHHHHHH---HHhcCCcchhH
Q psy17284         75 GYDAPSYYN-ANPELKLVVDQITN-GFFSPENPDEFKDLSDILLKWDRPGAIPLKGPVPTTQLVLR---WASSGRWPVTF  149 (286)
Q Consensus        75 gy~p~~~~~-~np~L~~vlD~i~~-G~f~~~d~~~f~~Lyd~L~~~D~ylvlaY~d~~~W~k~~i~---IA~~g~FSSDi  149 (286)
                      |+++|+|.. +||+|.++++...+ +|.  .|++.++.|    ..        +.+.+.|.+....   ..+.     .+
T Consensus       474 GV~~rrWl~~~np~L~~l~~~~ig~~w~--~d~~~l~~l----~~--------~~~d~~~~~~~~~~k~~~K~-----~L  534 (824)
T d2gj4a1         474 GITPRRWLVLCNPGLAEIIAERIGEEYI--SDLDQLRKL----LS--------YVDDEAFIRDVAKVKQENKL-----KF  534 (824)
T ss_dssp             CBCTCCCCCCTCHHHHHHHHHHHCSGGG--GCGGGGGGG----GG--------GTTCHHHHHHHHHHHHHHHH-----HH
T ss_pred             cccCccchhccCHHHHHHHHhhhccccc--cCHHHHHHH----HH--------hCCCHHHHHHHHHHHHHhHH-----HH
Confidence            899999987 89999999987664 444  344443322    21        3333322222211   1111     17


Q ss_pred             HHHHhhccCCCCCCCCcccccccCCCCccccchhhHHhhHHHHHHhh--cCCccceEEEEeecCCCCCHHHHHHHHHHHH
Q psy17284        150 MEHFRGSSHRDISTSTSSSGQVESSFPETGQKFAALITIFLIEERTA--KGKWHTRTIMIGGKAAPGYYTAKKIIKLICS  227 (286)
Q Consensus       150 ~eY~~~~tG~~~~~~~~~~~~~rR~~~YKR~~l~~l~~i~~~~~~~~--~~~~~p~~~i~~GKa~P~d~~~k~~i~~i~~  227 (286)
                      .+|+++.+|+.++|++|||+|||||||||||+||+++++.++.+...  +.+.+|+||||||||||+|..||+|||+|++
T Consensus       535 ~~~i~~~~g~~ldp~~lfd~~arRfheYKRq~Ln~~~i~~ly~rlk~~~~~~~~P~q~IFaGKAhP~d~~gK~iIk~I~~  614 (824)
T d2gj4a1         535 AAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITA  614 (824)
T ss_dssp             HHHHHHHHCCCCCTTSEEEEEESCCCGGGTHHHHHHHHHHHHHHHHHCTTSCCCCEEEEEECCCCTTCHHHHHHHHHHHH
T ss_pred             HHHHHHHhCCCCCcchhhhhheeechhhhhhhhhHhhHHHHHHHhhhcccCCCCCeEEEEeCCCCCccHHHHHHHHHHHH
Confidence            79999999999999999999999999999999999999998866544  4668899999999999999999999999999


Q ss_pred             HHHHHcCCcCCCCceeEEEEcCCChhhhhhhcccccccccCCCCCCCccCcccccccC
Q psy17284        228 VARVVNNDPDVGDKLKVVFLENYRVTLAELIIPAADLSEQISTAGTEASGTGNMKFMI  285 (286)
Q Consensus       228 ~~~~~~~d~~~~~~~~vvfl~nY~~~~a~~l~~~~Dv~~~~p~~~~EAsGTs~MK~~~  285 (286)
                      +|+++|+||++++++||||||||||++|++|+||||||+|||++|+||||||||||||
T Consensus       615 va~~in~dp~~~~~lkVvFlenY~v~lA~~li~g~Dvwln~p~~~~EASGTSgMK~al  672 (824)
T d2gj4a1         615 IGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFML  672 (824)
T ss_dssp             HHHHHTTCTTTGGGEEEEEETTCCHHHHHHHGGGCSEEEECCCTTSCSCCSHHHHHHH
T ss_pred             HHHHHhcChhhccceeEEEcCCCchHHHHHhhhhhhhhhcCCCCCcccCCcchhHHHH
Confidence            9999999999999999999999999999999999999999999999999999999987
>d1l5wa_ c.87.1.4 (A:) Maltodextrin phosphorylase (MALP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj4a1 c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1l5wa_ c.87.1.4 (A:) Maltodextrin phosphorylase (MALP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure