Psyllid ID: psy17302

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
MKPSVLYLTPCVLTMLWVLLLLPLGHSFMLDGSQDSYAQLHKWNAALNGSLELEFKTEQPNGLILYTDDGGTYDFFEIKLVEGALRLRYNLGSGAQILTVGHDLNDGHWHSVRVKRRVEKTSLTVDNITQTRTSRGKEFRFGHVTSNSWVYIGGMPPWYNAKLTLLALPSVIFAGERVPVWSRHFQLVGGMPPWYNAKLTLLALPSVIFEPRFVGFIRNVIYADPHASGPRRQLAHSPPTPSLK
cccccEEEEccccccEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEEEEEcccccEEEEEEcccccccEEEEEEEccEEEEEEEcccccEEEEEcccccccccEEEEEEEEccEEEEEEcccEEEEEcccccccEEcccccccEEEccccccccccccccccccEEEEEEEEEEEEEEEEEccccccccccccEEEcccccccccccccccccEEEcccccccccccccccccccccc
ccccEEEEEccEEEEEEEccccccccEEEEcccccEEEEccccccccccEEEEEEEEccccEEEEEEcccccccEEEEEEEccEEEEEEEcccccEEEEEccEcccccEEEEEEEEcccEEEEEEcccccEEEEccccccccEEcccccEEEcccccccccccccccccccEEEEccEEEEccEccccccccccEEccccccccccccccccccccEccEEEcccccccccccccccccccccc
mkpsvlyltpCVLTMLWVLLLLPlghsfmldgsqdSYAQLHKWNAALNgslelefkteqpnglilytddggtydfFEIKLVEGALRLRYnlgsgaqiltvghdlndghwhsVRVKRrvektsltvdnitqtrtsrgkefrfghvtsnswvyiggmppwynaKLTLLAlpsvifagervpvwsrhfqlvggmppwynaKLTLlalpsvifeprfvGFIRNviyadphasgprrqlahspptpslk
MKPSVLYLTPCVLTMLWVLLLLPLGHSFMLDGSQDSYAQLHKWNAALNGSLELEFKTEQPNGLILYTDDGGTYDFFEIKLVEGALRLRYNLGSGAQILTVGHDLNDGHWHSvrvkrrvektsltvdnitqtrtsrgkefrfghVTSNSWVYIGGMPPWYNAKLTLLALPSVIFAGERVPVWSRHFQLVGGMPPWYNAKLTLLALPSVIFEPRFVGFIRNVIYAdphasgprrqlahspptpslk
MKPSVLYLTPCVltmlwvllllplGHSFMLDGSQDSYAQLHKWNAALNGSLELEFKTEQPNGLILYTDDGGTYDFFEIKLVEGALRLRYNLGSGAQILTVGHDLNDGHWHSVRVKRRVEKTSLTVDNITQTRTSRGKEFRFGHVTSNSWVYIGGMPPWYNAKLTLLALPSVIFAGERVPVWSRHFQLVGGMPPWYNAKLTLLALPSVIFEPRFVGFIRNVIYADPHASGPRRQLAHSPPTPSLK
****VLYLTPCVLTMLWVLLLLPLGHSFMLDGSQDSYAQLHKWNAALNGSLELEFKTEQPNGLILYTDDGGTYDFFEIKLVEGALRLRYNLGSGAQILTVGHDLNDGHWHSVRVKRRVEKTSLTVDNITQTRTSRGKEFRFGHVTSNSWVYIGGMPPWYNAKLTLLALPSVIFAGERVPVWSRHFQLVGGMPPWYNAKLTLLALPSVIFEPRFVGFIRNVIYAD********************
*KPSVLYLTPCVLTMLWVLLLLPLGHSFMLDGSQDSYAQLHKWNAALNGSLELEFKTEQPNGLILYTDDGGTYDFFEIKLVEGALRLRYNLGSGAQILTVGHDLNDGHWHSVRVKRRVEKTSLTVD******************TSNSWVYIGGMPPWYNAKLTLLALPSVIFAGERVPVWSRHFQLVGGMPPWYNAKLTLLALPSVIFEPRFVGFIRNVIYADPH******************
MKPSVLYLTPCVLTMLWVLLLLPLGHSFMLDGSQDSYAQLHKWNAALNGSLELEFKTEQPNGLILYTDDGGTYDFFEIKLVEGALRLRYNLGSGAQILTVGHDLNDGHWHSVRVKRRVEKTSLTVDNITQTRTSRGKEFRFGHVTSNSWVYIGGMPPWYNAKLTLLALPSVIFAGERVPVWSRHFQLVGGMPPWYNAKLTLLALPSVIFEPRFVGFIRNVIYADPHA*****************
*KPSVLYLTPCVLTMLWVLLLLPLGHSFMLDGSQDSYAQLHKWNAALNGSLELEFKTEQPNGLILYTDDGGTYDFFEIKLVEGALRLRYNLGSGAQILTVGHDLNDGHWHSVRVKRRVEKTSLTVDNITQTRTSRGKEFRFGHVTSNSWVYIGGMPPWYNAKLTLLALPSVIFAGERVPVWSRHFQLVGGMPPWYNAKLTLLALPSVIFEPRFVGFIRNVIYADPHA*****************
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPSVLYLTPCVLTMLWVLLLLPLGHSFMLDGSQDSYAQLHKWNAALNGSLELEFKTEQPNGLILYTDDGGTYDFFEIKLVEGALRLRYNLGSGAQILTVGHDLNDGHWHSVRVKRRVEKTSLTVDNITQTRTSRGKEFRFGHVTSNSWVYIGGMPPWYNAKLTLLALPSVIFAGERVPVWSRHFQLVGGMPPWYNAKLTLLALPSVIFEPRFVGFIRNVIYADPHASGPRRQLAHSPPTPSLK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query244 2.2.26 [Sep-21-2011]
Q9ULB1 1477 Neurexin-1 OS=Homo sapien yes N/A 0.647 0.106 0.325 1e-14
Q28146 1530 Neurexin-1 OS=Bos taurus yes N/A 0.647 0.103 0.319 4e-14
Q9CS84 1514 Neurexin-1 OS=Mus musculu yes N/A 0.651 0.105 0.315 5e-14
Q63372 1530 Neurexin-1 OS=Rattus norv yes N/A 0.651 0.103 0.315 6e-14
A1XQX8 1697 Neurexin-3a OS=Danio reri no N/A 0.635 0.091 0.306 7e-14
A1XQX0 1491 Neurexin-1a OS=Danio reri no N/A 0.553 0.090 0.312 7e-14
Q07310 1578 Neurexin-3 OS=Rattus norv no N/A 0.598 0.092 0.311 8e-14
Q6P9K9 1571 Neurexin-3 OS=Mus musculu no N/A 0.598 0.092 0.311 1e-13
Q9P2S2 1712 Neurexin-2 OS=Homo sapien no N/A 0.557 0.079 0.358 2e-13
Q63374 1715 Neurexin-2 OS=Rattus norv no N/A 0.557 0.079 0.358 2e-13
>sp|Q9ULB1|NRX1A_HUMAN Neurexin-1 OS=Homo sapiens GN=NRXN1 PE=2 SV=1 Back     alignment and function desciption
 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 84/169 (49%), Gaps = 11/169 (6%)

Query: 24  LGHSFMLDGSQDSYAQLHKWNAALNGSLELEFKTEQPNGLILYTDDGGTYDFFEIKLVEG 83
           LG      G++  + +  KWNA     +  + KT    GL+LY DD G  DF E+ L  G
Sbjct: 27  LGSGLEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRG 86

Query: 84  A-LRLRYNLGSGAQILTVGHD--LNDGHWHSVRVKRRVEKTSLTVDNITQTRTSRGKEFR 140
             L+L +++   A+  T+  D  +NDG WHSVR++R+   T+L +D +         + R
Sbjct: 87  GRLQLSFSIFC-AEPATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKWVEVKSKRR 145

Query: 141 FGHVTSNSWVYIGGMPPWYNAKLTLLALPSVIFAGERVPV--WSRHFQL 187
              +T  S +++GG+PP   A    L L SV    ER P   W R  ++
Sbjct: 146 --DMTVFSGLFVGGLPPELRAAALKLTLASVR---EREPFKGWIRDVRV 189
Cell surface protein involved in cell-cell-interactions, excytosis of secretory granules and regulation of signal transmission. Function is isoform-specific. Alpha-type isoforms have a long N-terminus with six laminin G-like domains and play an important role in synaptic signal transmission. Alpha-type isoforms play a role in the regulation of calcium channel activity and Ca(2+)-triggered neurotransmitter release at synapses and at neuromuscular junctions. They play an important role in Ca(2+)-triggered exocytosis of secretory granules in pituitary gland. They may effect their functions at synapses and in endocrine cells via their interactions with proteins from the exocytotic machinery. Likewise, alpha-type isoforms play a role in regulating the activity of postsynaptic NMDA receptors, a subtype of glutamate-gated ion channels. Both alpha-type and beta-type isoforms may play a role in the formation or maintenance of synaptic junctions via their calcium-dependent interactions (via the extracellular domains) with neuroligin family members, CBLN1 or CBLN2. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Alpha-type isoforms were first identified as receptors for alpha-latroxin from spider venom.
Homo sapiens (taxid: 9606)
>sp|Q28146|NRX1A_BOVIN Neurexin-1 OS=Bos taurus GN=NRXN1 PE=1 SV=1 Back     alignment and function description
>sp|Q9CS84|NRX1A_MOUSE Neurexin-1 OS=Mus musculus GN=Nrxn1 PE=1 SV=3 Back     alignment and function description
>sp|Q63372|NRX1A_RAT Neurexin-1 OS=Rattus norvegicus GN=Nrxn1 PE=1 SV=3 Back     alignment and function description
>sp|A1XQX8|NR3AA_DANRE Neurexin-3a OS=Danio rerio GN=nrxn3a PE=2 SV=1 Back     alignment and function description
>sp|A1XQX0|NR1AA_DANRE Neurexin-1a OS=Danio rerio GN=nrxn1a PE=2 SV=1 Back     alignment and function description
>sp|Q07310|NRX3A_RAT Neurexin-3 OS=Rattus norvegicus GN=Nrxn3 PE=1 SV=1 Back     alignment and function description
>sp|Q6P9K9|NRX3A_MOUSE Neurexin-3 OS=Mus musculus GN=Nrxn3 PE=1 SV=2 Back     alignment and function description
>sp|Q9P2S2|NRX2A_HUMAN Neurexin-2 OS=Homo sapiens GN=NRXN2 PE=2 SV=1 Back     alignment and function description
>sp|Q63374|NRX2A_RAT Neurexin-2 OS=Rattus norvegicus GN=Nrxn2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query244
340727455 1469 PREDICTED: neurexin-2-alpha-like [Bombus 0.807 0.134 0.557 7e-65
350408588 680 PREDICTED: neurexin-3b-alpha-like, parti 0.823 0.295 0.552 1e-64
383849198 639 PREDICTED: uncharacterized protein LOC10 0.737 0.281 0.583 2e-64
380011533 1621 PREDICTED: LOW QUALITY PROTEIN: neurexin 0.75 0.112 0.575 3e-64
307167985 361 Neurexin-2-alpha [Camponotus floridanus] 0.713 0.481 0.590 4e-64
270010294 718 hypothetical protein TcasGA2_TC009676 [T 0.762 0.259 0.56 5e-64
307191571238 Neurexin-2-alpha [Harpegnathos saltator] 0.754 0.773 0.572 1e-63
332020210 1596 Neurexin-3-alpha [Acromyrmex echinatior] 0.713 0.109 0.585 2e-63
222354846 1622 neurexin I isoform A [Apis mellifera] 0.717 0.107 0.592 3e-63
347971168 2023 AGAP004066-PA [Anopheles gambiae str. PE 0.717 0.086 0.578 4e-63
>gi|340727455|ref|XP_003402059.1| PREDICTED: neurexin-2-alpha-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  253 bits (645), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 130/233 (55%), Positives = 150/233 (64%), Gaps = 36/233 (15%)

Query: 1   MKPSVLYLTPCVLTMLWVLLLLPLGHSFMLDGSQDSYAQLHKWNAALNGSLELEFKTEQP 60
           M  S++      L    V+LL  +  SF+L+GS  SYAQ  KWNA LNG+LE EFKTEQ 
Sbjct: 1   MHSSLVTSNTGALMPFLVVLLGQVATSFVLEGSATSYAQFRKWNAGLNGTLEFEFKTEQG 60

Query: 61  NGLILYTDDGGTYDFFEIKLVEGALRLRYNLGSGAQILTVGHDLNDGHWHSVRVKRRVEK 120
           NGL+LYTDDGGTYDFFE+KLVE ALRLRYNLG GAQI+TVGHDL DGHWH V++ R  E 
Sbjct: 61  NGLLLYTDDGGTYDFFEVKLVESALRLRYNLGGGAQIVTVGHDLGDGHWHKVQITRCNEN 120

Query: 121 TSLTVDNITQTRTSRGKEFRFGHVTSNSWVYIGGMPPWYNAKLTLLALPSVIFAGERVPV 180
           T+LTVD ++   TSRGKEF FG +  NS VY+GGMP WYN+KLTLLALPS          
Sbjct: 121 TTLTVDGVSAVSTSRGKEFEFGKLAGNSDVYVGGMPSWYNSKLTLLALPS---------- 170

Query: 181 WSRHFQLVGGMPPWYNAKLTLLALPSVIFEPRFVGFIRNVIYADPHASGPRRQ 233
                                     VIFEPRF GFIRN++YAD     PRRQ
Sbjct: 171 --------------------------VIFEPRFNGFIRNLVYADGENMVPRRQ 197

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350408588|ref|XP_003488453.1| PREDICTED: neurexin-3b-alpha-like, partial [Bombus impatiens] Back     alignment and taxonomy information
>gi|383849198|ref|XP_003700232.1| PREDICTED: uncharacterized protein LOC100882322 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380011533|ref|XP_003689856.1| PREDICTED: LOW QUALITY PROTEIN: neurexin-3-alpha-like [Apis florea] Back     alignment and taxonomy information
>gi|307167985|gb|EFN61329.1| Neurexin-2-alpha [Camponotus floridanus] Back     alignment and taxonomy information
>gi|270010294|gb|EFA06742.1| hypothetical protein TcasGA2_TC009676 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307191571|gb|EFN75069.1| Neurexin-2-alpha [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332020210|gb|EGI60654.1| Neurexin-3-alpha [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|222354846|gb|ACM48184.1| neurexin I isoform A [Apis mellifera] Back     alignment and taxonomy information
>gi|347971168|ref|XP_309618.5| AGAP004066-PA [Anopheles gambiae str. PEST] gi|333466618|gb|EAA05336.6| AGAP004066-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query244
FB|FBgn0038975 1840 Nrx-1 "Neurexin 1" [Drosophila 0.598 0.079 0.712 4.7e-55
WB|WBGene00007799 1725 nrx-1 [Caenorhabditis elegans 0.536 0.075 0.345 6.4e-18
UNIPROTKB|E1C8Q7 1540 E1C8Q7 "Uncharacterized protei 0.635 0.100 0.279 7.6e-17
UNIPROTKB|D0PRN3 1693 D0PRN3 "Neurexin-3" [Gallus ga 0.635 0.091 0.279 9.4e-17
UNIPROTKB|Q28146 1530 NRXN1 "Neurexin-1" [Bos taurus 0.627 0.1 0.329 1.2e-15
UNIPROTKB|F8WB18 1477 NRXN1 "Neurexin-1-beta" [Homo 0.627 0.103 0.335 1.5e-15
UNIPROTKB|Q9ULB1 1477 NRXN1 "Neurexin-1" [Homo sapie 0.627 0.103 0.335 1.5e-15
UNIPROTKB|F5GYC7 1499 NRXN1 "Neurexin-1-beta" [Homo 0.627 0.102 0.335 1.5e-15
UNIPROTKB|E7ERL8 1507 NRXN1 "Neurexin-1-beta" [Homo 0.627 0.101 0.335 1.5e-15
MGI|MGI:1096391 1514 Nrxn1 "neurexin I" [Mus muscul 0.627 0.101 0.335 3.2e-15
FB|FBgn0038975 Nrx-1 "Neurexin 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 568 (205.0 bits), Expect = 4.7e-55, Sum P(2) = 4.7e-55
 Identities = 104/146 (71%), Positives = 123/146 (84%)

Query:    28 FMLDGSQDSYAQLHKWNAALNGSLELEFKTEQPNGLILYTDDGGTYDFFEIKLVEGALRL 87
             F LDGSQ+S+    KW   LNG+LELEFKTEQPNGL+LYTDDGGTYDFFE+KLVEGALRL
Sbjct:   105 FQLDGSQNSFYTFRKWYTGLNGTLELEFKTEQPNGLVLYTDDGGTYDFFELKLVEGALRL 164

Query:    88 RYNLGSGAQILTVGHDLNDGHWHSVRVKRRVEKTSLTVDNITQTRTSRGKEFRFGHVTSN 147
             RYNLG GAQI+TVG +L+DGHWH V+V R  E+TSL VD ++Q R+++GKEF+FG   SN
Sbjct:   165 RYNLGGGAQIITVGRELHDGHWHKVQVLRNDEQTSLIVDGVSQQRSTKGKEFQFGKFASN 224

Query:   148 SWVYIGGMPPWYNAKLTLLALPSVIF 173
             S VY+GGMP WY++KL LLALPSVIF
Sbjct:   225 SDVYVGGMPNWYSSKLALLALPSVIF 250
GO:0005886 "plasma membrane" evidence=IDA;NAS
GO:0007268 "synaptic transmission" evidence=IDA
GO:0050808 "synapse organization" evidence=IDA
GO:0008306 "associative learning" evidence=IDA
GO:0007416 "synapse assembly" evidence=IDA
GO:0031594 "neuromuscular junction" evidence=IDA
WB|WBGene00007799 nrx-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8Q7 E1C8Q7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|D0PRN3 D0PRN3 "Neurexin-3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q28146 NRXN1 "Neurexin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F8WB18 NRXN1 "Neurexin-1-beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ULB1 NRXN1 "Neurexin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5GYC7 NRXN1 "Neurexin-1-beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7ERL8 NRXN1 "Neurexin-1-beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1096391 Nrxn1 "neurexin I" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query244
smart00282132 smart00282, LamG, Laminin G domain 4e-28
cd00110151 cd00110, LamG, Laminin G domain; Laminin G-like do 9e-28
pfam02210124 pfam02210, Laminin_G_2, Laminin G domain 6e-27
pfam00054131 pfam00054, Laminin_G_1, Laminin G domain 6e-16
>gnl|CDD|214598 smart00282, LamG, Laminin G domain Back     alignment and domain information 
 Score =  103 bits (259), Expect = 4e-28
 Identities = 39/109 (35%), Positives = 56/109 (51%), Gaps = 3/109 (2%)

Query: 50  SLELEFKTEQPNGLILYTDDGGTYDFFEIKLVEGALRLRYNLGSGAQILTVGHD-LNDGH 108
           S+   F+T  PNGL+LY    G  D+  ++L +G L LRY+LGSG   LT     LNDG 
Sbjct: 1   SISFSFRTTSPNGLLLYAGSKGGGDYLALELRDGRLVLRYDLGSGPARLTSDPTPLNDGQ 60

Query: 109 WHSVRVKRRVEKTSLTVDNITQTRTSRGKEFRFGHVTSNSWVYIGGMPP 157
           WH V V+R     +L+VD   +            ++     +Y+GG+P 
Sbjct: 61  WHRVAVERNGRSVTLSVDGGNRVSGESPGGLTILNLDGP--LYLGGLPE 107

Length = 132
>gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain Back     alignment and domain information
>gnl|CDD|215681 pfam00054, Laminin_G_1, Laminin G domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 244
PF00054131 Laminin_G_1: Laminin G domain; InterPro: IPR012679 99.94
KOG3514|consensus 1591 99.94
cd00110151 LamG Laminin G domain; Laminin G-like domains are 99.93
smart00282135 LamG Laminin G domain. 99.92
KOG1219|consensus 4289 99.9
KOG3516|consensus 1306 99.88
KOG3514|consensus 1591 99.87
PF02210128 Laminin_G_2: Laminin G domain; InterPro: IPR012680 99.87
KOG4289|consensus 2531 99.85
KOG3516|consensus 1306 99.79
KOG4289|consensus 2531 99.65
smart00210184 TSPN Thrombospondin N-terminal -like domains. Hepa 99.09
PF13385157 Laminin_G_3: Concanavalin A-like lectin/glucanases 98.64
cd00152201 PTX Pentraxins are plasma proteins characterized b 98.34
smart00159206 PTX Pentraxin / C-reactive protein / pentaxin fami 98.33
PF00354195 Pentaxin: Pentaxin family; InterPro: IPR001759 Pen 98.03
PF02973190 Sialidase: Sialidase, N-terminal domain; InterPro: 97.85
smart00560133 LamGL LamG-like jellyroll fold domain. 97.01
KOG3509|consensus 964 95.75
KOG1834|consensus 952 95.31
PF06439185 DUF1080: Domain of Unknown Function (DUF1080); Int 95.02
PF14099224 Polysacc_lyase: Polysaccharide lyase; PDB: 3ILR_A 91.31
PF0000832 EGF: EGF-like domain This is a sub-family of the P 89.38
smart00282135 LamG Laminin G domain. 81.1
PF02057669 Glyco_hydro_59: Glycosyl hydrolase family 59; Inte 80.2
>PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information 
Probab=99.94  E-value=3.2e-25  Score=169.72  Aligned_cols=123  Identities=32%  Similarity=0.553  Sum_probs=102.4

Q ss_pred             EEeCCCCeEEEEEcCCCCccEEEEEEeCCcEEEEEEcCCCeEEEEEcCccCCCCeEEEEEEEECcEEEEEEcCceee-ee
Q psy17302         55 FKTEQPNGLILYTDDGGTYDFFEIKLVEGALRLRYNLGSGAQILTVGHDLNDGHWHSVRVKRRVEKTSLTVDNITQT-RT  133 (244)
Q Consensus        55 frT~~~~GlLl~~~~~~~~~~l~l~L~~G~l~~~~~~g~~~~~~~s~~~vndg~WH~V~v~~~~~~~~L~VD~~~~~-~~  133 (244)
                      |||.+++|+|||.++..+.||++|+|.+|+++++|+.|++...+.++..++||+||+|++.|..+.+.|+||+.... ..
T Consensus         1 frT~~~~Gllly~g~~~~~dfial~L~~G~l~~~~~~G~~~~~~~~~~~i~dg~wh~v~~~r~~~~~~L~Vd~~~~~~~~   80 (131)
T PF00054_consen    1 FRTSEPNGLLLYLGSKDGKDFIALELRDGRLEFRYNLGSGPASLRSPQKINDGKWHTVSVSRNGRNGSLSVDGEEVVTGE   80 (131)
T ss_dssp             EEESSSSEEEEEEESSTTSSEEEEEEETTEEEEEEESSSEEEEEEESSETTSSSEEEEEEEEETTEEEEEETTSEEEEEE
T ss_pred             CccCCCCceEEECCcCCCCCEEEEEEECCEEEEEEeCCCccceecCCCccCCCcceEEEEEEcCcEEEEEECCccceeee
Confidence            89999999999998777779999999999999999999998888888889999999999999999999999998873 34


Q ss_pred             cCCCceeeeecccCCceEEeccCCCCCCC-------CCccccceeEECCEEec
Q psy17302        134 SRGKEFRFGHVTSNSWVYIGGMPPWYNAK-------LTLLALPSVIFAGERVP  179 (244)
Q Consensus       134 ~~~~~~~~~~l~~~~~lyiGG~p~~~~~~-------~~~GCl~~v~ing~~l~  179 (244)
                      .+... . ..++....|||||+|......       .+.|||+++.+|++++|
T Consensus        81 s~~~~-~-~~l~~~~~lyvGG~p~~~~~~~~~~~~~~f~GCi~~~~in~~~ld  131 (131)
T PF00054_consen   81 SPSGA-T-QSLDVDGPLYVGGLPSSSSRPRPLPISPGFKGCIRNLSINGKPLD  131 (131)
T ss_dssp             ECSSS-S-SSCEECSEEEESSSSTTTGCGSSCSCCSB-EEEEEEEEETTEEC-
T ss_pred             cCCcc-c-cccccccCEEEccCCchhhcccccccCCCeeEEEEEeEECCEECc
Confidence            43321 1 136778889999999322211       23999999999999875

The laminin globular (G) domain can be found in one to several copies in various laminin family members, which includes a large number of extracellular proteins. The C terminus of laminin alpha chain contains a tandem repeat of five laminin G domains, which are critical for heparin-binding and cell attachment activity []. Laminin alpha4 is distributed in a variety of tissues including peripheral nerves, dorsal root ganglion, skeletal muscle and capillaries; in the neuromuscular junction, it is required for synaptic specialisation []. The structure of the laminin-G domain has been predicted to resemble that of pentraxin []. Laminin G domains can vary in their function, and a variety of binding functions has been ascribed to different LamG modules. For example, the laminin alpha1 and alpha2 chains each has five C-teminal laminin G domains, where only domains LG4 and LG5 contain binding sites for heparin, sulphatides and the cell surface receptor dystroglycan []. Laminin G-containing proteins appear to have a wide variety of roles in cell adhesion, signalling, migration, assembly and differentiation. This entry represents one subtype of laminin G domains, which is sometimes found in association with thrombospondin-type laminin G domains (IPR012680 from INTERPRO).; PDB: 1OKQ_A 1DYK_A 2C5D_A 1H30_A 1LHW_A 1KDK_A 1LHU_A 1KDM_A 1LHO_A 1D2S_A ....
>KOG3514|consensus Back     alignment and domain information
>cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>smart00282 LamG Laminin G domain Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>KOG3514|consensus Back     alignment and domain information
>PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>smart00210 TSPN Thrombospondin N-terminal -like domains Back     alignment and domain information
>PF13385 Laminin_G_3: Concanavalin A-like lectin/glucanases superfamily; PDB: 4DQA_A 1N1Y_A 1MZ6_A 1MZ5_A 1N1S_A 2A75_A 1WCS_A 1N1T_A 1N1V_A 2FHR_A Back     alignment and domain information
>cd00152 PTX Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity Back     alignment and domain information
>smart00159 PTX Pentraxin / C-reactive protein / pentaxin family Back     alignment and domain information
>PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits Back     alignment and domain information
>PF02973 Sialidase: Sialidase, N-terminal domain; InterPro: IPR004124 O-Glycosyl hydrolases 3 Back     alignment and domain information
>smart00560 LamGL LamG-like jellyroll fold domain Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PF06439 DUF1080: Domain of Unknown Function (DUF1080); InterPro: IPR010496 This is a family of proteins of unknown function Back     alignment and domain information
>PF14099 Polysacc_lyase: Polysaccharide lyase; PDB: 3ILR_A 3IKW_A 3INA_A 3IMN_A 3IN9_A 2ZZJ_A Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00282 LamG Laminin G domain Back     alignment and domain information
>PF02057 Glyco_hydro_59: Glycosyl hydrolase family 59; InterPro: IPR001286 O-Glycosyl hydrolases 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query244
3r05_A 1254 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 4e-15
3qcw_A 1245 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 4e-15
3poy_A 1019 Crystal Structure Of The Alpha-Neurexin-1 Ectodomai 3e-11
2h0b_A184 Crystal Structure Of The Second LnsLG DOMAIN FROM N 1e-10
3asi_A 410 Alpha-Neurexin-1 Ectodomain Fragment; Lns5-Egf3-Lns 2e-10
2r16_A182 Crystal Structure Of Bovine Neurexin 1 Alpha LnsLG 1e-09
1dyk_A 394 Laminin Alpha 2 Chain Lg4-5 Domain Pair Length = 39 4e-09
3sh4_A195 Laminin G Like Domain 3 From Human Perlecan Length 4e-09
1okq_A 394 Laminin Alpha 2 Chain Lg4-5 Domain Pair, Ca1 Site M 2e-08
2wjs_A 608 Crystal Structure Of The Lg1-3 Region Of The Lamini 3e-07
2jd4_A 383 Mouse Laminin Alpha1 Chain, Domains Lg4-5 Length = 7e-07
1pz7_A204 Modulation Of Agrin Function By Alternative Splicin 2e-05
1pz8_A201 Modulation Of Agrin Function By Alternative Splicin 3e-05
1q56_A195 Nmr Structure Of The B0 Isoform Of The Agrin G3 Dom 3e-05
3v64_A191 Crystal Structure Of Agrin And Lrp4 Length = 191 6e-05
3pve_A189 Crystal Structure Of The G2 Domain Of Agrin From Mu 2e-04
1f5f_A205 Crystal Structure Of The N-Terminal G-Domain Of Shb 3e-04
1lhn_A189 Crystal Structure Of The N-Terminal Lg-Domain Of Sh 4e-04
1d2s_A170 Crystal Structure Of The N-Terminal Laminin G-Like 4e-04
1kdk_A177 The Structure Of The N-Terminal Lg Domain Of Shbg I 4e-04
>pdb|3R05|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), With Splice Insert Ss3 Length = 1254 Back     alignment and structure 
Iteration: 1

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 81/161 (50%), Gaps = 11/161 (6%)
Query: 32  GSQDSYAQLHKWNAALNGSLELEFKTEQPNGLILYTDDGGTYDFFEIKLVEGA-LRLRYN 90
           G++  + +  KWNA     +  + KT    GL+LY DD G  DF E+ L  G  L+L ++
Sbjct: 5   GAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFS 64
Query: 91  LGSG--AQILTVGHDLNDGHWHSVRVKRRVEKTSLTVDNITQTRTSRGKEFRFGHVTSNS 148
           +     A +LT    +NDG WH+VR++R+   T+L +D +         + R   +T  S
Sbjct: 65  IFCAEPATLLT-DTPVNDGAWHNVRIRRQFRNTTLFIDQVEAKWVEVKSKRR--DMTVFS 121
Query: 149 WVYIGGMPPWYNAKLTLLALPSVIFAGERVPV--WSRHFQL 187
            +++GG+PP   A    L L SV    ER P   W R  ++
Sbjct: 122 GLFVGGLPPELRAAALKLTLASV---REREPFKGWIRDVRV 159
>pdb|3QCW|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), No Splice Inserts Length = 1245 Back     alignment and structure
>pdb|3POY|A Chain A, Crystal Structure Of The Alpha-Neurexin-1 Ectodomain, Lns 2-6 Length = 1019 Back     alignment and structure
>pdb|2H0B|A Chain A, Crystal Structure Of The Second LnsLG DOMAIN FROM NEUREXIN 1 ALPHA Length = 184 Back     alignment and structure
>pdb|3ASI|A Chain A, Alpha-Neurexin-1 Ectodomain Fragment; Lns5-Egf3-Lns6 Length = 410 Back     alignment and structure
>pdb|2R16|A Chain A, Crystal Structure Of Bovine Neurexin 1 Alpha LnsLG DOMAIN 4 (With No Splice Insert) Length = 182 Back     alignment and structure
>pdb|1DYK|A Chain A, Laminin Alpha 2 Chain Lg4-5 Domain Pair Length = 394 Back     alignment and structure
>pdb|3SH4|A Chain A, Laminin G Like Domain 3 From Human Perlecan Length = 195 Back     alignment and structure
>pdb|1OKQ|A Chain A, Laminin Alpha 2 Chain Lg4-5 Domain Pair, Ca1 Site Mutant Length = 394 Back     alignment and structure
>pdb|2WJS|A Chain A, Crystal Structure Of The Lg1-3 Region Of The Laminin Alpha2 Chain Length = 608 Back     alignment and structure
>pdb|2JD4|A Chain A, Mouse Laminin Alpha1 Chain, Domains Lg4-5 Length = 383 Back     alignment and structure
>pdb|1PZ7|A Chain A, Modulation Of Agrin Function By Alternative Splicing And Ca2+ Binding Length = 204 Back     alignment and structure
>pdb|1PZ8|A Chain A, Modulation Of Agrin Function By Alternative Splicing And Ca2+ Binding Length = 201 Back     alignment and structure
>pdb|1Q56|A Chain A, Nmr Structure Of The B0 Isoform Of The Agrin G3 Domain In Its Ca2+ Bound State Length = 195 Back     alignment and structure
>pdb|3V64|A Chain A, Crystal Structure Of Agrin And Lrp4 Length = 191 Back     alignment and structure
>pdb|3PVE|A Chain A, Crystal Structure Of The G2 Domain Of Agrin From Mus Musculus Length = 189 Back     alignment and structure
>pdb|1F5F|A Chain A, Crystal Structure Of The N-Terminal G-Domain Of Shbg In Complex With Zinc Length = 205 Back     alignment and structure
>pdb|1LHN|A Chain A, Crystal Structure Of The N-Terminal Lg-Domain Of Shbg In Complex With 5alpha-Androstane-3beta,17alpha-Diol Length = 189 Back     alignment and structure
>pdb|1D2S|A Chain A, Crystal Structure Of The N-Terminal Laminin G-Like Domain Of Shbg In Complex With Dihydrotestosterone Length = 170 Back     alignment and structure
>pdb|1KDK|A Chain A, The Structure Of The N-Terminal Lg Domain Of Shbg In Crystals Soaked With Edta Length = 177 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query244
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-36
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 5e-27
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 3e-25
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-24
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-22
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-22
1dyk_A 394 Laminin alpha 2 chain; metal binding protein; 2.0A 8e-34
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 3e-24
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 1e-33
2jd4_A 383 Laminin subunit alpha-1; basement membrane protein 1e-33
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 1e-24
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 3e-33
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 4e-33
3v64_A191 Low-density lipoprotein receptor-related protein; 6e-33
1h30_A 422 GAS6, growth-arrest-specific protein; laminin G-do 9e-32
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 4e-15
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 1e-31
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 3e-31
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 4e-30
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 1e-29
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 3e-23
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 2e-29
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 4e-29
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 3e-28
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 8e-24
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 3e-28
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 2e-26
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 7e-25
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
 Score =  134 bits (337), Expect = 4e-36
 Identities = 48/155 (30%), Positives = 74/155 (47%), Gaps = 10/155 (6%)

Query: 27  SFMLDGSQDSYAQLHKWNAALNGSLELEFKTEQPNGLILYTDDGGTYDFFEIKLVEGA-L 85
            F   G++  + +  KWNA     +  + KT    GL+LY DD G  DF E+ L  G  L
Sbjct: 2   EF--PGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRL 59

Query: 86  RLRYNLGSG-AQILTVGHDLNDGHWHSVRVKRRVEKTSLTVDNITQTRTSRGKEFRFGHV 144
           +L +++       L     +NDG WH+VR++R+   T+L +D +         + R   +
Sbjct: 60  QLSFSIFCAEPATLLTDTPVNDGAWHNVRIRRQFRNTTLFIDQVEAKWVEVKSKRR--DM 117

Query: 145 TSNSWVYIGGMPPWYNAKLTLLALPSVI----FAG 175
           T  S +++GG+PP   A    L L SV     F G
Sbjct: 118 TVFSGLFVGGLPPELRAAALKLTLASVREREPFKG 152
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query244
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 99.97
3v64_A191 Low-density lipoprotein receptor-related protein; 99.97
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 99.96
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 99.96
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 99.96
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 99.96
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 99.96
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 99.96
2jd4_A 383 Laminin subunit alpha-1; basement membrane protein 99.95
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 99.95
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 99.95
1dyk_A 394 Laminin alpha 2 chain; metal binding protein; 2.0A 99.94
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.94
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.94
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 99.94
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 99.93
1h30_A 422 GAS6, growth-arrest-specific protein; laminin G-do 99.92
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 99.91
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 99.9
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 99.9
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 99.89
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 99.88
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 99.83
2erf_A209 Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug 98.5
2v73_A191 CBM40, putative EXO-alpha-sialidase; carbohydrate- 98.46
3kqr_A204 Serum amyloid P-component; glycoprotein, disulfide 98.45
3pvn_A206 C-reactive protein; pentraxin family, immune syste 98.43
1za4_A251 Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel 98.43
3flp_A217 SAP-like pentraxin; physiological doubly-stacked h 98.42
2uur_A245 Collagen alpha-1(IX) chain; glycoprotein, hydroxyl 98.23
4dqa_A355 Uncharacterized protein; two domains structure, DU 97.41
2sli_A 679 Intramolecular trans-sialidase; hydrolase, neurami 96.98
4b1m_A185 Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacil 96.73
2jkb_A 686 Sialidase B; intramolecular trans-sialidase, lyase 96.72
1a8d_A 452 Tetanus neurotoxin; clostridial, ganglioside bindi 96.7
3zr5_A656 Galactocerebrosidase; hydrolase, GALC, glycosyl hy 93.71
4azz_A172 Levanase; hydrolase; 1.70A {Bacillus subtilis} 91.91
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 91.83
3v0a_B1196 NTNH; botulinum neurotoxin, toxin, neurotoxin asso 91.1
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 90.46
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 90.23
1a3p_A45 Epidermal growth factor; disulfide connectivities, 89.64
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 88.14
2nyy_A 1295 Botulinum neurotoxin type A; neurotoxin, FAB, prot 87.7
3v64_A191 Low-density lipoprotein receptor-related protein; 85.16
1nql_B53 Epidermal growth factor; cell surface receptor, ty 83.83
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 83.8
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 83.01
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 82.93
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Back     alignment and structure
Probab=99.97  E-value=3.5e-29  Score=204.41  Aligned_cols=162  Identities=23%  Similarity=0.370  Sum_probs=129.4

Q ss_pred             HHHhcccccceeeEecCCCceeEEeccc----------------CcccceEEEEEEEeCCCCeEEEEEcCC-CCccEEEE
Q psy17302         16 LWVLLLLPLGHSFMLDGSQDSYAQLHKW----------------NAALNGSLELEFKTEQPNGLILYTDDG-GTYDFFEI   78 (244)
Q Consensus        16 ~~~~~~c~~~~~~~F~gs~~syl~~~~~----------------~~~~~~~is~~frT~~~~GlLl~~~~~-~~~~~l~l   78 (244)
                      .|-+..|+... ..|+|  .+|+.|+..                ......+|+|.|||++++|+|||.++. ...+|++|
T Consensus         4 ~~e~~~~~~~~-~~F~G--~sy~~~~~~~~~~~~~l~~~~~~~~~~~~~~~is~~frT~~~~GlLl~~g~~~~~~dfl~l   80 (204)
T 1pz7_A            4 IIEKAAGDAEA-IAFDG--RTYMEYHNAVTKSPDALDYPAEPSEKALQSNHFELSIKTEATQGLILWSGKGLERSDYIAL   80 (204)
T ss_dssp             ---CTTSSSCC-EEEES--SCCEEEECCSCCC-------CCSSCEEESEEEEEEEEEECCSSEEEEEESCCSTTCCEEEE
T ss_pred             ccccccccccc-eeECC--ceeEEEcCcccccccccccccccccccceeEEEEEEEEcCCCCeEEEEeCCCCCCCCeEEE
Confidence            35567776644 56777  599999743                223468999999999999999999642 35799999


Q ss_pred             EEeCCcEEEEEEcCCCeEEEEEcCccCCCCeEEEEEEEECcEEEEEEcCceeeee-cCCCceeeeecccCCceEEeccCC
Q psy17302         79 KLVEGALRLRYNLGSGAQILTVGHDLNDGHWHSVRVKRRVEKTSLTVDNITQTRT-SRGKEFRFGHVTSNSWVYIGGMPP  157 (244)
Q Consensus        79 ~L~~G~l~~~~~~g~~~~~~~s~~~vndg~WH~V~v~~~~~~~~L~VD~~~~~~~-~~~~~~~~~~l~~~~~lyiGG~p~  157 (244)
                      +|.+|++++.++.|++...+.+...+|||+||+|.+.|.++.++|.||+...... .++.   ...++...+|||||+|.
T Consensus        81 ~L~~G~l~~~~~~G~g~~~v~s~~~lnDg~WH~V~v~r~~~~~~L~VD~~~~~~~~~~~~---~~~l~~~~~lylGG~p~  157 (204)
T 1pz7_A           81 AIVDGFVQMMYDLGSKPVVLRSTVPINTNHWTHIKAYRVQREGSLQVGNEAPITGSSPLG---ATQLDTDGALWLGGMER  157 (204)
T ss_dssp             EEETTEEEEEEESSSCCEEEEEEEECCSSSCEEEEEEEETTEEEEEETTSCCEEEECCSS---CCCEEECCEEEESSCSC
T ss_pred             EEECCEEEEEEECCCCeEEEECCcccCCCCeEEEEEEEeCCEEEEEECCcceEEEECCCC---CceEcCCCCEEEecCCC
Confidence            9999999999999988777788889999999999999999999999999865543 3321   23467788999999997


Q ss_pred             CCC--------CCCCccccceeEECCEEecCccc
Q psy17302        158 WYN--------AKLTLLALPSVIFAGERVPVWSR  183 (244)
Q Consensus       158 ~~~--------~~~~~GCl~~v~ing~~l~l~~~  183 (244)
                      ...        ...+.|||++|+||++.+++...
T Consensus       158 ~~~~~~~~~~~~~~F~GCi~~l~in~~~~dl~~~  191 (204)
T 1pz7_A          158 LSVAHKLPKAYSTGFIGCIRDVIVDRQELHLVED  191 (204)
T ss_dssp             CSTTTTSCGGGGSBCEEEEEEEEETTEECCTTTS
T ss_pred             cccccccccccCCCceEEEEEEEECCEEccchhh
Confidence            542        12359999999999999999764
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A Back     alignment and structure
>2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} Back     alignment and structure
>3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* Back     alignment and structure
>3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A Back     alignment and structure
>1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A Back     alignment and structure
>3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A Back     alignment and structure
>2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} Back     alignment and structure
>4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} Back     alignment and structure
>2sli_A Intramolecular trans-sialidase; hydrolase, neuraminidase; HET: SKD; 1.80A {Macrobdella decora} SCOP: b.29.1.9 b.68.1.1 PDB: 1sll_A 1sli_A* 3sli_A* 4sli_A* Back     alignment and structure
>4b1m_A Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacillus subtilis} PDB: 4b1l_A* 4azz_A Back     alignment and structure
>2jkb_A Sialidase B; intramolecular trans-sialidase, lyase, glycosidase, neuraminidase; HET: SKD; 1.54A {Streptococcus pneumoniae} PDB: 2vw2_A* 2vw1_A* 2vw0_A* Back     alignment and structure
>1a8d_A Tetanus neurotoxin; clostridial, ganglioside binding region; 1.57A {Clostridium tetani} SCOP: b.29.1.6 b.42.4.2 PDB: 1af9_A 1fv3_A* 1fv2_A* 3hmy_A* 3hn1_A* 1d0h_A* 1dfq_A* 1dll_A* 1yxw_A* 1yyn_A* 1diw_A* Back     alignment and structure
>3zr5_A Galactocerebrosidase; hydrolase, GALC, glycosyl hydrolase, krabbe disease, TIM BAR lectin domain; HET: NAG; 2.10A {Mus musculus} PDB: 3zr6_A* Back     alignment and structure
>4azz_A Levanase; hydrolase; 1.70A {Bacillus subtilis} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3v0a_B NTNH; botulinum neurotoxin, toxin, neurotoxin associated protein, progenitor toxin complex, VHH bound interlocked complex; HET: MES; 2.70A {Clostridium botulinum} PDB: 3v0b_B Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2nyy_A Botulinum neurotoxin type A; neurotoxin, FAB, protein antibody complex, toxin- system complex; 2.61A {Clostridium botulinum} PDB: 2nz9_A 3bta_A 3v0a_A* 3v0b_A 3v0c_A 3zus_A 3zur_A Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 244
d1h30a1191 b.29.1.4 (A:261-451) Growth-arrest-specific protei 4e-26
d1dyka1189 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse 4e-25
d1dyka2185 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse 1e-21
d1pz7a_195 b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI 6e-21
d1d2sa_170 b.29.1.4 (A:) Sex hormone-binding globulin {Human 2e-20
d2r1da1177 b.29.1.4 (A:36-212) Ligand-binding domain of neure 4e-18
d1h30a2218 b.29.1.4 (A:461-678) Growth-arrest-specific protei 2e-14
d2erfa1206 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal do 0.004
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Laminin G-like module
domain: Growth-arrest-specific protein Gas6
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 98.7 bits (245), Expect = 4e-26
 Identities = 26/138 (18%), Positives = 51/138 (36%), Gaps = 4/138 (2%)

Query: 21  LLPLGHSFMLDGSQDSYAQLHKWNAALNGSLELEFKTEQPNGLILYTDDGGTYDFFEIKL 80
            L LG  F   G+     +  +         E +F+T  P G++L+        +  + L
Sbjct: 34  SLYLGRMF--SGTPVIRLRFKRLQP-TRLVAEFDFRTFDPEGILLFAGGHQDSTWIVLAL 90

Query: 81  VEGALRLRYNLGSGAQILTVGHDLNDGHWHSVRVKRRVEKTSLTVDN-ITQTRTSRGKEF 139
             G L L+       ++ + G  +N G W ++ V+       + V+          G  F
Sbjct: 91  RAGRLELQLRYNGVGRVTSSGPVINHGMWQTISVEELARNLVIKVNRDAVMKIAVAGDLF 150

Query: 140 RFGHVTSNSWVYIGGMPP 157
           +      +  + +GG+P 
Sbjct: 151 QPERGLYHLNLTVGGIPF 168
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 Back     information, alignment and structure
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query244
d1dyka1189 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.97
d1pz7a_195 Agrin {Chicken (Gallus gallus) [TaxId: 9031]} 99.95
d1h30a1191 Growth-arrest-specific protein Gas6 {Human (Homo s 99.94
d1dyka2185 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.94
d1d2sa_170 Sex hormone-binding globulin {Human (Homo sapiens) 99.94
d2r1da1177 Ligand-binding domain of neurexin 1beta {Rat (Ratt 99.93
d1h30a2218 Growth-arrest-specific protein Gas6 {Human (Homo s 99.87
d2erfa1206 Thrombospondin 1 N-terminal domain {Human (Homo sa 98.83
d1b09a_206 C-reactive protein (CRP) {Human (Homo sapiens) [Ta 98.43
d1saca_204 Serum amyloid P component (SAP) {Human (Homo sapie 98.36
d2slia1196 Leech intramolecular trans-sialidase, N-terminal d 97.88
d1a8da1247 Tetanus neurotoxin {Clostridium tetani [TaxId: 151 97.73
d3btaa1207 Botulinum neurotoxin {Clostridium botulinum, serot 97.48
d1epwa1218 Botulinum neurotoxin {Clostridium botulinum, serot 97.42
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 95.85
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 95.55
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 95.34
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 94.79
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 93.92
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 93.65
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 93.5
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 93.32
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 91.97
d1dyka1189 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 91.67
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 90.21
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 90.04
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 89.53
d1d2sa_170 Sex hormone-binding globulin {Human (Homo sapiens) 87.51
d1oq1a_223 Hypothetical protein YesU {Bacillus subtilis [TaxI 85.62
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 83.5
d1h30a2218 Growth-arrest-specific protein Gas6 {Human (Homo s 80.84
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Laminin G-like module
domain: Laminin alpha2 chain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.97  E-value=2.3e-29  Score=201.21  Aligned_cols=155  Identities=24%  Similarity=0.350  Sum_probs=129.1

Q ss_pred             eeeEecCCCceeEEecc--cCcccceEEEEEEEeCCCCeEEEEEcCCCCccEEEEEEeCCcEEEEEEcCCCeEEEEEcCc
Q psy17302         26 HSFMLDGSQDSYAQLHK--WNAALNGSLELEFKTEQPNGLILYTDDGGTYDFFEIKLVEGALRLRYNLGSGAQILTVGHD  103 (244)
Q Consensus        26 ~~~~F~gs~~syl~~~~--~~~~~~~~is~~frT~~~~GlLl~~~~~~~~~~l~l~L~~G~l~~~~~~g~~~~~~~s~~~  103 (244)
                      .+..|.++..||+.++.  .....+++|+|+|||++++|+|||.++....+|++|+|.+|+|++.++.|++...+.++..
T Consensus        15 ~~~~fg~s~~s~~~~~~~~~~~~~~~~i~~~frT~~~~GlL~~~~~~~~~dfi~l~l~~G~l~~~~~~g~~~~~~~~~~~   94 (189)
T d1dyka1          15 GSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPYFSYDLGSGDTSTMIPTK   94 (189)
T ss_dssp             TCEECCSSTTCEEEEECCGGGGSSEEEEEEEEEECCSCEEEEEEECTTSSSEEEEEEETTEEEEEEESSSCEEEEECCSC
T ss_pred             CceecCCCCCceEEEecCcccccccEEEEEEEEECCCCEEEEEEcCCCCCcEEEEEEECCEEEEEEECCCccEEecCCcE
Confidence            44667666789999963  3445678999999999999999999876778999999999999999999988887888889


Q ss_pred             cCCCCeEEEEEEEECcEEEEEEcCceeeeecCCCceeeeecccCCceEEeccCCCCCCC-------CCccccceeEECCE
Q psy17302        104 LNDGHWHSVRVKRRVEKTSLTVDNITQTRTSRGKEFRFGHVTSNSWVYIGGMPPWYNAK-------LTLLALPSVIFAGE  176 (244)
Q Consensus       104 vndg~WH~V~v~~~~~~~~L~VD~~~~~~~~~~~~~~~~~l~~~~~lyiGG~p~~~~~~-------~~~GCl~~v~ing~  176 (244)
                      +|||+||+|.+.|.++.++|.||+.......+...   ..++....+||||+|......       .+.|||++|+||++
T Consensus        95 v~Dg~WH~V~v~~~~~~~~l~VD~~~~~~~~~~~~---~~l~~~~~lyiGG~p~~~~~~~~~~~~~~F~GCi~~v~in~~  171 (189)
T d1dyka1          95 INDGQWHKIKIVRVKQEGILYVDDASSQTISPKKA---DILDVVGILYVGGLPINYTTRRIGPVTYSLDGCVRNLHMEQA  171 (189)
T ss_dssp             CCSSSCEEEEEEEETTEEEEEETTEEEEEECSTTC---CCCCCCSEEEESSCCTTCCCCSSCSCCSBCSEEEEEEEESSS
T ss_pred             eeCCCEEEEEEEEcccEEEEEECCcceeeEccCcc---cccccccceEEecccccccccccCcCCCCcEEEEeEEEECCE
Confidence            99999999999999999999999987665444322   236677899999998654332       25999999999999


Q ss_pred             EecCccc
Q psy17302        177 RVPVWSR  183 (244)
Q Consensus       177 ~l~l~~~  183 (244)
                      +++|+.+
T Consensus       172 ~~~L~~~  178 (189)
T d1dyka1         172 PVDLDQP  178 (189)
T ss_dssp             CCCTTSC
T ss_pred             EecCCCc
Confidence            9999754
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} Back     information, alignment and structure
>d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} Back     information, alignment and structure
>d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Back     information, alignment and structure
>d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oq1a_ b.29.1.17 (A:) Hypothetical protein YesU {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure