Psyllid ID: psy17376
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 227 | ||||||
| 1169995 | 1115 | RecName: Full=G-protein coupled receptor | 0.488 | 0.099 | 0.460 | 5e-21 | |
| 443690449 | 1080 | hypothetical protein CAPTEDRAFT_92610 [C | 0.550 | 0.115 | 0.408 | 9e-20 | |
| 405972283 | 585 | hypothetical protein CGI_10018795 [Crass | 0.334 | 0.129 | 0.558 | 8e-16 | |
| 331702865 | 844 | vitellogenin receptor [Dicentrarchus lab | 0.484 | 0.130 | 0.398 | 8e-15 | |
| 169646705 | 866 | very low-density lipoprotein receptor pr | 0.484 | 0.127 | 0.398 | 4e-14 | |
| 270016386 | 1751 | hypothetical protein TcasGA2_TC004260 [T | 0.559 | 0.072 | 0.359 | 5e-14 | |
| 37728099 | 844 | vitellogenin receptor [Morone americana] | 0.484 | 0.130 | 0.398 | 6e-14 | |
| 91094565 | 1731 | PREDICTED: similar to low-density lipopr | 0.559 | 0.073 | 0.359 | 6e-14 | |
| 348505126 | 844 | PREDICTED: very low-density lipoprotein | 0.484 | 0.130 | 0.390 | 7e-14 | |
| 45382563 | 863 | very low-density lipoprotein receptor pr | 0.497 | 0.130 | 0.391 | 7e-14 |
| >gi|1169995|sp|P46023.1|GR101_LYMST RecName: Full=G-protein coupled receptor GRL101; Flags: Precursor gi|438129|emb|CAA80651.1| G protein-coupled receptor [Lymnaea stagnalis] | Back alignment and taxonomy information |
|---|
Score = 107 bits (266), Expect = 5e-21, Method: Compositional matrix adjust.
Identities = 59/128 (46%), Positives = 77/128 (60%), Gaps = 17/128 (13%)
Query: 29 SSRPIFQCN--QTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPNEFR 86
S F C+ QC+L S C+G+ +C NG DESV CG CL +EF+
Sbjct: 39 SVEGTFHCDDGMLQCVLMGSKCDGVSDCENGMDESVETCG-------------CLQSEFQ 85
Query: 87 CSNS-CIDHLKRCDRTQDCELGEDEIDCKTYMCPV-SHYKCSNDFCIPLDKVCNFIDDCG 144
C+++ CID + RCDR DC G DE +C Y+CP+ +H K N FC+P DK C+F+DDCG
Sbjct: 86 CNHTTCIDKILRCDRNDDCSNGLDERECDIYICPLGTHVKWHNHFCVPRDKQCDFLDDCG 145
Query: 145 DNSDEMEC 152
DNSDE C
Sbjct: 146 DNSDEKIC 153
|
Source: Lymnaea stagnalis Species: Lymnaea stagnalis Genus: Lymnaea Family: Lymnaeidae Order: Class: Gastropoda Phylum: Mollusca Superkingdom: Eukaryota |
| >gi|443690449|gb|ELT92587.1| hypothetical protein CAPTEDRAFT_92610 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|405972283|gb|EKC37059.1| hypothetical protein CGI_10018795 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|331702865|emb|CBX54721.1| vitellogenin receptor [Dicentrarchus labrax] | Back alignment and taxonomy information |
|---|
| >gi|169646705|ref|NP_957217.2| very low-density lipoprotein receptor precursor [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|270016386|gb|EFA12832.1| hypothetical protein TcasGA2_TC004260 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|37728099|gb|AAO92396.1| vitellogenin receptor [Morone americana] | Back alignment and taxonomy information |
|---|
| >gi|91094565|ref|XP_967627.1| PREDICTED: similar to low-density lipoprotein receptor (ldl), partial [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|348505126|ref|XP_003440112.1| PREDICTED: very low-density lipoprotein receptor [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|45382563|ref|NP_990560.1| very low-density lipoprotein receptor precursor [Gallus gallus] gi|1730110|sp|P98165.1|VLDLR_CHICK RecName: Full=Very low-density lipoprotein receptor; Short=VLDL receptor; Short=VLDL-R; AltName: Full=Vitellogenin receptor; Short=VTG receptor; Flags: Precursor gi|609266|emb|CAA56505.1| chicken very low density lipoprotein (VLDL)/vitellogenin receptor [Gallus gallus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 227 | ||||||
| UNIPROTKB|P98165 | 863 | VLDLR "Very low-density lipopr | 0.533 | 0.140 | 0.384 | 2.7e-19 | |
| UNIPROTKB|F1NC45 | 865 | VLDLR "Very low-density lipopr | 0.533 | 0.139 | 0.384 | 2.7e-19 | |
| ZFIN|ZDB-GENE-040426-803 | 866 | vldlr "very low density lipopr | 0.484 | 0.127 | 0.406 | 5.7e-19 | |
| UNIPROTKB|Q6X0I2 | 1782 | VgR "Vitellogenin receptor" [S | 0.528 | 0.067 | 0.389 | 6.6e-18 | |
| UNIPROTKB|F1LZE5 | 1074 | Lrp1b "Protein Lrp1b" [Rattus | 0.511 | 0.108 | 0.417 | 1.5e-17 | |
| FB|FBgn0261260 | 4769 | mgl "Megalin" [Drosophila mela | 0.506 | 0.024 | 0.383 | 2e-17 | |
| UNIPROTKB|F1MIQ2 | 844 | VLDLR "Uncharacterized protein | 0.533 | 0.143 | 0.369 | 2.8e-17 | |
| UNIPROTKB|F1P787 | 845 | VLDLR "Uncharacterized protein | 0.533 | 0.143 | 0.369 | 2.8e-17 | |
| UNIPROTKB|F1P783 | 873 | VLDLR "Uncharacterized protein | 0.533 | 0.138 | 0.369 | 3e-17 | |
| UNIPROTKB|P98155 | 873 | VLDLR "Very low-density lipopr | 0.533 | 0.138 | 0.369 | 3.8e-17 |
| UNIPROTKB|P98165 VLDLR "Very low-density lipoprotein receptor" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 242 (90.2 bits), Expect = 2.7e-19, P = 2.7e-19
Identities = 50/130 (38%), Positives = 68/130 (52%)
Query: 24 KVSCNSSRPIFQCNQTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPN 83
K +C S F CN QC+ C+G P+C +G DES +C ++R N + C P
Sbjct: 87 KKTCAESD--FVCNSGQCVPNRWQCDGDPDCEDGSDESAELC---HMRTCRVNEISCGPQ 141
Query: 84 EFRCSNSCIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDC 143
S CI +CD +DC+ GEDE +C C + + CS+ CI VCN DDC
Sbjct: 142 ----STQCIPVSWKCDGEKDCDSGEDEENCGNVTCSAAEFTCSSGQCISKSFVCNGQDDC 197
Query: 144 GDNSDEMECS 153
D SDE+EC+
Sbjct: 198 SDGSDELECA 207
|
|
| UNIPROTKB|F1NC45 VLDLR "Very low-density lipoprotein receptor" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-803 vldlr "very low density lipoprotein receptor" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6X0I2 VgR "Vitellogenin receptor" [Solenopsis invicta (taxid:13686)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LZE5 Lrp1b "Protein Lrp1b" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0261260 mgl "Megalin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MIQ2 VLDLR "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P787 VLDLR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P783 VLDLR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P98155 VLDLR "Very low-density lipoprotein receptor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 227 | |||
| cd00112 | 35 | cd00112, LDLa, Low Density Lipoprotein Receptor Cl | 4e-09 | |
| cd00112 | 35 | cd00112, LDLa, Low Density Lipoprotein Receptor Cl | 4e-07 | |
| smart00192 | 33 | smart00192, LDLa, Low-density lipoprotein receptor | 4e-07 | |
| pfam00057 | 37 | pfam00057, Ldl_recept_a, Low-density lipoprotein r | 3e-06 | |
| smart00192 | 33 | smart00192, LDLa, Low-density lipoprotein receptor | 1e-04 | |
| pfam00057 | 37 | pfam00057, Ldl_recept_a, Low-density lipoprotein r | 1e-04 |
| >gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
Score = 50.3 bits (121), Expect = 4e-09
Identities = 18/35 (51%), Positives = 23/35 (65%)
Query: 118 CPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEMEC 152
CP + ++C+N CIP VC+ DDCGD SDE C
Sbjct: 1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
|
Length = 35 |
| >gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 227 | |||
| KOG1215|consensus | 877 | 99.08 | ||
| PF00057 | 37 | Ldl_recept_a: Low-density lipoprotein receptor dom | 99.08 | |
| cd00112 | 35 | LDLa Low Density Lipoprotein Receptor Class A doma | 99.04 | |
| PF00057 | 37 | Ldl_recept_a: Low-density lipoprotein receptor dom | 99.02 | |
| cd00112 | 35 | LDLa Low Density Lipoprotein Receptor Class A doma | 99.01 | |
| PF12999 | 176 | PRKCSH-like: Glucosidase II beta subunit-like | 98.82 | |
| smart00192 | 33 | LDLa Low-density lipoprotein receptor domain class | 98.79 | |
| PF12999 | 176 | PRKCSH-like: Glucosidase II beta subunit-like | 98.73 | |
| smart00192 | 33 | LDLa Low-density lipoprotein receptor domain class | 98.73 | |
| KOG1215|consensus | 877 | 98.48 | ||
| KOG2397|consensus | 480 | 97.37 | ||
| KOG2397|consensus | 480 | 97.22 | ||
| KOG3509|consensus | 964 | 95.8 | ||
| KOG3509|consensus | 964 | 93.05 |
| >KOG1215|consensus | Back alignment and domain information |
|---|
Probab=99.08 E-value=2.1e-10 Score=115.69 Aligned_cols=152 Identities=25% Similarity=0.453 Sum_probs=111.8
Q ss_pred eeecCCCCCCCcCC----CccCCCCCCceecC--CCceEeCCCccCCCCCCCCCCCCCCCCCCCCcccCCC---------
Q psy17376 10 YHKVLDVPRTQARQ----KVSCNSSRPIFQCN--QTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLL--------- 74 (227)
Q Consensus 10 cdg~~dc~~~~d~~----~~~C~~~~~~F~C~--~g~CI~~~~~CDg~~DC~DgSDE~~~~C~~~~~~~~~--------- 74 (227)
..+....+.+.++. ...|. ..+|.|. +++||+..|+|||..+|.+|+|| .+|.........
T Consensus 117 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~c~~~~~~Cip~~~~cd~~~~C~dg~de--~~~~~~~~~~~~~~~~~~~~~ 192 (877)
T KOG1215|consen 117 PSSQPLAPDPCAESGNGPCSHCC--LDKFSCRTGSCKCIPGDWLCDGEADCPDGSDE--LNCAVRRCEPRGASLDCIVAI 192 (877)
T ss_pred cCCCCCCCCcccccCCCCCcccc--CCCCCCcCccccCCCCceeCCCCCccccchhh--hcccccccCccccccccceee
Confidence 33444455555553 23333 6889999 78999999999999999999999 677411100000
Q ss_pred -----------------CCCCCC---CCCceecC--CceecCCCccCCcccCCCCCcc--cCCCCCCcCCCceecCCCce
Q psy17376 75 -----------------PNPLGC---LPNEFRCS--NSCIDHLKRCDRTQDCELGEDE--IDCKTYMCPVSHYKCSNDFC 130 (227)
Q Consensus 75 -----------------~~~~~C---~~~~f~C~--~~Ci~~~~~CDG~~DC~dgsDE--~~C~~~~C~~~~f~C~~g~C 130 (227)
.....+ ....++|. .+||...++|||..||.+++|| .++....|...++.|.++.|
T Consensus 193 ~~~d~~~~~~~~~d~~~~~~~~~~~~~~~~~~c~g~~~~i~~~~~~Dg~~dc~~~~de~~~~~~~~~~~~~e~~~~~~~~ 272 (877)
T KOG1215|consen 193 KVCDIQHDCADDYDESEGRIYWTDDSRIEVTRCDGSSRCILISEVCDGPRDCVDGPDEGVMNCSDATCEAPEIECADGDC 272 (877)
T ss_pred eecCcccccccccccccCcccccCCcceeEEEecCCCcEEeehhccCCCcccccCCcCceeEeeccccCCcceeecCCCC
Confidence 000001 13567887 4999999999999999999999 46766678888999999999
Q ss_pred ecCCcccCCCCCCCCCCCCCCCCCCCc--CceecCCC
Q psy17376 131 IPLDKVCNFIDDCGDNSDEMECSLFTF--LSFRLNKK 165 (227)
Q Consensus 131 i~~~~~CDg~~DC~DgsDE~~C~~~~C--~~f~C~~~ 165 (227)
++..++|+|..||++|+||.+|....+ ..|.|..+
T Consensus 273 ~~~~~~~~g~~d~pdg~de~~~~~~~~~~~~~d~~~~ 309 (877)
T KOG1215|consen 273 SDRQKLCDGDLDCPDGLDEDYCKKKLYWSMNVDGSGR 309 (877)
T ss_pred ccceEEecCccCCCCcccccccccceeeeeecccCCc
Confidence 999999999999999999998875433 45555543
|
|
| >PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >PF12999 PRKCSH-like: Glucosidase II beta subunit-like | Back alignment and domain information |
|---|
| >smart00192 LDLa Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >PF12999 PRKCSH-like: Glucosidase II beta subunit-like | Back alignment and domain information |
|---|
| >smart00192 LDLa Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >KOG1215|consensus | Back alignment and domain information |
|---|
| >KOG2397|consensus | Back alignment and domain information |
|---|
| >KOG2397|consensus | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 227 | ||||
| 3m0c_C | 791 | The X-Ray Crystal Structure Of Pcsk9 In Complex Wit | 5e-12 | ||
| 1n7d_A | 699 | Extracellular Domain Of The Ldl Receptor Length = 6 | 9e-12 | ||
| 2fyj_A | 82 | Nmr Solution Structure Of Calcium-Loaded Lrp Double | 2e-05 | ||
| 2fcw_B | 80 | Structure Of A Complex Between The Pair Of The Ldl | 9e-05 | ||
| 1f5y_A | 85 | Nmr Structure Of A Concatemer Of The First And Seco | 1e-04 | ||
| 2lgp_A | 94 | Solution Structure Of La45 From Ldlr Length = 94 | 3e-04 | ||
| 2xrc_A | 565 | Human Complement Factor I Length = 565 | 5e-04 |
| >pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 | Back alignment and structure |
|
| >pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 | Back alignment and structure |
| >pdb|2FYJ|A Chain A, Nmr Solution Structure Of Calcium-Loaded Lrp Double Module Length = 82 | Back alignment and structure |
| >pdb|2FCW|B Chain B, Structure Of A Complex Between The Pair Of The Ldl Receptor Ligand-Binding Modules 3-4 And The Receptor Associated Protein (Rap) Length = 80 | Back alignment and structure |
| >pdb|1F5Y|A Chain A, Nmr Structure Of A Concatemer Of The First And Second Ligand-Binding Modules Of The Human Ldl Receptor Length = 85 | Back alignment and structure |
| >pdb|2LGP|A Chain A, Solution Structure Of La45 From Ldlr Length = 94 | Back alignment and structure |
| >pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 227 | |||
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 4e-23 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 4e-22 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 1e-18 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 1e-17 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 2e-17 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 3e-11 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 4e-07 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 4e-05 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 2e-22 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 9e-22 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 4e-18 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 2e-17 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 4e-16 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 5e-14 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 6e-11 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 1e-06 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 5e-21 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 2e-12 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 3e-08 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 8e-04 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 2e-20 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 6e-13 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 1e-14 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 4e-10 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 4e-06 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 1e-08 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 6e-06 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 3e-08 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 4e-05 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 4e-08 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 1e-07 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 5e-08 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 3e-05 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 4e-04 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 9e-08 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 2e-06 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 5e-07 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 3e-05 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 1e-06 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 2e-06 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 2e-06 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 3e-05 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 2e-06 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 8e-06 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 5e-06 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 1e-05 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 3e-05 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 3e-04 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 3e-05 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 4e-05 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 3e-05 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 8e-05 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 7e-05 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 |
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
Score = 96.1 bits (238), Expect = 4e-23
Identities = 42/126 (33%), Positives = 54/126 (42%), Gaps = 13/126 (10%)
Query: 34 FQCNQTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPNEFRCSNS--- 90
FQC +CI +C+G EC +G DES C + C +F C
Sbjct: 29 FQCQDGKCISYKWVCDGSAECQDGSDESQETC----------LSVTCKSGDFSCGGRVNR 78
Query: 91 CIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEM 150
CI RCD DC+ G DE C C ++C + CI VC+ DC D SDE
Sbjct: 79 CIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEA 138
Query: 151 ECSLFT 156
C + T
Sbjct: 139 SCPVLT 144
|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 227 | |||
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 100.0 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 100.0 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 99.97 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 99.96 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 99.87 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 99.84 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 99.84 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 99.83 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 99.55 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 99.4 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 99.37 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 99.16 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 99.15 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 99.12 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 99.11 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 99.09 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 99.08 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 99.07 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 99.07 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 99.06 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 99.05 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 99.04 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 99.03 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 99.03 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 99.01 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 99.01 | |
| 2m0p_A | 52 | Low-density lipoprotein receptor-related protein; | 99.0 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 98.99 | |
| 2m0p_A | 52 | Low-density lipoprotein receptor-related protein; | 98.98 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 98.98 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 98.98 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 98.93 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 98.93 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 98.93 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 98.92 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 98.88 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 98.86 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 98.83 | |
| 2gtl_N | 220 | Extracellular hemoglobin linker L2 subunit; anneli | 98.63 | |
| 2gtl_N | 220 | Extracellular hemoglobin linker L2 subunit; anneli | 98.6 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 98.43 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 98.32 | |
| 3ojy_B | 537 | Complement component C8 beta chain; macpf, lipocal | 98.08 | |
| 3ojy_A | 554 | Complement component C8 alpha chain; macpf, lipoca | 97.98 | |
| 3ojy_B | 537 | Complement component C8 beta chain; macpf, lipocal | 97.9 | |
| 3ojy_A | 554 | Complement component C8 alpha chain; macpf, lipoca | 97.71 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 97.29 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 96.71 |
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
Probab=100.00 E-value=8.8e-35 Score=283.19 Aligned_cols=193 Identities=24% Similarity=0.426 Sum_probs=134.1
Q ss_pred eeeccCCceeecCCCCCCCcCCCccCC---CCCCceecCC--CceEeCCCccCCCCCCCCCCCCCCCCCCCCcccCCCCC
Q psy17376 2 LLLRKHEVYHKVLDVPRTQARQKVSCN---SSRPIFQCNQ--TQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPN 76 (227)
Q Consensus 2 ~cl~~~~~cdg~~dc~~~~d~~~~~C~---~~~~~F~C~~--g~CI~~~~~CDg~~DC~DgSDE~~~~C~~~~~~~~~~~ 76 (227)
.||+...+|||+.||.+++||....|. +...+|+|.+ ++|||..|+|||..||.||||| .+|.
T Consensus 17 ~ci~~~~~Cdg~~dC~d~sDE~~~~C~~~~C~~~~f~C~~~~~~Ci~~~~~Cdg~~dC~dgsDE--~~C~---------- 84 (699)
T 1n7d_A 17 KCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDE--QGCP---------- 84 (699)
T ss_dssp ---------------------------CCSCSSSSCCCCC--CCCCCSSSTTSSSCCC-CCCTT--TSCS----------
T ss_pred cEEcHHhcCCCcccCCCCCCCCccccCCcCCCCCccCCCCCCCceeCcceecCCcccCCCCccc--Cccc----------
Confidence 489999999999999999999875552 3479999997 4899999999999999999999 8997
Q ss_pred CCCCCCCceecC-CceecCCCccCCcccCCCCCcccCCCCCCcCCCceecCCCceecCCcccCCCCCCCCCCCC--CCCC
Q psy17376 77 PLGCLPNEFRCS-NSCIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDE--MECS 153 (227)
Q Consensus 77 ~~~C~~~~f~C~-~~Ci~~~~~CDG~~DC~dgsDE~~C~~~~C~~~~f~C~~g~Ci~~~~~CDg~~DC~DgsDE--~~C~ 153 (227)
...|.+.+|+|. ++||+..|+|||+.||.|||||.+|....|++.+|+|.+|+||+..|+|||+.||.||||| .+|.
T Consensus 85 ~~~C~~~~f~C~~g~Ci~~~~~Cdg~~dC~dgsDE~~C~~~~C~~~~f~C~~~~Ci~~~~~Cdg~~dC~dgsDE~~~~C~ 164 (699)
T 1n7d_A 85 PKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCR 164 (699)
T ss_dssp SCCCCSSCCCSSCC----CCCTTCSSCCSSSSCSSSSCCCCCCCSSCCCCSSSCCCCTTSTTCSSCCSSSSSSSSCSSSS
T ss_pred ccccccCcEEcCCCCEecHHHcCCCcCcCCCCCccCCcCccccCccccCCCCCcccchhcccCCCCcCCCCcccccccCC
Confidence 457999999999 9999999999999999999999999888899999999999999999999999999999999 8995
Q ss_pred C--------CCc--CceecCCC--CCCCeeeccccCCcchhhccCCCCCCccccCCCccccCCCCCCCCCCCCccCCCCC
Q psy17376 154 L--------FTF--LSFRLNKK--IPRKSISMTSAKMNQQALLTGNENFDLWVAGFCADALKPSRNFTKHPRALFPLPHK 221 (227)
Q Consensus 154 ~--------~~C--~~f~C~~~--~~~~~~~~~~~~~~~~~~~~g~~~~~~w~c~~~~De~~~~~~~~~cp~~~f~cp~~ 221 (227)
. ..| .+|+|.++ |+..|+|++ ...|.+++||.+-. ...|+.+.|.|.+|
T Consensus 165 ~~~~~~~~~~~C~~~~f~C~~g~Ci~~~~~CDg-----------------~~dC~dgsDE~~C~--~~~C~~~~f~C~~g 225 (699)
T 1n7d_A 165 GLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDG-----------------GPDCKDKSDEENCA--VATCRPDEFQCSDG 225 (699)
T ss_dssp CCCCCSSCCCCSCSSSCCCSSSCCCSTTCTTSS-----------------SCCSTTSCSSCSCC--CCCCCSSEEESSSS
T ss_pred CcccccCCCCCCCCcceecCCCceEechhccCC-----------------CCCCCCCcccccCC--CcccCCCcEecCCC
Confidence 3 368 78999875 444444433 22356777777621 24677777777777
Q ss_pred CCCC
Q psy17376 222 SPVP 225 (227)
Q Consensus 222 ~~~~ 225 (227)
.+||
T Consensus 226 ~Ci~ 229 (699)
T 1n7d_A 226 NCIH 229 (699)
T ss_dssp CEEE
T ss_pred ceee
Confidence 7766
|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* | Back alignment and structure |
|---|
| >2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 227 | ||||
| d1f8za_ | 39 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-08 | |
| d1f8za_ | 39 | g.12.1.1 (A:) Ligand-binding domain of low-density | 3e-06 | |
| d1ajja_ | 37 | g.12.1.1 (A:) Ligand-binding domain of low-density | 3e-08 | |
| d1ajja_ | 37 | g.12.1.1 (A:) Ligand-binding domain of low-density | 1e-05 | |
| d1j8ea_ | 44 | g.12.1.1 (A:) Ligand-binding domain of low-density | 3e-08 | |
| d1j8ea_ | 44 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-05 | |
| d1j8ea_ | 44 | g.12.1.1 (A:) Ligand-binding domain of low-density | 0.001 | |
| d2fcwb1 | 39 | g.12.1.1 (B:86-124) Ligand-binding domain of low-d | 4e-08 | |
| d2fcwb1 | 39 | g.12.1.1 (B:86-124) Ligand-binding domain of low-d | 7e-06 | |
| d2fcwb1 | 39 | g.12.1.1 (B:86-124) Ligand-binding domain of low-d | 0.004 | |
| d1f5ya1 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 6e-08 | |
| d1f5ya1 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 7e-05 | |
| d1f5ya1 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 6e-04 | |
| d1d2la_ | 45 | g.12.1.1 (A:) Ligand-binding domain of low-density | 6e-08 | |
| d1d2la_ | 45 | g.12.1.1 (A:) Ligand-binding domain of low-density | 4e-05 | |
| d1d2la_ | 45 | g.12.1.1 (A:) Ligand-binding domain of low-density | 8e-05 | |
| d2fcwb2 | 39 | g.12.1.1 (B:125-163) Ligand-binding domain of low- | 2e-07 | |
| d2fcwb2 | 39 | g.12.1.1 (B:125-163) Ligand-binding domain of low- | 1e-04 | |
| d2fcwb2 | 39 | g.12.1.1 (B:125-163) Ligand-binding domain of low- | 1e-04 | |
| d2gtlo2 | 41 | g.12.1.1 (O:60-100) Extracellular hemoglobin linke | 1e-06 | |
| d2gtlo2 | 41 | g.12.1.1 (O:60-100) Extracellular hemoglobin linke | 6e-05 | |
| d1cr8a_ | 42 | g.12.1.1 (A:) Ligand-binding domain of low-density | 1e-06 | |
| d1cr8a_ | 42 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-06 | |
| d1xfea2 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 2e-06 | |
| d1xfea2 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 3e-05 | |
| d1xfea2 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 0.001 | |
| d1f5ya2 | 41 | g.12.1.1 (A:45-85) Ligand-binding domain of low-de | 4e-06 | |
| d1f5ya2 | 41 | g.12.1.1 (A:45-85) Ligand-binding domain of low-de | 4e-05 | |
| d1v9u5_ | 39 | g.12.1.1 (5:) Very low-density lipoprotein recepto | 5e-06 | |
| d1v9u5_ | 39 | g.12.1.1 (5:) Very low-density lipoprotein recepto | 4e-05 | |
| d1k7ba_ | 42 | g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai | 1e-05 | |
| d1k7ba_ | 42 | g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai | 4e-05 | |
| d2gtln2 | 41 | g.12.1.1 (N:61-101) Extracellular hemoglobin linke | 3e-05 | |
| d2gtln2 | 41 | g.12.1.1 (N:61-101) Extracellular hemoglobin linke | 0.001 | |
| d2gtlm2 | 42 | g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co | 6e-05 | |
| d2gtlm2 | 42 | g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co | 0.002 |
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
class: Small proteins fold: LDL receptor-like module superfamily: LDL receptor-like module family: LDL receptor-like module domain: Ligand-binding domain of low-density lipoprotein receptor species: Human (Homo sapiens) [TaxId: 9606]
Score = 46.6 bits (111), Expect = 2e-08
Identities = 13/35 (37%), Positives = 19/35 (54%)
Query: 118 CPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEMEC 152
C ++CS+ CI + C+ DC D SDE+ C
Sbjct: 3 CRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGC 37
|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 227 | |||
| d1ajja_ | 37 | Ligand-binding domain of low-density lipoprotein r | 99.22 | |
| d1f8za_ | 39 | Ligand-binding domain of low-density lipoprotein r | 99.21 | |
| d2fcwb1 | 39 | Ligand-binding domain of low-density lipoprotein r | 99.18 | |
| d1xfea2 | 44 | Ligand-binding domain of low-density lipoprotein r | 99.18 | |
| d2fcwb2 | 39 | Ligand-binding domain of low-density lipoprotein r | 99.15 | |
| d1ajja_ | 37 | Ligand-binding domain of low-density lipoprotein r | 99.15 | |
| d1f8za_ | 39 | Ligand-binding domain of low-density lipoprotein r | 99.14 | |
| d2fcwb1 | 39 | Ligand-binding domain of low-density lipoprotein r | 99.14 | |
| d1f5ya2 | 41 | Ligand-binding domain of low-density lipoprotein r | 99.13 | |
| d1f5ya2 | 41 | Ligand-binding domain of low-density lipoprotein r | 99.11 | |
| d1f5ya1 | 44 | Ligand-binding domain of low-density lipoprotein r | 99.11 | |
| d1d2la_ | 45 | Ligand-binding domain of low-density lipoprotein r | 99.11 | |
| d1cr8a_ | 42 | Ligand-binding domain of low-density lipoprotein r | 99.1 | |
| d1f5ya1 | 44 | Ligand-binding domain of low-density lipoprotein r | 99.1 | |
| d1cr8a_ | 42 | Ligand-binding domain of low-density lipoprotein r | 99.08 | |
| d2gtlo2 | 41 | Extracellular hemoglobin linker l3 subunit {Common | 99.04 | |
| d1v9u5_ | 39 | Very low-density lipoprotein receptor {Human (Homo | 99.04 | |
| d1j8ea_ | 44 | Ligand-binding domain of low-density lipoprotein r | 99.03 | |
| d2fcwb2 | 39 | Ligand-binding domain of low-density lipoprotein r | 99.01 | |
| d2gtlo2 | 41 | Extracellular hemoglobin linker l3 subunit {Common | 99.0 | |
| d1d2la_ | 45 | Ligand-binding domain of low-density lipoprotein r | 99.0 | |
| d1j8ea_ | 44 | Ligand-binding domain of low-density lipoprotein r | 99.0 | |
| d1v9u5_ | 39 | Very low-density lipoprotein receptor {Human (Homo | 98.99 | |
| d1k7ba_ | 42 | soluble Tva ectodomain, sTva47 {Quail (Coturnix co | 98.98 | |
| d2gtln2 | 41 | Extracellular hemoglobin linker l2 subunit {Common | 98.98 | |
| d2gtlm2 | 42 | Hemoglobin linker chain l1 {Common earthworm (Lumb | 98.96 | |
| d1k7ba_ | 42 | soluble Tva ectodomain, sTva47 {Quail (Coturnix co | 98.91 | |
| d2gtln2 | 41 | Extracellular hemoglobin linker l2 subunit {Common | 98.85 | |
| d1xfea2 | 44 | Ligand-binding domain of low-density lipoprotein r | 98.83 | |
| d2gtlm2 | 42 | Hemoglobin linker chain l1 {Common earthworm (Lumb | 98.82 |
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: LDL receptor-like module superfamily: LDL receptor-like module family: LDL receptor-like module domain: Ligand-binding domain of low-density lipoprotein receptor species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.22 E-value=2.7e-12 Score=77.84 Aligned_cols=36 Identities=33% Similarity=0.695 Sum_probs=27.8
Q ss_pred cCCCceecCCCceecCCcccCCCCCCCCCCCCCCCC
Q psy17376 118 CPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEMECS 153 (227)
Q Consensus 118 C~~~~f~C~~g~Ci~~~~~CDg~~DC~DgsDE~~C~ 153 (227)
|++++|+|.+|+||+..++|||+.||.|||||.+|+
T Consensus 2 C~~~~f~C~~g~Ci~~~~~CDg~~DC~dgsDE~~Cs 37 (37)
T d1ajja_ 2 CSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCA 37 (37)
T ss_dssp CCTTCEECTTSCEECGGGTTSSSCCSTTCGGGTTCC
T ss_pred CCCCceEcCCCCEECchhcCCCCCcCCCCchhhccC
Confidence 566778887777888888888888888888887764
|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|