Psyllid ID: psy17376


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MLLLRKHEVYHKVLDVPRTQARQKVSCNSSRPIFQCNQTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPNEFRCSNSCIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEMECSLFTFLSFRLNKKIPRKSISMTSAKMNQQALLTGNENFDLWVAGFCADALKPSRNFTKHPRALFPLPHKSPVPCS
cEEccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cEEccccEEEcccccccccccccccccccccccEEcccccEccccEEEccccccccccccccccccccccccccccccccccccEEEccccccccEEEcccccccccccccccccccccccccEcccccEccccEEcccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mlllrkhevyhkvldvprtqarqkvscnssrpifqcnqtqCILEtslcngipecgngrdesvamcgeynirdllpnplgclpnefrcsnscidhlkrcdrtqdcelgedeidcktymcpvshykcsndfcipldkvcnfiddcgdnsdemeCSLFTFLSFRlnkkiprksisMTSAKMNQQALLTGNENFDLWVAGFcadalkpsrnftkhpralfplphkspvpcs
mlllrkhevyhkvldvprtqarqKVSCNSSRPIFQCNQTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPNEFRCSNSCIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEMECSLFTFLSFRLNKKIPRKSISMTSAKMNQQALLTGNENFDLWVAGFCADALKPSRNFTkhpralfplphkspvpcs
MLLLRKHEVYHKVLDVPRTQARQKVSCNSSRPIFQCNQTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPNEFRCSNSCIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEMECSLFTFLSFRLNKKIPRKSISMTSAKMNQQALLTGNENFDLWVAGFCADALKPSRNFTKHPRALFPLPHKSPVPCS
******HEVYHKVLDVPRT****KVSCNSSRPIFQCNQTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPNEFRCSNSCIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEMECSLFTFLSFRLNKKIP*************QALLTGNENFDLWVAGFCADALKP***********************
MLLLRKHEVYHKVLDVPRTQARQKVSCNSSRPIFQCNQTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPNEFRCSNSCIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEMECSLFTFLSFRLNKKIPRKSISMTSAKMNQQALLTGNENFDLWVAGFCADALKPSRNFTK****L*****KS*****
MLLLRKHEVYHKVLDVPRT*********SSRPIFQCNQTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPNEFRCSNSCIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEMECSLFTFLSFRLNKKIPRKSISMTSAKMNQQALLTGNENFDLWVAGFCADALKPSRNFTKHPRALFPLPHKSPVPCS
MLLLRKHEVYHKVLDVPRTQARQKVSCNSSRPIFQCNQTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPNEFRCSNSCIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEMECSLFTFLSFRLNKKIPRKSISMTSAKMNQQALLTGNENFDLWVAGFCADALKPSRNFTKHPRALFPLPHKSP**C*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLLRKHEVYHKVLDVPRTQARQKVSCNSSRPIFQCNQTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPNEFRCSNSCIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEMECSLFTFLSFRLNKKIPRKSISMTSAKMNQQALLTGNENFDLWVAGFCADALKPSRNFTKHPRALFPLPHKSPVPCS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query227 2.2.26 [Sep-21-2011]
P46023 1115 G-protein coupled recepto N/A N/A 0.488 0.099 0.460 8e-23
P98165 863 Very low-density lipoprot yes N/A 0.497 0.130 0.391 1e-15
P35953 873 Very low-density lipoprot yes N/A 0.497 0.129 0.391 1e-13
P20063 837 Low-density lipoprotein r no N/A 0.537 0.145 0.368 2e-13
P98166 873 Very low-density lipoprot yes N/A 0.497 0.129 0.366 5e-13
P98155 873 Very low-density lipoprot yes N/A 0.497 0.129 0.375 6e-13
Q98931 917 Low-density lipoprotein r no N/A 0.488 0.121 0.381 8e-13
P98156 873 Very low-density lipoprot yes N/A 0.497 0.129 0.366 1e-12
P98160 4391 Basement membrane-specifi no N/A 0.550 0.028 0.358 2e-12
P35952 879 Low-density lipoprotein r no N/A 0.497 0.128 0.357 2e-12
>sp|P46023|GR101_LYMST G-protein coupled receptor GRL101 OS=Lymnaea stagnalis PE=2 SV=1 Back     alignment and function desciption
 Score =  107 bits (266), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 77/128 (60%), Gaps = 17/128 (13%)

Query: 29  SSRPIFQCN--QTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPNEFR 86
           S    F C+    QC+L  S C+G+ +C NG DESV  CG             CL +EF+
Sbjct: 39  SVEGTFHCDDGMLQCVLMGSKCDGVSDCENGMDESVETCG-------------CLQSEFQ 85

Query: 87  CSNS-CIDHLKRCDRTQDCELGEDEIDCKTYMCPV-SHYKCSNDFCIPLDKVCNFIDDCG 144
           C+++ CID + RCDR  DC  G DE +C  Y+CP+ +H K  N FC+P DK C+F+DDCG
Sbjct: 86  CNHTTCIDKILRCDRNDDCSNGLDERECDIYICPLGTHVKWHNHFCVPRDKQCDFLDDCG 145

Query: 145 DNSDEMEC 152
           DNSDE  C
Sbjct: 146 DNSDEKIC 153




Might directly transduce signals carried by large extracellular (lipo)protein(complexe)s into neuronal events.
Lymnaea stagnalis (taxid: 6523)
>sp|P98165|VLDLR_CHICK Very low-density lipoprotein receptor OS=Gallus gallus GN=VLDLR PE=1 SV=1 Back     alignment and function description
>sp|P35953|VLDLR_RABIT Very low-density lipoprotein receptor OS=Oryctolagus cuniculus GN=VLDLR PE=2 SV=1 Back     alignment and function description
>sp|P20063|LDLR_RABIT Low-density lipoprotein receptor (Fragment) OS=Oryctolagus cuniculus GN=LDLR PE=2 SV=1 Back     alignment and function description
>sp|P98166|VLDLR_RAT Very low-density lipoprotein receptor OS=Rattus norvegicus GN=Vldlr PE=2 SV=1 Back     alignment and function description
>sp|P98155|VLDLR_HUMAN Very low-density lipoprotein receptor OS=Homo sapiens GN=VLDLR PE=1 SV=1 Back     alignment and function description
>sp|Q98931|LRP8_CHICK Low-density lipoprotein receptor-related protein 8 OS=Gallus gallus GN=LRP8 PE=1 SV=1 Back     alignment and function description
>sp|P98156|VLDLR_MOUSE Very low-density lipoprotein receptor OS=Mus musculus GN=Vldlr PE=1 SV=1 Back     alignment and function description
>sp|P98160|PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens GN=HSPG2 PE=1 SV=4 Back     alignment and function description
>sp|P35952|LDLR_RAT Low-density lipoprotein receptor OS=Rattus norvegicus GN=Ldlr PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query227
1169995 1115 RecName: Full=G-protein coupled receptor 0.488 0.099 0.460 5e-21
443690449 1080 hypothetical protein CAPTEDRAFT_92610 [C 0.550 0.115 0.408 9e-20
405972283 585 hypothetical protein CGI_10018795 [Crass 0.334 0.129 0.558 8e-16
331702865 844 vitellogenin receptor [Dicentrarchus lab 0.484 0.130 0.398 8e-15
169646705 866 very low-density lipoprotein receptor pr 0.484 0.127 0.398 4e-14
270016386 1751 hypothetical protein TcasGA2_TC004260 [T 0.559 0.072 0.359 5e-14
37728099 844 vitellogenin receptor [Morone americana] 0.484 0.130 0.398 6e-14
91094565 1731 PREDICTED: similar to low-density lipopr 0.559 0.073 0.359 6e-14
348505126 844 PREDICTED: very low-density lipoprotein 0.484 0.130 0.390 7e-14
45382563 863 very low-density lipoprotein receptor pr 0.497 0.130 0.391 7e-14
>gi|1169995|sp|P46023.1|GR101_LYMST RecName: Full=G-protein coupled receptor GRL101; Flags: Precursor gi|438129|emb|CAA80651.1| G protein-coupled receptor [Lymnaea stagnalis] Back     alignment and taxonomy information
 Score =  107 bits (266), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 77/128 (60%), Gaps = 17/128 (13%)

Query: 29  SSRPIFQCN--QTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPNEFR 86
           S    F C+    QC+L  S C+G+ +C NG DESV  CG             CL +EF+
Sbjct: 39  SVEGTFHCDDGMLQCVLMGSKCDGVSDCENGMDESVETCG-------------CLQSEFQ 85

Query: 87  CSNS-CIDHLKRCDRTQDCELGEDEIDCKTYMCPV-SHYKCSNDFCIPLDKVCNFIDDCG 144
           C+++ CID + RCDR  DC  G DE +C  Y+CP+ +H K  N FC+P DK C+F+DDCG
Sbjct: 86  CNHTTCIDKILRCDRNDDCSNGLDERECDIYICPLGTHVKWHNHFCVPRDKQCDFLDDCG 145

Query: 145 DNSDEMEC 152
           DNSDE  C
Sbjct: 146 DNSDEKIC 153




Source: Lymnaea stagnalis

Species: Lymnaea stagnalis

Genus: Lymnaea

Family: Lymnaeidae

Order:

Class: Gastropoda

Phylum: Mollusca

Superkingdom: Eukaryota

>gi|443690449|gb|ELT92587.1| hypothetical protein CAPTEDRAFT_92610 [Capitella teleta] Back     alignment and taxonomy information
>gi|405972283|gb|EKC37059.1| hypothetical protein CGI_10018795 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|331702865|emb|CBX54721.1| vitellogenin receptor [Dicentrarchus labrax] Back     alignment and taxonomy information
>gi|169646705|ref|NP_957217.2| very low-density lipoprotein receptor precursor [Danio rerio] Back     alignment and taxonomy information
>gi|270016386|gb|EFA12832.1| hypothetical protein TcasGA2_TC004260 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|37728099|gb|AAO92396.1| vitellogenin receptor [Morone americana] Back     alignment and taxonomy information
>gi|91094565|ref|XP_967627.1| PREDICTED: similar to low-density lipoprotein receptor (ldl), partial [Tribolium castaneum] Back     alignment and taxonomy information
>gi|348505126|ref|XP_003440112.1| PREDICTED: very low-density lipoprotein receptor [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|45382563|ref|NP_990560.1| very low-density lipoprotein receptor precursor [Gallus gallus] gi|1730110|sp|P98165.1|VLDLR_CHICK RecName: Full=Very low-density lipoprotein receptor; Short=VLDL receptor; Short=VLDL-R; AltName: Full=Vitellogenin receptor; Short=VTG receptor; Flags: Precursor gi|609266|emb|CAA56505.1| chicken very low density lipoprotein (VLDL)/vitellogenin receptor [Gallus gallus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query227
UNIPROTKB|P98165 863 VLDLR "Very low-density lipopr 0.533 0.140 0.384 2.7e-19
UNIPROTKB|F1NC45 865 VLDLR "Very low-density lipopr 0.533 0.139 0.384 2.7e-19
ZFIN|ZDB-GENE-040426-803 866 vldlr "very low density lipopr 0.484 0.127 0.406 5.7e-19
UNIPROTKB|Q6X0I2 1782 VgR "Vitellogenin receptor" [S 0.528 0.067 0.389 6.6e-18
UNIPROTKB|F1LZE5 1074 Lrp1b "Protein Lrp1b" [Rattus 0.511 0.108 0.417 1.5e-17
FB|FBgn0261260 4769 mgl "Megalin" [Drosophila mela 0.506 0.024 0.383 2e-17
UNIPROTKB|F1MIQ2 844 VLDLR "Uncharacterized protein 0.533 0.143 0.369 2.8e-17
UNIPROTKB|F1P787 845 VLDLR "Uncharacterized protein 0.533 0.143 0.369 2.8e-17
UNIPROTKB|F1P783 873 VLDLR "Uncharacterized protein 0.533 0.138 0.369 3e-17
UNIPROTKB|P98155 873 VLDLR "Very low-density lipopr 0.533 0.138 0.369 3.8e-17
UNIPROTKB|P98165 VLDLR "Very low-density lipoprotein receptor" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 242 (90.2 bits), Expect = 2.7e-19, P = 2.7e-19
 Identities = 50/130 (38%), Positives = 68/130 (52%)

Query:    24 KVSCNSSRPIFQCNQTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPN 83
             K +C  S   F CN  QC+     C+G P+C +G DES  +C   ++R    N + C P 
Sbjct:    87 KKTCAESD--FVCNSGQCVPNRWQCDGDPDCEDGSDESAELC---HMRTCRVNEISCGPQ 141

Query:    84 EFRCSNSCIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDC 143
                 S  CI    +CD  +DC+ GEDE +C    C  + + CS+  CI    VCN  DDC
Sbjct:   142 ----STQCIPVSWKCDGEKDCDSGEDEENCGNVTCSAAEFTCSSGQCISKSFVCNGQDDC 197

Query:   144 GDNSDEMECS 153
              D SDE+EC+
Sbjct:   198 SDGSDELECA 207


GO:0005509 "calcium ion binding" evidence=IEA
GO:0006869 "lipid transport" evidence=IEA
GO:0008203 "cholesterol metabolic process" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0034361 "very-low-density lipoprotein particle" evidence=IEA
GO:0005905 "coated pit" evidence=IEA
GO:0021517 "ventral spinal cord development" evidence=IEP
GO:0034185 "apolipoprotein binding" evidence=IPI
GO:0030228 "lipoprotein particle receptor activity" evidence=IC
UNIPROTKB|F1NC45 VLDLR "Very low-density lipoprotein receptor" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-803 vldlr "very low density lipoprotein receptor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q6X0I2 VgR "Vitellogenin receptor" [Solenopsis invicta (taxid:13686)] Back     alignment and assigned GO terms
UNIPROTKB|F1LZE5 Lrp1b "Protein Lrp1b" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0261260 mgl "Megalin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MIQ2 VLDLR "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P787 VLDLR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P783 VLDLR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P98155 VLDLR "Very low-density lipoprotein receptor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 4e-09
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 4e-07
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 4e-07
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 3e-06
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 1e-04
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 1e-04
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
 Score = 50.3 bits (121), Expect = 4e-09
 Identities = 18/35 (51%), Positives = 23/35 (65%)

Query: 118 CPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEMEC 152
           CP + ++C+N  CIP   VC+  DDCGD SDE  C
Sbjct: 1   CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35


Length = 35

>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 227
KOG1215|consensus 877 99.08
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 99.08
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 99.04
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 99.02
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 99.01
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 98.82
smart0019233 LDLa Low-density lipoprotein receptor domain class 98.79
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 98.73
smart0019233 LDLa Low-density lipoprotein receptor domain class 98.73
KOG1215|consensus 877 98.48
KOG2397|consensus 480 97.37
KOG2397|consensus 480 97.22
KOG3509|consensus 964 95.8
KOG3509|consensus 964 93.05
>KOG1215|consensus Back     alignment and domain information
Probab=99.08  E-value=2.1e-10  Score=115.69  Aligned_cols=152  Identities=25%  Similarity=0.453  Sum_probs=111.8

Q ss_pred             eeecCCCCCCCcCC----CccCCCCCCceecC--CCceEeCCCccCCCCCCCCCCCCCCCCCCCCcccCCC---------
Q psy17376         10 YHKVLDVPRTQARQ----KVSCNSSRPIFQCN--QTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLL---------   74 (227)
Q Consensus        10 cdg~~dc~~~~d~~----~~~C~~~~~~F~C~--~g~CI~~~~~CDg~~DC~DgSDE~~~~C~~~~~~~~~---------   74 (227)
                      ..+....+.+.++.    ...|.  ..+|.|.  +++||+..|+|||..+|.+|+||  .+|.........         
T Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~c~~~~~~Cip~~~~cd~~~~C~dg~de--~~~~~~~~~~~~~~~~~~~~~  192 (877)
T KOG1215|consen  117 PSSQPLAPDPCAESGNGPCSHCC--LDKFSCRTGSCKCIPGDWLCDGEADCPDGSDE--LNCAVRRCEPRGASLDCIVAI  192 (877)
T ss_pred             cCCCCCCCCcccccCCCCCcccc--CCCCCCcCccccCCCCceeCCCCCccccchhh--hcccccccCccccccccceee
Confidence            33444455555553    23333  6889999  78999999999999999999999  677411100000         


Q ss_pred             -----------------CCCCCC---CCCceecC--CceecCCCccCCcccCCCCCcc--cCCCCCCcCCCceecCCCce
Q psy17376         75 -----------------PNPLGC---LPNEFRCS--NSCIDHLKRCDRTQDCELGEDE--IDCKTYMCPVSHYKCSNDFC  130 (227)
Q Consensus        75 -----------------~~~~~C---~~~~f~C~--~~Ci~~~~~CDG~~DC~dgsDE--~~C~~~~C~~~~f~C~~g~C  130 (227)
                                       .....+   ....++|.  .+||...++|||..||.+++||  .++....|...++.|.++.|
T Consensus       193 ~~~d~~~~~~~~~d~~~~~~~~~~~~~~~~~~c~g~~~~i~~~~~~Dg~~dc~~~~de~~~~~~~~~~~~~e~~~~~~~~  272 (877)
T KOG1215|consen  193 KVCDIQHDCADDYDESEGRIYWTDDSRIEVTRCDGSSRCILISEVCDGPRDCVDGPDEGVMNCSDATCEAPEIECADGDC  272 (877)
T ss_pred             eecCcccccccccccccCcccccCCcceeEEEecCCCcEEeehhccCCCcccccCCcCceeEeeccccCCcceeecCCCC
Confidence                             000001   13567887  4999999999999999999999  46766678888999999999


Q ss_pred             ecCCcccCCCCCCCCCCCCCCCCCCCc--CceecCCC
Q psy17376        131 IPLDKVCNFIDDCGDNSDEMECSLFTF--LSFRLNKK  165 (227)
Q Consensus       131 i~~~~~CDg~~DC~DgsDE~~C~~~~C--~~f~C~~~  165 (227)
                      ++..++|+|..||++|+||.+|....+  ..|.|..+
T Consensus       273 ~~~~~~~~g~~d~pdg~de~~~~~~~~~~~~~d~~~~  309 (877)
T KOG1215|consen  273 SDRQKLCDGDLDCPDGLDEDYCKKKLYWSMNVDGSGR  309 (877)
T ss_pred             ccceEEecCccCCCCcccccccccceeeeeecccCCc
Confidence            999999999999999999998875433  45555543



>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information
>KOG2397|consensus Back     alignment and domain information
>KOG2397|consensus Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
3m0c_C 791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 5e-12
1n7d_A 699 Extracellular Domain Of The Ldl Receptor Length = 6 9e-12
2fyj_A82 Nmr Solution Structure Of Calcium-Loaded Lrp Double 2e-05
2fcw_B80 Structure Of A Complex Between The Pair Of The Ldl 9e-05
1f5y_A85 Nmr Structure Of A Concatemer Of The First And Seco 1e-04
2lgp_A94 Solution Structure Of La45 From Ldlr Length = 94 3e-04
2xrc_A 565 Human Complement Factor I Length = 565 5e-04
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure

Iteration: 1

Score = 67.8 bits (164), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 44/129 (34%), Positives = 56/129 (43%), Gaps = 13/129 (10%) Query: 31 RPIFQCNQTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPNEFRCS-- 88 R FQC +CI +C+G EC +G DES C + C +F C Sbjct: 26 RNEFQCQDGKCISYKWVCDGSAECQDGSDESQETC----------LSVTCKSGDFSCGGR 75 Query: 89 -NSCIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDCGDNS 147 N CI RCD DC+ G DE C C ++C + CI VC+ DC D S Sbjct: 76 VNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGS 135 Query: 148 DEMECSLFT 156 DE C + T Sbjct: 136 DEASCPVLT 144
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|2FYJ|A Chain A, Nmr Solution Structure Of Calcium-Loaded Lrp Double Module Length = 82 Back     alignment and structure
>pdb|2FCW|B Chain B, Structure Of A Complex Between The Pair Of The Ldl Receptor Ligand-Binding Modules 3-4 And The Receptor Associated Protein (Rap) Length = 80 Back     alignment and structure
>pdb|1F5Y|A Chain A, Nmr Structure Of A Concatemer Of The First And Second Ligand-Binding Modules Of The Human Ldl Receptor Length = 85 Back     alignment and structure
>pdb|2LGP|A Chain A, Solution Structure Of La45 From Ldlr Length = 94 Back     alignment and structure
>pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 4e-23
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 4e-22
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 1e-18
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 1e-17
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 2e-17
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 3e-11
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 4e-07
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 4e-05
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 2e-22
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 9e-22
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 4e-18
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 2e-17
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 4e-16
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 5e-14
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 6e-11
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 1e-06
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 5e-21
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 2e-12
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 3e-08
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 8e-04
2fyj_A82 Low-density lipoprotein receptor-related protein 1 2e-20
2fyj_A82 Low-density lipoprotein receptor-related protein 1 6e-13
2xrc_A 565 Human complement factor I; immune system, hydrolas 1e-14
2xrc_A 565 Human complement factor I; immune system, hydrolas 4e-10
2xrc_A 565 Human complement factor I; immune system, hydrolas 4e-06
3a7q_B44 Low-density lipoprotein receptor-related protein; 1e-08
3a7q_B44 Low-density lipoprotein receptor-related protein; 6e-06
1j8e_A44 Low-density lipoprotein receptor-related protein 1 3e-08
1j8e_A44 Low-density lipoprotein receptor-related protein 1 4e-05
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 4e-08
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 1e-07
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 5e-08
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 3e-05
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 4e-04
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 9e-08
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 2e-06
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 5e-07
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 3e-05
2i1p_A48 Low-density lipoprotein receptor-related protein 2 1e-06
2i1p_A48 Low-density lipoprotein receptor-related protein 2 2e-06
2knx_A50 Prolow-density lipoprotein receptor-related prote; 2e-06
2knx_A50 Prolow-density lipoprotein receptor-related prote; 3e-05
1cr8_A42 Protein (LOW density lipoprotein receptor related 2e-06
1cr8_A42 Protein (LOW density lipoprotein receptor related 8e-06
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 5e-06
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 1e-05
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 3e-05
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 3e-04
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 3e-05
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 4e-05
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 3e-05
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 8e-05
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 7e-05
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
 Score = 96.1 bits (238), Expect = 4e-23
 Identities = 42/126 (33%), Positives = 54/126 (42%), Gaps = 13/126 (10%)

Query: 34  FQCNQTQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPNPLGCLPNEFRCSNS--- 90
           FQC   +CI    +C+G  EC +G DES   C            + C   +F C      
Sbjct: 29  FQCQDGKCISYKWVCDGSAECQDGSDESQETC----------LSVTCKSGDFSCGGRVNR 78

Query: 91  CIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEM 150
           CI    RCD   DC+ G DE  C    C    ++C +  CI    VC+   DC D SDE 
Sbjct: 79  CIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEA 138

Query: 151 ECSLFT 156
            C + T
Sbjct: 139 SCPVLT 144


>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query227
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 100.0
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 100.0
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 99.97
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 99.96
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.87
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.84
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.84
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.83
2xrc_A 565 Human complement factor I; immune system, hydrolas 99.55
2xrc_A 565 Human complement factor I; immune system, hydrolas 99.4
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 99.37
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 99.16
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 99.15
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 99.12
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 99.11
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 99.09
1cr8_A42 Protein (LOW density lipoprotein receptor related 99.08
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 99.07
3a7q_B44 Low-density lipoprotein receptor-related protein; 99.07
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 99.06
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 99.05
3a7q_B44 Low-density lipoprotein receptor-related protein; 99.04
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 99.03
1cr8_A42 Protein (LOW density lipoprotein receptor related 99.03
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 99.01
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 99.01
2m0p_A52 Low-density lipoprotein receptor-related protein; 99.0
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.99
2m0p_A52 Low-density lipoprotein receptor-related protein; 98.98
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 98.98
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 98.98
2knx_A50 Prolow-density lipoprotein receptor-related prote; 98.93
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 98.93
2knx_A50 Prolow-density lipoprotein receptor-related prote; 98.93
1j8e_A44 Low-density lipoprotein receptor-related protein 1 98.92
1j8e_A44 Low-density lipoprotein receptor-related protein 1 98.88
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.86
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 98.83
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 98.63
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 98.6
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 98.43
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 98.32
3ojy_B 537 Complement component C8 beta chain; macpf, lipocal 98.08
3ojy_A 554 Complement component C8 alpha chain; macpf, lipoca 97.98
3ojy_B 537 Complement component C8 beta chain; macpf, lipocal 97.9
3ojy_A 554 Complement component C8 alpha chain; macpf, lipoca 97.71
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 97.29
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 96.71
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
Probab=100.00  E-value=8.8e-35  Score=283.19  Aligned_cols=193  Identities=24%  Similarity=0.426  Sum_probs=134.1

Q ss_pred             eeeccCCceeecCCCCCCCcCCCccCC---CCCCceecCC--CceEeCCCccCCCCCCCCCCCCCCCCCCCCcccCCCCC
Q psy17376          2 LLLRKHEVYHKVLDVPRTQARQKVSCN---SSRPIFQCNQ--TQCILETSLCNGIPECGNGRDESVAMCGEYNIRDLLPN   76 (227)
Q Consensus         2 ~cl~~~~~cdg~~dc~~~~d~~~~~C~---~~~~~F~C~~--g~CI~~~~~CDg~~DC~DgSDE~~~~C~~~~~~~~~~~   76 (227)
                      .||+...+|||+.||.+++||....|.   +...+|+|.+  ++|||..|+|||..||.|||||  .+|.          
T Consensus        17 ~ci~~~~~Cdg~~dC~d~sDE~~~~C~~~~C~~~~f~C~~~~~~Ci~~~~~Cdg~~dC~dgsDE--~~C~----------   84 (699)
T 1n7d_A           17 KCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDE--QGCP----------   84 (699)
T ss_dssp             ---------------------------CCSCSSSSCCCCC--CCCCCSSSTTSSSCCC-CCCTT--TSCS----------
T ss_pred             cEEcHHhcCCCcccCCCCCCCCccccCCcCCCCCccCCCCCCCceeCcceecCCcccCCCCccc--Cccc----------
Confidence            489999999999999999999875552   3479999997  4899999999999999999999  8997          


Q ss_pred             CCCCCCCceecC-CceecCCCccCCcccCCCCCcccCCCCCCcCCCceecCCCceecCCcccCCCCCCCCCCCC--CCCC
Q psy17376         77 PLGCLPNEFRCS-NSCIDHLKRCDRTQDCELGEDEIDCKTYMCPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDE--MECS  153 (227)
Q Consensus        77 ~~~C~~~~f~C~-~~Ci~~~~~CDG~~DC~dgsDE~~C~~~~C~~~~f~C~~g~Ci~~~~~CDg~~DC~DgsDE--~~C~  153 (227)
                      ...|.+.+|+|. ++||+..|+|||+.||.|||||.+|....|++.+|+|.+|+||+..|+|||+.||.|||||  .+|.
T Consensus        85 ~~~C~~~~f~C~~g~Ci~~~~~Cdg~~dC~dgsDE~~C~~~~C~~~~f~C~~~~Ci~~~~~Cdg~~dC~dgsDE~~~~C~  164 (699)
T 1n7d_A           85 PKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCR  164 (699)
T ss_dssp             SCCCCSSCCCSSCC----CCCTTCSSCCSSSSCSSSSCCCCCCCSSCCCCSSSCCCCTTSTTCSSCCSSSSSSSSCSSSS
T ss_pred             ccccccCcEEcCCCCEecHHHcCCCcCcCCCCCccCCcCccccCccccCCCCCcccchhcccCCCCcCCCCcccccccCC
Confidence            457999999999 9999999999999999999999999888899999999999999999999999999999999  8995


Q ss_pred             C--------CCc--CceecCCC--CCCCeeeccccCCcchhhccCCCCCCccccCCCccccCCCCCCCCCCCCccCCCCC
Q psy17376        154 L--------FTF--LSFRLNKK--IPRKSISMTSAKMNQQALLTGNENFDLWVAGFCADALKPSRNFTKHPRALFPLPHK  221 (227)
Q Consensus       154 ~--------~~C--~~f~C~~~--~~~~~~~~~~~~~~~~~~~~g~~~~~~w~c~~~~De~~~~~~~~~cp~~~f~cp~~  221 (227)
                      .        ..|  .+|+|.++  |+..|+|++                 ...|.+++||.+-.  ...|+.+.|.|.+|
T Consensus       165 ~~~~~~~~~~~C~~~~f~C~~g~Ci~~~~~CDg-----------------~~dC~dgsDE~~C~--~~~C~~~~f~C~~g  225 (699)
T 1n7d_A          165 GLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDG-----------------GPDCKDKSDEENCA--VATCRPDEFQCSDG  225 (699)
T ss_dssp             CCCCCSSCCCCSCSSSCCCSSSCCCSTTCTTSS-----------------SCCSTTSCSSCSCC--CCCCCSSEEESSSS
T ss_pred             CcccccCCCCCCCCcceecCCCceEechhccCC-----------------CCCCCCCcccccCC--CcccCCCcEecCCC
Confidence            3        368  78999875  444444433                 22356777777621  24677777777777


Q ss_pred             CCCC
Q psy17376        222 SPVP  225 (227)
Q Consensus       222 ~~~~  225 (227)
                      .+||
T Consensus       226 ~Ci~  229 (699)
T 1n7d_A          226 NCIH  229 (699)
T ss_dssp             CEEE
T ss_pred             ceee
Confidence            7766



>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 227
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-08
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-06
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-08
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-05
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-08
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-05
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 0.001
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 4e-08
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 7e-06
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 0.004
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 6e-08
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 7e-05
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 6e-04
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-08
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-05
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 8e-05
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 2e-07
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 1e-04
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 1e-04
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 1e-06
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 6e-05
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-06
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-06
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-06
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 3e-05
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 0.001
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 4e-06
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 4e-05
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 5e-06
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 4e-05
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 1e-05
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 4e-05
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 3e-05
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 0.001
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 6e-05
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 0.002
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: LDL receptor-like module
superfamily: LDL receptor-like module
family: LDL receptor-like module
domain: Ligand-binding domain of low-density lipoprotein receptor
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 46.6 bits (111), Expect = 2e-08
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 118 CPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEMEC 152
           C    ++CS+  CI   + C+   DC D SDE+ C
Sbjct: 3   CRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGC 37


>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query227
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 99.22
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 99.21
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 99.18
d1xfea244 Ligand-binding domain of low-density lipoprotein r 99.18
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 99.15
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 99.15
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 99.14
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 99.14
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 99.13
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 99.11
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 99.11
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 99.11
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 99.1
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 99.1
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 99.08
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 99.04
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 99.04
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 99.03
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 99.01
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 99.0
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 99.0
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 99.0
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 98.99
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.98
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.98
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.96
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.91
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.85
d1xfea244 Ligand-binding domain of low-density lipoprotein r 98.83
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.82
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: LDL receptor-like module
superfamily: LDL receptor-like module
family: LDL receptor-like module
domain: Ligand-binding domain of low-density lipoprotein receptor
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.22  E-value=2.7e-12  Score=77.84  Aligned_cols=36  Identities=33%  Similarity=0.695  Sum_probs=27.8

Q ss_pred             cCCCceecCCCceecCCcccCCCCCCCCCCCCCCCC
Q psy17376        118 CPVSHYKCSNDFCIPLDKVCNFIDDCGDNSDEMECS  153 (227)
Q Consensus       118 C~~~~f~C~~g~Ci~~~~~CDg~~DC~DgsDE~~C~  153 (227)
                      |++++|+|.+|+||+..++|||+.||.|||||.+|+
T Consensus         2 C~~~~f~C~~g~Ci~~~~~CDg~~DC~dgsDE~~Cs   37 (37)
T d1ajja_           2 CSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCA   37 (37)
T ss_dssp             CCTTCEECTTSCEECGGGTTSSSCCSTTCGGGTTCC
T ss_pred             CCCCceEcCCCCEECchhcCCCCCcCCCCchhhccC
Confidence            566778887777888888888888888888887764



>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure