Psyllid ID: psy17412


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MSIPLQSPLLNLLPTFFLFLMNDFMRSVEIDAMRRFEERKARQDIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHSLGQREEAKEYVRQLVEKYPTRRKLAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHNLGQREEAKEYIRELVEKYPTRRKLVENYTQAFEQE
ccccccHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHccc
cccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHccHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcc
msiplqspllnllPTFFLFLMNDFMRSVEIDAMRRFEERKARQDIADHFKAngnkafqsGQYEAALVQYDKAIEqvrdspvlyTNRALTLLHLQLydpvlpdcdkaLRLDEDNMKAHLYKARAMHSLGQREEAKEYVRQLVEKYPTRRKLAIeqvrdspvlytNRALTLLHLQLydpvlpdcdkaLRLDEDNMKAHLYKARAMHNLGQREEAKEYIRELVEKYPTRRKLVENYTQAFEQE
msiplqspllnLLPTFFLFLMNDFMRSVEIDAMRRFEERKARQDIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARamhslgqreeAKEYVRQLVEkyptrrklaieqvrdspvlYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKAramhnlgqreeAKEYIRELVekyptrrklvENYTQAFEQE
MSIPLQSpllnllptfflflMNDFMRSVEIDAMRRFEERKARQDIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHSLGQREEAKEYVRQLVEKYPTRRKLAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHNLGQREEAKEYIRELVEKYPTRRKLVENYTQAFEQE
********LLNLLPTFFLFLMNDFMRSVEIDAMRRF********IADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAM*********KEYVRQLVEKYPTRRKLAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHNL******KEYIRELVEKYPTR**L***********
MSIPLQSPLLNLLPTFFLFLMNDFMRSVEIDAMRRFEERKARQDIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHSLGQREEAKEYVRQLVEKYPTRRKLAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHNLGQREEAKEYIRELVEKYPTRRKLVENYTQAFEQ*
MSIPLQSPLLNLLPTFFLFLMNDFMRSVEIDAMRRFEERKARQDIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHSLGQREEAKEYVRQLVEKYPTRRKLAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHNLGQREEAKEYIRELVEKYPTRRKLVENYTQAFEQE
*SIPLQSPLLNLLPTFFLFLMNDFMRSVEIDAMRRFEERKARQDIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHSLGQREEAKEYVRQLVEKYPTRRKLAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHNLGQREEAKEYIRELVEKYPTRRKLVENYTQAFEQE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIPLQSPLLNLLPTFFLFLMNDFMRSVEIDAMRRFEERKARQDIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHSLGQREEAKEYVRQLVEKYPTRRKLAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHNLGQREEAKEYIRELVEKYPTRRKLVENYTQAFEQE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query240 2.2.26 [Sep-21-2011]
Q95LY5 577 Tetratricopeptide repeat N/A N/A 0.508 0.211 0.377 9e-18
Q9H892 705 Tetratricopeptide repeat yes N/A 0.508 0.173 0.368 2e-17
Q8BW49 704 Tetratricopeptide repeat yes N/A 0.508 0.173 0.385 9e-17
Q54DA8 564 Protein STIP1 homolog OS= yes N/A 0.204 0.086 0.361 3e-10
Q80ZX8 901 Sperm-associated antigen no N/A 0.437 0.116 0.339 4e-09
O13754358 Hsp70/Hsp90 co-chaperone yes N/A 0.533 0.357 0.321 1e-08
Q5ZHY5314 STIP1 homology and U box- yes N/A 0.366 0.280 0.363 5e-08
Q5U2X2 893 Sperm-associated antigen no N/A 0.416 0.111 0.336 6e-08
Q9SIN1691 Inactive TPR repeat-conta yes N/A 0.362 0.125 0.352 1e-07
Q54VG4334 Small glutamine-rich tetr no N/A 0.475 0.341 0.310 2e-07
>sp|Q95LY5|TTC12_MACFA Tetratricopeptide repeat protein 12 (Fragment) OS=Macaca fascicularis GN=TTC12 PE=2 SV=1 Back     alignment and function desciption
 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 73/122 (59%)

Query: 24  FMRSVEIDAMRRFEERKARQDIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLY 83
           F+ SVE DA  R + R+  + +AD  K  GN+AF  G YE A++ Y + +E+++D  VLY
Sbjct: 84  FLASVEKDAKERAKRRRENKVLADALKDKGNEAFAEGNYETAILHYSEGLEKLKDVKVLY 143

Query: 84  TNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHSLGQREEAKEYVRQLVEK 143
           TNRA   + L+ Y+  L DC+ AL+ DE   KA+ +  RA  +L     ++E  ++++E 
Sbjct: 144 TNRAQAYMKLKNYEKALVDCEWALKCDEKCTKAYFHMGRANLALKNYSVSRECYKKILEI 203

Query: 144 YP 145
            P
Sbjct: 204 NP 205





Macaca fascicularis (taxid: 9541)
>sp|Q9H892|TTC12_HUMAN Tetratricopeptide repeat protein 12 OS=Homo sapiens GN=TTC12 PE=2 SV=2 Back     alignment and function description
>sp|Q8BW49|TTC12_MOUSE Tetratricopeptide repeat protein 12 OS=Mus musculus GN=Ttc12 PE=2 SV=1 Back     alignment and function description
>sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 Back     alignment and function description
>sp|Q80ZX8|SPAG1_MOUSE Sperm-associated antigen 1 OS=Mus musculus GN=Spag1 PE=1 SV=1 Back     alignment and function description
>sp|O13754|CNS1_SCHPO Hsp70/Hsp90 co-chaperone cns1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cns1 PE=3 SV=1 Back     alignment and function description
>sp|Q5ZHY5|CHIP_CHICK STIP1 homology and U box-containing protein 1 OS=Gallus gallus GN=STUB1 PE=2 SV=1 Back     alignment and function description
>sp|Q5U2X2|SPAG1_RAT Sperm-associated antigen 1 OS=Rattus norvegicus GN=Spag1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIN1|TTL3_ARATH Inactive TPR repeat-containing thioredoxin TTL3 OS=Arabidopsis thaliana GN=TTL3 PE=1 SV=2 Back     alignment and function description
>sp|Q54VG4|SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum GN=sgt PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
332031373266 Tetratricopeptide repeat protein 12 [Acr 0.591 0.533 0.433 1e-23
242023704272 heat shock protein 70 HSP70 interacting 0.541 0.477 0.429 2e-21
383854814253 PREDICTED: tetratricopeptide repeat prot 0.508 0.482 0.450 2e-21
380021817262 PREDICTED: tetratricopeptide repeat prot 0.508 0.465 0.442 5e-21
156547021267 PREDICTED: tetratricopeptide repeat prot 0.508 0.456 0.442 6e-21
307187791140 Tetratricopeptide repeat protein 12 [Cam 0.508 0.871 0.418 8e-21
328786092263 PREDICTED: tetratricopeptide repeat prot 0.508 0.463 0.434 2e-20
350427887261 PREDICTED: LOW QUALITY PROTEIN: tetratri 0.508 0.467 0.434 1e-19
340728445261 PREDICTED: LOW QUALITY PROTEIN: tetratri 0.508 0.467 0.434 1e-19
270008563258 hypothetical protein TcasGA2_TC015092 [T 0.416 0.387 0.5 2e-19
>gi|332031373|gb|EGI70886.1| Tetratricopeptide repeat protein 12 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  116 bits (290), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 92/143 (64%), Gaps = 1/143 (0%)

Query: 24  FMRSVEIDAMRRFEERKARQDIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLY 83
           FM+SVE DA +R EERK R + A+  K   N AF+ G YE A+  Y KA+EQ +DS VL+
Sbjct: 116 FMKSVEKDAKKRAEERKIRNERAETLKRIANGAFKEGDYEKAVTYYSKALEQRKDSSVLW 175

Query: 84  TNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHSLGQREEAKEYVRQLVEK 143
            NRAL+ ++L+L++  L DC+  L+L + N+KA LY A+    L  RE++KEY+R   EK
Sbjct: 176 NNRALSYMNLELFEKALHDCEWTLKLSDSNLKALLYSAKCYMHLRNREKSKEYIRMAKEK 235

Query: 144 YPTRRKLAIEQVRDSPVLYTNRA 166
            P   K  I++ +++  L  N++
Sbjct: 236 NPHFNKF-IDEFQENIELQFNKS 257




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242023704|ref|XP_002432271.1| heat shock protein 70 HSP70 interacting protein, putative [Pediculus humanus corporis] gi|212517680|gb|EEB19533.1| heat shock protein 70 HSP70 interacting protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383854814|ref|XP_003702915.1| PREDICTED: tetratricopeptide repeat protein 12-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380021817|ref|XP_003694753.1| PREDICTED: tetratricopeptide repeat protein 12-like [Apis florea] Back     alignment and taxonomy information
>gi|156547021|ref|XP_001600918.1| PREDICTED: tetratricopeptide repeat protein 12-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307187791|gb|EFN72757.1| Tetratricopeptide repeat protein 12 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328786092|ref|XP_001122862.2| PREDICTED: tetratricopeptide repeat protein 12-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350427887|ref|XP_003494915.1| PREDICTED: LOW QUALITY PROTEIN: tetratricopeptide repeat protein 12-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340728445|ref|XP_003402535.1| PREDICTED: LOW QUALITY PROTEIN: tetratricopeptide repeat protein 12-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|270008563|gb|EFA05011.1| hypothetical protein TcasGA2_TC015092 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
ZFIN|ZDB-GENE-061013-512 591 spag1b "sperm associated antig 0.475 0.192 0.336 8.3e-19
FB|FBgn0039228250 CG6980 [Drosophila melanogaste 0.508 0.488 0.422 3.6e-18
MGI|MGI:1349387 901 Spag1 "sperm associated antige 0.487 0.129 0.330 1.3e-17
MGI|MGI:2444588 704 Ttc12 "tetratricopeptide repea 0.508 0.173 0.385 1.9e-16
FB|FBgn0024352490 Hop "Hsp70/Hsp90 organizing pr 0.691 0.338 0.292 1.4e-14
FB|FBgn0051294225 CG31294 [Drosophila melanogast 0.454 0.484 0.381 1.4e-14
RGD|1310702 893 Spag1 "sperm associated antige 0.437 0.117 0.330 2.7e-14
UNIPROTKB|Q07617 926 SPAG1 "Sperm-associated antige 0.487 0.126 0.322 4.4e-14
UNIPROTKB|G4MXP4284 MGG_08035 "E3 ubiquitin-protei 0.433 0.366 0.403 5.6e-14
FB|FBgn0085303250 CG34274 [Drosophila melanogast 0.466 0.448 0.359 7.9e-14
ZFIN|ZDB-GENE-061013-512 spag1b "sperm associated antigen 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 165 (63.1 bits), Expect = 8.3e-19, Sum P(3) = 8.3e-19
 Identities = 39/116 (33%), Positives = 67/116 (57%)

Query:    42 RQDIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLP 101
             +Q  A   K  GN+A++S  YE AL  Y +++  +  S  ++ NRA TL+ LQ +   L 
Sbjct:   190 KQTAALREKDKGNEAYRSRDYEEALDYYCRSLS-LASSAAVFNNRAQTLIRLQQWPAALS 248

Query:   102 DCDKALRLDEDNMKAHLYKARAMHSLGQREEAKEYVRQLVEKYPTRRKLAIEQVRD 157
             DCD  L+L+  N+KA L +A     LG ++E+ + +R +++  P + K A++ + D
Sbjct:   249 DCDAVLQLEPHNIKALLRRATVHKHLGHQQESHDDLRAVLQIQP-QNKTALKLLAD 303


GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
FB|FBgn0039228 CG6980 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1349387 Spag1 "sperm associated antigen 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:2444588 Ttc12 "tetratricopeptide repeat domain 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0024352 Hop "Hsp70/Hsp90 organizing protein homolog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0051294 CG31294 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1310702 Spag1 "sperm associated antigen 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q07617 SPAG1 "Sperm-associated antigen 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G4MXP4 MGG_08035 "E3 ubiquitin-protein ligase CHIP" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
FB|FBgn0085303 CG34274 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-12
pfam1341469 pfam13414, TPR_11, TPR repeat 4e-10
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-08
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 1e-07
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-06
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-04
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 2e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 4e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 6e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 0.002
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 61.2 bits (149), Expect = 2e-12
 Identities = 36/94 (38%), Positives = 49/94 (52%)

Query: 53  GNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDED 112
           GN  ++ G Y+ AL  Y+KA+E   D+   Y N A     L  Y+  L D +KAL LD D
Sbjct: 7   GNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKALELDPD 66

Query: 113 NMKAHLYKARAMHSLGQREEAKEYVRQLVEKYPT 146
           N KA+     A + LG+ EEA E   + +E  P 
Sbjct: 67  NAKAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100


Length = 100

>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 240
KOG4626|consensus 966 99.96
KOG4626|consensus 966 99.96
KOG1126|consensus638 99.94
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.94
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.93
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.92
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.92
PRK11189296 lipoprotein NlpI; Provisional 99.92
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.91
PRK12370553 invasion protein regulator; Provisional 99.91
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.91
KOG1155|consensus559 99.9
KOG1126|consensus638 99.9
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.9
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.89
PRK12370553 invasion protein regulator; Provisional 99.89
KOG1155|consensus559 99.88
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.88
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.88
KOG0547|consensus606 99.88
KOG1125|consensus579 99.88
KOG0547|consensus606 99.88
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.88
KOG1173|consensus611 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
KOG1125|consensus579 99.87
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.87
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.87
KOG0548|consensus539 99.86
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.86
KOG0624|consensus 504 99.85
PLN02789320 farnesyltranstransferase 99.85
PLN02789320 farnesyltranstransferase 99.85
PRK15359144 type III secretion system chaperone protein SscB; 99.84
KOG1129|consensus478 99.84
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.83
PRK15359144 type III secretion system chaperone protein SscB; 99.83
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.83
KOG2002|consensus 1018 99.83
KOG2076|consensus 895 99.82
PRK10370198 formate-dependent nitrite reductase complex subuni 99.82
KOG1129|consensus478 99.8
PRK11189296 lipoprotein NlpI; Provisional 99.8
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.8
PRK14574 822 hmsH outer membrane protein; Provisional 99.79
KOG0553|consensus304 99.78
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 99.78
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.78
KOG2003|consensus 840 99.77
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.77
KOG2002|consensus 1018 99.77
PRK10370198 formate-dependent nitrite reductase complex subuni 99.76
KOG0624|consensus 504 99.76
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.76
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.75
KOG0550|consensus 486 99.75
KOG3060|consensus289 99.75
KOG2003|consensus 840 99.75
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.75
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.74
KOG1173|consensus 611 99.74
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.73
KOG0553|consensus 304 99.73
KOG0495|consensus913 99.73
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.73
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.72
KOG1174|consensus564 99.72
KOG1840|consensus508 99.72
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.71
KOG2076|consensus 895 99.71
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.71
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.7
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.69
KOG1840|consensus508 99.68
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.68
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.67
KOG4162|consensus799 99.67
KOG0495|consensus 913 99.67
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.67
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.66
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.66
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.66
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.65
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.65
KOG0548|consensus539 99.64
KOG3060|consensus289 99.64
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.64
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.63
KOG0550|consensus 486 99.63
KOG4162|consensus799 99.63
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.62
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.61
KOG1156|consensus 700 99.6
KOG1127|consensus 1238 99.59
KOG1174|consensus 564 99.58
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.57
KOG1156|consensus 700 99.56
PRK14574 822 hmsH outer membrane protein; Provisional 99.56
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.54
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.53
KOG1128|consensus 777 99.53
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.53
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.53
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.52
KOG0543|consensus397 99.49
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.49
KOG2376|consensus 652 99.48
KOG1128|consensus 777 99.48
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.48
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.47
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.47
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.47
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.47
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.47
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.47
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.46
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.46
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.46
KOG1127|consensus 1238 99.45
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.45
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.45
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.45
KOG3785|consensus 557 99.45
PRK11906458 transcriptional regulator; Provisional 99.44
KOG0543|consensus397 99.44
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.43
KOG4648|consensus 536 99.43
PRK15331165 chaperone protein SicA; Provisional 99.42
PRK10803263 tol-pal system protein YbgF; Provisional 99.42
COG4105254 ComL DNA uptake lipoprotein [General function pred 99.42
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.41
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.41
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.41
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.4
PRK15331165 chaperone protein SicA; Provisional 99.39
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.39
PRK10803263 tol-pal system protein YbgF; Provisional 99.38
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.38
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.37
KOG4234|consensus271 99.37
KOG4340|consensus 459 99.36
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.33
PLN03218 1060 maturation of RBCL 1; Provisional 99.33
COG1729262 Uncharacterized protein conserved in bacteria [Fun 99.32
PRK11906458 transcriptional regulator; Provisional 99.3
KOG2376|consensus 652 99.3
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.29
KOG4234|consensus271 99.29
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 99.28
KOG1130|consensus 639 99.26
COG1729262 Uncharacterized protein conserved in bacteria [Fun 99.26
PLN03218 1060 maturation of RBCL 1; Provisional 99.26
PF13512142 TPR_18: Tetratricopeptide repeat 99.25
PF12688120 TPR_5: Tetratrico peptide repeat 99.24
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.24
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.23
KOG1070|consensus1710 99.22
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.22
KOG4648|consensus 536 99.22
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.21
PF13512142 TPR_18: Tetratricopeptide repeat 99.21
KOG1915|consensus 677 99.21
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 99.2
PF1337173 TPR_9: Tetratricopeptide repeat 99.18
KOG1130|consensus 639 99.18
KOG3785|consensus 557 99.18
PF12688120 TPR_5: Tetratrico peptide repeat 99.17
COG4105254 ComL DNA uptake lipoprotein [General function pred 99.16
PLN03077 857 Protein ECB2; Provisional 99.15
PF1337173 TPR_9: Tetratricopeptide repeat 99.15
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.14
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.14
PLN03077 857 Protein ECB2; Provisional 99.13
COG4700251 Uncharacterized protein conserved in bacteria cont 99.11
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.11
KOG4555|consensus175 99.1
KOG4642|consensus284 99.09
KOG4340|consensus 459 99.08
KOG3081|consensus299 99.05
KOG3081|consensus299 99.04
KOG1915|consensus 677 99.01
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.98
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.96
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.96
KOG2796|consensus366 98.94
KOG0545|consensus329 98.93
KOG1070|consensus1710 98.91
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.9
KOG1941|consensus 518 98.9
KOG2796|consensus366 98.88
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.88
PRK04841 903 transcriptional regulator MalT; Provisional 98.86
PRK04841 903 transcriptional regulator MalT; Provisional 98.85
KOG0376|consensus 476 98.83
COG4700251 Uncharacterized protein conserved in bacteria cont 98.82
KOG1586|consensus288 98.81
KOG4642|consensus 284 98.8
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.8
KOG4555|consensus175 98.79
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.75
KOG0545|consensus329 98.74
PF1342844 TPR_14: Tetratricopeptide repeat 98.73
KOG0376|consensus 476 98.72
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.72
KOG1585|consensus308 98.69
KOG0551|consensus 390 98.69
COG3118304 Thioredoxin domain-containing protein [Posttransla 98.67
KOG1941|consensus 518 98.67
PF13281374 DUF4071: Domain of unknown function (DUF4071) 98.65
KOG2047|consensus 835 98.62
KOG0551|consensus 390 98.59
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.58
KOG2053|consensus 932 98.58
KOG2053|consensus 932 98.58
KOG2610|consensus 491 98.57
KOG2047|consensus 835 98.55
PF1342844 TPR_14: Tetratricopeptide repeat 98.54
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.5
KOG1308|consensus377 98.49
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.48
KOG1586|consensus288 98.46
PF1343134 TPR_17: Tetratricopeptide repeat 98.46
PF1343134 TPR_17: Tetratricopeptide repeat 98.46
KOG2610|consensus 491 98.45
KOG4507|consensus 886 98.4
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.4
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.39
KOG2471|consensus 696 98.39
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.38
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.37
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.37
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.36
KOG2471|consensus 696 98.35
COG2976207 Uncharacterized protein conserved in bacteria [Fun 98.33
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.22
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.21
COG3118304 Thioredoxin domain-containing protein [Posttransla 98.21
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.21
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.08
KOG1308|consensus 377 98.07
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 98.04
KOG3617|consensus 1416 97.97
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.93
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.92
KOG1585|consensus 308 97.89
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.87
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.87
KOG0530|consensus318 97.84
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.84
KOG1258|consensus577 97.83
KOG3617|consensus 1416 97.8
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.79
KOG2300|consensus 629 97.76
KOG2396|consensus 568 97.76
KOG2300|consensus629 97.76
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.75
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.74
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.73
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.72
PRK10941269 hypothetical protein; Provisional 97.7
KOG1550|consensus 552 97.67
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.66
KOG1914|consensus 656 97.65
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.63
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 97.62
KOG0530|consensus 318 97.62
KOG1550|consensus 552 97.62
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.59
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.57
KOG1310|consensus 758 97.57
PRK10941269 hypothetical protein; Provisional 97.56
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.53
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.51
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.5
KOG0985|consensus 1666 97.46
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.43
KOG1914|consensus 656 97.43
KOG2396|consensus 568 97.41
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.4
KOG1839|consensus1236 97.4
KOG3824|consensus 472 97.36
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.34
KOG4507|consensus 886 97.31
KOG3824|consensus 472 97.28
KOG4814|consensus 872 97.28
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.27
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.25
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.24
KOG1310|consensus 758 97.23
KOG3783|consensus546 97.23
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.22
KOG4814|consensus 872 97.22
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.22
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.2
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.19
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.18
KOG2041|consensus 1189 97.16
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.16
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.14
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.1
KOG3364|consensus149 97.1
COG5191 435 Uncharacterized conserved protein, contains HAT (H 97.04
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 97.04
KOG3364|consensus149 97.01
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.98
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.98
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 96.97
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.95
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 96.95
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.89
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.85
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.79
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.64
KOG1258|consensus577 96.62
KOG0985|consensus 1666 96.61
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 96.59
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.56
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.53
KOG2581|consensus 493 96.48
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.44
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.41
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 96.36
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 96.36
COG5191 435 Uncharacterized conserved protein, contains HAT (H 96.3
COG2912269 Uncharacterized conserved protein [Function unknow 96.29
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 96.24
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.19
COG2912269 Uncharacterized conserved protein [Function unknow 96.18
KOG0890|consensus 2382 96.16
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.1
KOG3616|consensus 1636 96.01
KOG0529|consensus 421 95.97
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.95
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.88
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 95.87
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.79
KOG2422|consensus 665 95.73
COG3629280 DnrI DNA-binding transcriptional activator of the 95.71
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 95.68
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 95.68
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 95.65
COG3629280 DnrI DNA-binding transcriptional activator of the 95.63
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 95.57
KOG3616|consensus 1636 95.56
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.52
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 95.5
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 95.45
KOG1839|consensus1236 95.44
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.42
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.4
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.35
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 95.3
KOG1464|consensus 440 95.27
KOG0546|consensus372 95.21
KOG0546|consensus372 95.17
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.07
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 95.05
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 95.03
COG3947361 Response regulator containing CheY-like receiver a 94.94
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 94.92
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 94.83
KOG0890|consensus 2382 94.52
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.49
KOG0529|consensus 421 94.49
KOG3807|consensus 556 94.37
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 94.35
KOG2422|consensus 665 94.22
KOG2041|consensus 1189 94.1
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.02
COG4455 273 ImpE Protein of avirulence locus involved in tempe 93.84
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 93.84
KOG3807|consensus 556 93.71
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 93.69
KOG1463|consensus411 93.63
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 93.51
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 93.16
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 93.15
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 92.87
COG3947361 Response regulator containing CheY-like receiver a 92.78
KOG0276|consensus794 92.44
COG4941415 Predicted RNA polymerase sigma factor containing a 92.29
COG4455273 ImpE Protein of avirulence locus involved in tempe 92.26
KOG2114|consensus 933 92.03
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 91.89
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 91.88
KOG1538|consensus 1081 91.82
KOG0686|consensus 466 91.79
COG1747 711 Uncharacterized N-terminal domain of the transcrip 91.66
KOG0686|consensus 466 91.52
COG5159 421 RPN6 26S proteasome regulatory complex component [ 91.42
KOG1538|consensus 1081 91.33
PF1285434 PPR_1: PPR repeat 91.3
PF1285434 PPR_1: PPR repeat 90.47
COG5187 412 RPN7 26S proteasome regulatory complex component, 90.38
KOG4151|consensus 748 90.32
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 90.12
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 90.11
KOG4151|consensus 748 90.1
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 89.82
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 89.49
KOG2561|consensus 568 89.4
PF09797365 NatB_MDM20: N-acetyltransferase B complex (NatB) n 89.0
COG5536328 BET4 Protein prenyltransferase, alpha subunit [Pos 88.77
KOG3783|consensus 546 88.61
PF1304150 PPR_2: PPR repeat family 88.44
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 88.41
PF0421269 MIT: MIT (microtubule interacting and transport) d 88.26
PF09797365 NatB_MDM20: N-acetyltransferase B complex (NatB) n 88.02
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 87.61
KOG2561|consensus 568 87.32
PF1304150 PPR_2: PPR repeat family 87.13
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 87.11
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 87.04
smart00299140 CLH Clathrin heavy chain repeat homology. 86.9
KOG4279|consensus 1226 86.81
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 86.2
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 85.64
KOG0687|consensus 393 85.5
COG1747 711 Uncharacterized N-terminal domain of the transcrip 84.64
KOG0276|consensus794 84.16
PF02064121 MAS20: MAS20 protein import receptor; InterPro: IP 83.86
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 83.45
KOG1464|consensus 440 83.22
KOG2114|consensus 933 83.08
KOG1920|consensus 1265 82.1
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 81.9
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 81.73
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 81.62
KOG0128|consensus 881 81.43
PHA02537230 M terminase endonuclease subunit; Provisional 80.95
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 80.53
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 80.52
KOG2581|consensus 493 80.5
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 80.08
>KOG4626|consensus Back     alignment and domain information
Probab=99.96  E-value=8.8e-28  Score=185.23  Aligned_cols=200  Identities=19%  Similarity=0.150  Sum_probs=115.0

Q ss_pred             HHHhchhHHHHHHHhHhHHHHhCCHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHccCcCchHHHHHHHHhcCcccHHHH
Q psy17412         38 ERKARQDIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAH  117 (240)
Q Consensus        38 ~~~~~~~~~~~~~~~a~~~~~~~~~~~A~~~~~~a~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~  117 (240)
                      +....|..+.++-++|.+|+.+|..+-||..|+++++..|..+.++.++|.++-..|+..+|..+|.+++.+.|+++++.
T Consensus       278 Al~lrpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~~P~F~~Ay~NlanALkd~G~V~ea~~cYnkaL~l~p~hadam  357 (966)
T KOG4626|consen  278 ALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYKRALELQPNFPDAYNNLANALKDKGSVTEAVDCYNKALRLCPNHADAM  357 (966)
T ss_pred             HHhcCCcchhhccceEEEEeccccHHHHHHHHHHHHhcCCCchHHHhHHHHHHHhccchHHHHHHHHHHHHhCCccHHHH
Confidence            34445555555555555555555555555555555555555555555555555555555555555555555555555555


Q ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHcCCCchHH-----------------------HHHhccCchHHHHHHHHHHHHhcc
Q psy17412        118 LYKARAMHSLGQREEAKEYVRQLVEKYPTRRKL-----------------------AIEQVRDSPVLYTNRALTLLHLQL  174 (240)
Q Consensus       118 ~~la~~~~~~~~~~~A~~~~~~a~~~~~~~~~~-----------------------~~~~~~~~~~~~~~la~~~~~~~~  174 (240)
                      .++|.++..+|++++|...|+++++..|+....                       ++...|..++.+.++|.+|...|+
T Consensus       358 ~NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa~nNLa~i~kqqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~  437 (966)
T KOG4626|consen  358 NNLGNIYREQGKIEEATRLYLKALEVFPEFAAAHNNLASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGD  437 (966)
T ss_pred             HHHHHHHHHhccchHHHHHHHHHHhhChhhhhhhhhHHHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhhh
Confidence            555555555555555555555555555554333                       122223333446666666666666


Q ss_pred             cCchhhHHHHHhhcChhhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHhh
Q psy17412        175 YDPVLPDCDKALRLDEDNMKAHLYKARAMHNLGQREEAKEYIRELVEKYPTRRKLVENYTQAF  237 (240)
Q Consensus       175 ~~~A~~~~~~~l~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~  237 (240)
                      .+.|+++|.+++..+|...+++.++|.+|...|+..+|+..|+.++++.|+.+++..++..++
T Consensus       438 v~~A~q~y~rAI~~nPt~AeAhsNLasi~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh~l  500 (966)
T KOG4626|consen  438 VSAAIQCYTRAIQINPTFAEAHSNLASIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLHCL  500 (966)
T ss_pred             HHHHHHHHHHHHhcCcHHHHHHhhHHHHhhccCCcHHHHHHHHHHHccCCCCchhhhHHHHHH
Confidence            666666666666666666666666666666666666666666666666666666666655544



>KOG4626|consensus Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1258|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1839|consensus Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG3783|consensus Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1258|consensus Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2581|consensus Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0890|consensus Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2422|consensus Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG1839|consensus Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG0890|consensus Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>KOG3807|consensus Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG2422|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG3807|consensus Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG1463|consensus Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0686|consensus Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG0686|consensus Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG2561|consensus Back     alignment and domain information
>PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) Back     alignment and domain information
>COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3783|consensus Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG2561|consensus Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0687|consensus Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PF02064 MAS20: MAS20 protein import receptor; InterPro: IPR002056 Virtually all mitochondrial precursors are imported via the same mechanism []: precursors first bind to receptors on the mitochondrial surface, then insert into the translocation channel in the outer membrane Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG2581|consensus Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 4e-09
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 1e-04
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 1e-07
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 3e-04
2c2l_A281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 1e-07
2c2l_A 281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 4e-04
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 5e-07
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 2e-06
2if4_A338 Crystal Structure Of A Multi-Domain Immunophilin Fr 3e-06
1a17_A166 Tetratricopeptide Repeats Of Protein Phosphatase 5 5e-06
2bug_A140 Solution Structure Of The Tpr Domain From Protein P 7e-06
1wao_1 477 Pp5 Structure Length = 477 1e-05
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 3e-05
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 7e-05
3lca_A 533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 1e-04
3fp2_A 537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 1e-04
1p5q_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 2e-04
2l6j_A111 Tah1 Complexed By Meevd Length = 111 3e-04
2y4t_A 450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 3e-04
3uq3_A258 Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 5e-04
2y4u_A 450 Crystal Structure Of Human P58(Ipk) In Space Group 6e-04
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 9e-04
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 9e-04
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure

Iteration: 1

Score = 58.2 bits (139), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 33/115 (28%), Positives = 63/115 (54%), Gaps = 1/115 (0%) Query: 44 DIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDC 103 ++A K GN+ F+ G Y A+ Y++A+++ ++ +LY+NRA L L + L DC Sbjct: 11 ELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDC 70 Query: 104 DKALRLDEDNMKAHLYKARAMHSLGQREEAKEYVRQLVEKYPTRRKLAIEQVRDS 158 D +RLD +K ++ KA + ++ + +A+ ++ P+ + A E VR+ Sbjct: 71 DTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEE-AREGVRNC 124
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 Back     alignment and structure
>pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 Back     alignment and structure
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|2L6J|A Chain A, Tah1 Complexed By Meevd Length = 111 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-31
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-22
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-21
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-15
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-14
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-08
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-30
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-21
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-20
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-14
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-27
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-15
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 7e-26
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 9e-26
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-13
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-25
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-24
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-18
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 3e-09
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-25
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 8e-15
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 5e-25
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 4e-14
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 6e-25
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 6e-14
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 7e-25
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-24
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-24
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 1e-13
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-24
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-23
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-23
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-22
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-21
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-18
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-15
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-23
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 5e-14
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-23
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 9e-20
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 8e-19
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-14
2l6j_A111 TPR repeat-containing protein associated with HSP; 5e-23
2l6j_A111 TPR repeat-containing protein associated with HSP; 4e-12
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-23
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-21
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-21
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-21
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-20
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-14
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-21
3u4t_A272 TPR repeat-containing protein; structural genomics 9e-19
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-17
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-15
3u4t_A 272 TPR repeat-containing protein; structural genomics 7e-14
3u4t_A 272 TPR repeat-containing protein; structural genomics 4e-09
3u4t_A 272 TPR repeat-containing protein; structural genomics 3e-04
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-21
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-21
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-21
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-20
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-20
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-17
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-15
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-11
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-07
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-04
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-20
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-09
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 6e-20
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-09
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 4e-19
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-19
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-16
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-15
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-15
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-13
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-08
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-08
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 7e-19
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 5e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-18
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-18
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-18
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 4e-18
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 8e-18
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-16
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-14
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-09
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-18
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-14
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-13
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-09
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-18
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-17
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-08
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 3e-18
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 2e-09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-18
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 8e-13
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-13
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-06
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 3e-18
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 1e-10
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-17
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-12
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-12
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-17
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-12
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 2e-17
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-12
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-11
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 1e-10
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-17
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-16
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 9e-15
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-14
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-14
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 7e-14
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 9e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 8e-17
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 6e-12
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-16
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-16
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-15
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-13
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-16
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-16
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-16
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-15
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-14
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-14
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-14
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-14
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-13
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-07
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-05
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 5e-16
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-13
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 3e-12
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 9e-12
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-09
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-07
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 9e-16
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 3e-10
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-15
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 4e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-15
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-13
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-15
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 6e-15
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 6e-09
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 3e-15
4g1t_A 472 Interferon-induced protein with tetratricopeptide 3e-14
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-10
4g1t_A 472 Interferon-induced protein with tetratricopeptide 5e-10
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-04
4g1t_A 472 Interferon-induced protein with tetratricopeptide 7e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-14
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-12
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-09
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 5e-08
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-05
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-12
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-10
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 6e-12
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 9e-12
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-10
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-11
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-11
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 9e-07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-11
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-10
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 4e-11
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 6e-11
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 1e-07
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 7e-10
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 3e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-10
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-07
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-09
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-09
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-08
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-07
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 4e-06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 7e-06
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 3e-05
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 7e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 8e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-04
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-04
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
 Score =  117 bits (296), Expect = 5e-31
 Identities = 35/184 (19%), Positives = 70/184 (38%), Gaps = 4/184 (2%)

Query: 46  ADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDK 105
            +     G K   +GQ   AL Q+  A++   D+ + Y  RA   L +      LPD  K
Sbjct: 26  VEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTK 85

Query: 106 ALRLDEDNMKAHLYKARAMHSLGQREEAKEYVRQLVEKYP----TRRKLAIEQVRDSPVL 161
            ++L  D   A L +   +   G+ +EA++  +++++  P     +   +     D    
Sbjct: 86  VIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDEMQR 145

Query: 162 YTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHNLGQREEAKEYIRELVE 221
             ++AL       Y   +   DK L +   + +    +A      G+  +A   ++   +
Sbjct: 146 LRSQALNAFGSGDYTAAIAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASK 205

Query: 222 KYPT 225
               
Sbjct: 206 LKND 209


>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 100.0
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.98
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.97
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.97
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.97
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.97
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.96
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.96
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.96
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.96
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.95
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.95
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.95
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.95
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.95
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.95
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.95
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.95
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.94
3u4t_A272 TPR repeat-containing protein; structural genomics 99.94
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.94
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.94
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.94
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.94
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.94
3u4t_A272 TPR repeat-containing protein; structural genomics 99.94
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.94
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.94
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.94
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.93
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.93
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.93
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.93
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.93
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.93
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.92
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.92
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.91
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.91
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.91
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.91
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.91
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.91
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.9
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.9
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.9
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.9
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.9
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.9
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.9
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.89
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.89
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.89
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.89
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.89
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.89
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.89
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.88
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.87
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.87
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.87
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.86
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.86
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.86
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.86
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.86
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.85
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.85
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.85
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.85
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.85
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 99.85
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.85
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.85
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.85
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.85
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.85
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.85
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.85
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.84
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.84
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.84
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.84
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.84
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.84
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.84
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.84
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.84
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.84
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.83
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.83
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.83
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.83
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.83
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.83
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.83
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.82
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.82
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.82
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.81
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.81
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.81
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.81
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.81
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.81
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.81
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.81
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.8
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.8
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.8
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.8
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.8
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.79
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.79
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.79
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.79
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.78
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.78
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.78
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.78
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.77
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.77
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.77
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.77
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.77
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.77
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.77
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.76
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.76
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.76
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.75
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.75
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.75
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.75
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.75
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.75
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.75
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 99.75
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.74
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.73
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.73
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.73
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.73
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.73
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.73
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.72
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.72
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.72
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 99.72
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.72
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.71
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.71
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.69
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.69
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.69
3k9i_A117 BH0479 protein; putative protein binding protein, 99.69
3k9i_A117 BH0479 protein; putative protein binding protein, 99.68
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 99.68
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 99.68
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.68
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.68
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.66
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.66
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.64
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.64
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.64
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.61
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.59
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.55
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.55
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.53
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.53
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.52
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.51
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.51
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.5
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.5
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.48
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.47
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.46
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.42
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.4
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.4
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.4
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.38
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.37
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 99.36
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.35
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.34
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 99.26
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.19
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 99.15
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.14
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.11
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.11
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.1
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.1
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.07
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 99.02
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 99.01
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 99.01
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.0
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.91
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 98.83
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.78
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.76
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.68
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.63
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.57
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.37
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.29
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.24
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.12
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.06
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.94
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.94
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 97.78
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 97.62
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 97.61
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 97.36
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 97.3
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 97.29
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 97.19
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 97.05
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 97.01
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 97.0
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 96.92
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 96.88
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.86
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 96.86
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 96.81
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.62
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 96.61
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.48
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 96.28
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.19
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 96.19
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 95.87
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 95.78
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 95.43
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 95.38
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 95.12
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 94.95
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 93.27
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 92.41
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 91.38
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 90.34
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 90.08
3t5v_B 455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 88.95
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 86.82
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 86.65
1om2_A95 Protein (mitochondrial import receptor subunit TOM 86.32
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 85.12
3t5v_B 455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 84.19
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 83.25
2ijq_A161 Hypothetical protein; structural genomics, PSI, pr 82.51
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 82.17
1om2_A95 Protein (mitochondrial import receptor subunit TOM 80.58
3t5x_A 203 PCI domain-containing protein 2; PCI, mRNA nuclear 80.57
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 80.4
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
Probab=100.00  E-value=9e-32  Score=192.93  Aligned_cols=185  Identities=22%  Similarity=0.238  Sum_probs=177.6

Q ss_pred             hhHHHHHHHhHhHHHHhCCHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHccCcCchHHHHHHHHhcCcccHHHHHHHHH
Q psy17412         43 QDIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKAR  122 (240)
Q Consensus        43 ~~~~~~~~~~a~~~~~~~~~~~A~~~~~~a~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~la~  122 (240)
                      |.++..++.+|..+...|++++|+..|+++++.+|+++.++..+|.++...|++++|+..++++++++|+++.++..+|.
T Consensus         2 p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~g~~~~A~~~~~~al~~~P~~~~a~~~lg~   81 (217)
T 2pl2_A            2 QTAEQNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMVLSE   81 (217)
T ss_dssp             --CCHHHHHHHHHHHHTTCHHHHHHHHHHHHTTSSSCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHH
T ss_pred             CCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHH
Confidence            45677899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHc-----------CCHHHHHHHHHHHHHcCCCchHHHHHhccCchHHHHHHHHHHHHhcccCchhhHHHHHhhcChh
Q psy17412        123 AMHSL-----------GQREEAKEYVRQLVEKYPTRRKLAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDED  191 (240)
Q Consensus       123 ~~~~~-----------~~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~~l~~~~~  191 (240)
                      ++..+           |++++|+..++++++++|+++..           +..+|.++...|++++|+..|+++++.+ +
T Consensus        82 ~~~~~~~~~~~~~~~~g~~~~A~~~~~~al~~~P~~~~~-----------~~~lg~~~~~~g~~~~A~~~~~~al~~~-~  149 (217)
T 2pl2_A           82 AYVALYRQAEDRERGKGYLEQALSVLKDAERVNPRYAPL-----------HLQRGLVYALLGERDKAEASLKQALALE-D  149 (217)
T ss_dssp             HHHHHHHTCSSHHHHHHHHHHHHHHHHHHHHHCTTCHHH-----------HHHHHHHHHHTTCHHHHHHHHHHHHHHC-C
T ss_pred             HHHHhhhhhhhhcccccCHHHHHHHHHHHHHhCcccHHH-----------HHHHHHHHHHcCChHHHHHHHHHHHhcc-c
Confidence            99999           99999999999999999999888           9999999999999999999999999999 9


Q ss_pred             hHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHhhhc
Q psy17412        192 NMKAHLYKARAMHNLGQREEAKEYIRELVEKYPTRRKLVENYTQAFEQ  239 (240)
Q Consensus       192 ~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~  239 (240)
                      ++.++..+|.++..+|++++|+..|+++++.+|+++.++..++.++..
T Consensus       150 ~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~P~~~~~~~~la~~~~~  197 (217)
T 2pl2_A          150 TPEIRSALAELYLSMGRLDEALAQYAKALEQAPKDLDLRVRYASALLL  197 (217)
T ss_dssp             CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHSTTCHHHHHHHHHHHTC
T ss_pred             chHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999987653



>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>2ijq_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.88A {Haloarcula marismortui} SCOP: a.246.2.1 Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 240
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-16
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-14
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-11
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-08
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-05
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.003
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-12
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 6e-12
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-08
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 5e-04
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 9e-08
d1dcea1 334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.001
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-04
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.001
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 6e-07
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 1e-06
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-05
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 5e-05
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 3e-04
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 4e-04
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-04
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.002
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 4e-04
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 8e-04
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 0.004
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 74.3 bits (181), Expect = 4e-16
 Identities = 36/200 (18%), Positives = 68/200 (34%), Gaps = 11/200 (5%)

Query: 40  KARQDIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPV 99
               +  D +   GN   ++  ++ A+  Y +A+    +  V++ N A       L D  
Sbjct: 197 TLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLA 256

Query: 100 LPDCDKALRLDEDNMKAHLYKARAMHSLGQREEAKEYVRQLVEKYPTRRKLAIEQVRDSP 159
           +    +A+ L      A+   A A+   G   EA++     +   PT             
Sbjct: 257 IDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADS--------- 307

Query: 160 VLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLYKARAMHNLGQREEAKEYIREL 219
               N A         +  +    KAL +  +   AH   A  +   G+ +EA  + +E 
Sbjct: 308 --LNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEA 365

Query: 220 VEKYPTRRKLVENYTQAFEQ 239
           +   PT      N     ++
Sbjct: 366 IRISPTFADAYSNMGNTLKE 385


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.96
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.96
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.96
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.96
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.94
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.94
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.92
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.87
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.86
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.85
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.85
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.83
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.82
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.82
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.8
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.79
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.79
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.78
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.78
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.78
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.77
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.76
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.75
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.74
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.74
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.73
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.72
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.72
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.71
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.71
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.71
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.66
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.65
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.56
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.53
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.51
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.49
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.46
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.42
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.36
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 99.36
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.35
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.29
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.14
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.84
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.77
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.63
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.59
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.98
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 95.58
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 93.33
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 93.08
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 89.27
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 86.12
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 85.87
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 85.51
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 85.18
d1om2a_95 Mitochondrial import receptor subunit Tom20 {Rat ( 84.53
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 80.62
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=2.2e-28  Score=186.90  Aligned_cols=190  Identities=19%  Similarity=0.168  Sum_probs=155.2

Q ss_pred             HHhchhHHHHHHHhHhHHHHhCCHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHccCcCchHHHHHHHHhcCcccHHHHH
Q psy17412         39 RKARQDIADHFKANGNKAFQSGQYEAALVQYDKAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHL  118 (240)
Q Consensus        39 ~~~~~~~~~~~~~~a~~~~~~~~~~~A~~~~~~a~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~  118 (240)
                      ....|..+.++..+|.++...|++++|+..++++....|.....+..+|.++...|++++|+..|+++++.+|+++.++.
T Consensus       196 l~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~  275 (388)
T d1w3ba_         196 VTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYC  275 (388)
T ss_dssp             HHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHH
T ss_pred             HHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHH
Confidence            34456666677777777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHcCCCchHHHHHhccCchHHHHHHHHHHHHhcccCchhhHHHHHhhcChhhHHHHHH
Q psy17412        119 YKARAMHSLGQREEAKEYVRQLVEKYPTRRKLAIEQVRDSPVLYTNRALTLLHLQLYDPVLPDCDKALRLDEDNMKAHLY  198 (240)
Q Consensus       119 ~la~~~~~~~~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~~l~~~~~~~~~~~~  198 (240)
                      .+|.++...|++++|+..+++++...|.+...           +..+|.++...|++++|+..++++++.+|+++.++..
T Consensus       276 ~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~-----------~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~  344 (388)
T d1w3ba_         276 NLANALKEKGSVAEAEDCYNTALRLCPTHADS-----------LNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSN  344 (388)
T ss_dssp             HHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHH-----------HHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHH
T ss_pred             HHHHHHHHcCCHHHHHHHHHhhhccCCccchh-----------hhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHH
Confidence            77777777777777777777777777766555           9999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHhhhc
Q psy17412        199 KARAMHNLGQREEAKEYIRELVEKYPTRRKLVENYTQAFEQ  239 (240)
Q Consensus       199 la~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~  239 (240)
                      +|.++..+|++++|+.+|+++++++|+++.++..++.++.+
T Consensus       345 la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~  385 (388)
T d1w3ba_         345 LASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKE  385 (388)
T ss_dssp             HHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHH
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999998864



>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1om2a_ a.23.4.1 (A:) Mitochondrial import receptor subunit Tom20 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure