Psyllid ID: psy17416


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290
TPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIHGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMK
cccHHHHHccccEEEEcccccHHHHHHHHHHHHccccccEEEEEccccccHHHHHccccccccEEEEccccccccccEEEEcccccccHHHHHHHHHHHHHcccEEEEEccccccEEEHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccccccccHHHHHHcccEEEEcccccHHHHHHHHHHHHccccccEEEEEccccccHHHHHccccccccEEEEccccccccccEEEEcccccccHHHHHHHHHHHHHcccc
cccHHHHHHcccEEEEEccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHcccccHEEEEEccccccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHcccccHEEEEEcccccccEEEEEEEccccccHHHHHHHHHHHHHHccc
TPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIfmssntilssstssflpsvlsehsthrsqfivahpvnppyfiplveivpaawtserVITRTREIMTeigmkpvtlTTEIRGFALNRIHGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDyhqkgclkgslspeeqfglisgtpvLRECLEDAIFIQESVPEILQIKHQVYRAIDIfmssntilssstssflpsvlsehsthrsqfivahpvnppyfiplveivpaawtserVITRTREIMTEIGMK
TPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTReimteigmkpvtLTTEIRGFALNRIHGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEivpaawtservITRTREimteigmk
TPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMssntilssstssflpsvlsEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIHGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMssntilssstssflpsvlsEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMK
***LRECLEDAIFIQESVPEILQIKHQVYRAIDIFMS*************************QFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIHGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMS*************************QFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREI*******
TPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIHGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQK*****SLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMK
TPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIHGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMK
*PVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIHGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIG**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIHGLIGQAWAMIFASAGYKVSLxxxxxxxxxxxxxxxxxxxxxYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query290 2.2.26 [Sep-21-2011]
Q5RDZ2 319 Lambda-crystallin homolog yes N/A 0.568 0.517 0.493 4e-41
Q9Y2S2 319 Lambda-crystallin homolog yes N/A 0.568 0.517 0.493 4e-41
Q8SQ26 322 Lambda-crystallin homolog yes N/A 0.568 0.512 0.481 1e-34
Q99KP3 319 Lambda-crystallin homolog yes N/A 0.568 0.517 0.487 5e-34
Q811X6 319 Lambda-crystallin homolog yes N/A 0.565 0.514 0.484 2e-33
P14755 319 Lambda-crystallin OS=Oryc yes N/A 0.568 0.517 0.475 1e-32
Q8SPX7 321 Lambda-crystallin homolog yes N/A 0.568 0.514 0.445 6e-31
D7URM0321 L-carnitine dehydrogenase N/A N/A 0.389 0.352 0.415 1e-20
Q8CUW0307 L-carnitine dehydrogenase yes N/A 0.389 0.368 0.423 2e-20
Q92NF5 496 L-carnitine dehydrogenase yes N/A 0.537 0.314 0.365 2e-20
>sp|Q5RDZ2|CRYL1_PONAB Lambda-crystallin homolog OS=Pongo abelii GN=CRYL1 PE=2 SV=3 Back     alignment and function desciption
 Score =  168 bits (426), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 111/166 (66%)

Query: 123 GLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGL 182
           G+IG++WAM+FAS G++V LYD+  +QI NA   I+  ++   Q G LKGSLS EEQ  L
Sbjct: 15  GVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEEQLSL 74

Query: 183 ISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEH 242
           ISG P ++E +E A+ IQE VPE L++K +++  +D  +    ILSSSTS  +PS L   
Sbjct: 75  ISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAG 134

Query: 243 STHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIG 288
             H  Q IVAHPVNPPY+IPLVE+VP   T+   + RT  +M +IG
Sbjct: 135 LVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIG 180





Pongo abelii (taxid: 9601)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 5
>sp|Q9Y2S2|CRYL1_HUMAN Lambda-crystallin homolog OS=Homo sapiens GN=CRYL1 PE=1 SV=3 Back     alignment and function description
>sp|Q8SQ26|CRYL1_PIG Lambda-crystallin homolog OS=Sus scrofa GN=CRYL1 PE=2 SV=3 Back     alignment and function description
>sp|Q99KP3|CRYL1_MOUSE Lambda-crystallin homolog OS=Mus musculus GN=Cryl1 PE=2 SV=3 Back     alignment and function description
>sp|Q811X6|CRYL1_RAT Lambda-crystallin homolog OS=Rattus norvegicus GN=Cryl1 PE=2 SV=3 Back     alignment and function description
>sp|P14755|CRYL1_RABIT Lambda-crystallin OS=Oryctolagus cuniculus GN=CRYL1 PE=1 SV=3 Back     alignment and function description
>sp|Q8SPX7|CRYL1_BOVIN Lambda-crystallin homolog OS=Bos taurus GN=CRYL1 PE=2 SV=3 Back     alignment and function description
>sp|D7URM0|LCDH_PSESP L-carnitine dehydrogenase OS=Pseudomonas sp. GN=lcdH PE=1 SV=1 Back     alignment and function description
>sp|Q8CUW0|LCDH_OCEIH L-carnitine dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lcdH PE=3 SV=1 Back     alignment and function description
>sp|Q92NF5|LCDH_RHIME L-carnitine dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=lcdH PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query290
195124585315 GI18410 [Drosophila mojavensis] gi|19391 0.575 0.530 0.523 4e-47
158285772315 AGAP007378-PB [Anopheles gambiae str. PE 0.575 0.530 0.511 7e-47
195040405318 GH12278 [Drosophila grimshawi] gi|193900 0.575 0.525 0.505 2e-46
45549573315 CG9914 [Drosophila melanogaster] gi|3358 0.575 0.530 0.511 3e-46
195351396318 GM13412 [Drosophila sechellia] gi|194124 0.575 0.525 0.511 4e-46
195134454313 GI10976 [Drosophila mojavensis] gi|19390 0.575 0.533 0.5 1e-45
321464503317 hypothetical protein DAPPUDRAFT_306692 [ 0.575 0.526 0.505 2e-45
195448304316 GK25055 [Drosophila willistoni] gi|19416 0.575 0.528 0.511 2e-45
194893905315 GG19334 [Drosophila erecta] gi|190649613 0.575 0.530 0.505 3e-45
312384823304 hypothetical protein AND_01493 [Anophele 0.582 0.555 0.488 6e-45
>gi|195124585|ref|XP_002006772.1| GI18410 [Drosophila mojavensis] gi|193911840|gb|EDW10707.1| GI18410 [Drosophila mojavensis] Back     alignment and taxonomy information
 Score =  194 bits (492), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 120/168 (71%)

Query: 123 GLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGL 182
           GLIG+AWA++FASAGY+V LYD+L  QI  A + ++  LQ    KG L+G+L+   QF L
Sbjct: 12  GLIGRAWALLFASAGYRVQLYDILESQIATALDELREELQQLEAKGALRGNLTAAAQFEL 71

Query: 183 ISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEH 242
           ISG   L+E ++DA+ IQE VPE LQ+K  +Y  +D  +   T+L+SSTS+F+PS+ SE 
Sbjct: 72  ISGCTQLKELVQDALHIQECVPEQLQLKRSLYAQLDDLLEPQTVLASSTSTFMPSLFSEK 131

Query: 243 STHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMK 290
              RSQ +VAHP+NPPYFIPLVE+VPA WT+E  + RTR +M  +G +
Sbjct: 132 LKRRSQILVAHPLNPPYFIPLVELVPAPWTTEEAVERTRLLMLTLGQR 179




Source: Drosophila mojavensis

Species: Drosophila mojavensis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|158285772|ref|XP_308454.4| AGAP007378-PB [Anopheles gambiae str. PEST] gi|347965269|ref|XP_003435742.1| AGAP013544-PA [Anopheles gambiae str. PEST] gi|333466437|gb|EGK96241.1| AGAP013544-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195040405|ref|XP_001991062.1| GH12278 [Drosophila grimshawi] gi|193900820|gb|EDV99686.1| GH12278 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|45549573|ref|NP_573114.2| CG9914 [Drosophila melanogaster] gi|33589300|gb|AAQ22417.1| RH68464p [Drosophila melanogaster] gi|45447016|gb|AAF48586.2| CG9914 [Drosophila melanogaster] gi|220959622|gb|ACL92354.1| CG9914-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195351396|ref|XP_002042220.1| GM13412 [Drosophila sechellia] gi|194124063|gb|EDW46106.1| GM13412 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195134454|ref|XP_002011652.1| GI10976 [Drosophila mojavensis] gi|193906775|gb|EDW05642.1| GI10976 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|321464503|gb|EFX75510.1| hypothetical protein DAPPUDRAFT_306692 [Daphnia pulex] Back     alignment and taxonomy information
>gi|195448304|ref|XP_002071598.1| GK25055 [Drosophila willistoni] gi|194167683|gb|EDW82584.1| GK25055 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194893905|ref|XP_001977964.1| GG19334 [Drosophila erecta] gi|190649613|gb|EDV46891.1| GG19334 [Drosophila erecta] Back     alignment and taxonomy information
>gi|312384823|gb|EFR29456.1| hypothetical protein AND_01493 [Anopheles darlingi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query290
FB|FBgn0030737 315 CG9914 [Drosophila melanogaste 0.579 0.533 0.428 1.9e-35
FB|FBgn0033949 315 CG10131 [Drosophila melanogast 0.579 0.533 0.422 2.2e-34
UNIPROTKB|Q9Y2S2 319 CRYL1 "Lambda-crystallin homol 0.572 0.520 0.433 1.8e-32
UNIPROTKB|Q5RDZ2 319 CRYL1 "Lambda-crystallin homol 0.572 0.520 0.433 1.8e-32
MGI|MGI:1915881 319 Cryl1 "crystallin, lambda 1" [ 0.572 0.520 0.427 2e-31
UNIPROTKB|Q8SQ26 322 CRYL1 "Lambda-crystallin homol 0.572 0.515 0.421 2.6e-31
UNIPROTKB|P14755 319 CRYL1 "Lambda-crystallin" [Ory 0.572 0.520 0.421 6.9e-31
RGD|631427 319 Cryl1 "crystallin, lambda 1" [ 0.568 0.517 0.424 6.9e-31
UNIPROTKB|E2R471 387 CRYL1 "Uncharacterized protein 0.572 0.428 0.409 3e-30
UNIPROTKB|F1NPU2 321 CRYL1 "Uncharacterized protein 0.572 0.517 0.379 5.6e-29
FB|FBgn0030737 CG9914 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 383 (139.9 bits), Expect = 1.9e-35, P = 1.9e-35
 Identities = 72/168 (42%), Positives = 102/168 (60%)

Query:   123 GLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGL 182
             GLIG++W+M+FAS GY+V LYD+L EQ+  A    Q  LQD   KG L+G L+  +QF  
Sbjct:    14 GLIGRSWSMLFASVGYQVVLYDILPEQVSTALTATQKELQDLEAKGLLRGKLTAAQQFAC 73

Query:   183 ISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMXXXXXXXXXXXXXXXXXXXEH 242
             ISGT  L+E ++ AIF+QE +PE L +K  +Y+ +D  +                     
Sbjct:    74 ISGTNDLKELVKGAIFVQECIPERLDLKKALYKQLDAVVGPNTILSSSTSTFLPSLFSAD 133

Query:   243 STHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMK 290
               +++  +V+HPVNPPY++PLVEIVPA WT    + +TR +M EIG K
Sbjct:   134 LKNKANVLVSHPVNPPYYVPLVEIVPAPWTKPEWVKKTRALMEEIGQK 181


GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006631 "fatty acid metabolic process" evidence=IEA
GO:0070403 "NAD+ binding" evidence=IEA
GO:0003857 "3-hydroxyacyl-CoA dehydrogenase activity" evidence=IEA
FB|FBgn0033949 CG10131 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2S2 CRYL1 "Lambda-crystallin homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RDZ2 CRYL1 "Lambda-crystallin homolog" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:1915881 Cryl1 "crystallin, lambda 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8SQ26 CRYL1 "Lambda-crystallin homolog" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P14755 CRYL1 "Lambda-crystallin" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
RGD|631427 Cryl1 "crystallin, lambda 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R471 CRYL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPU2 CRYL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
PRK06129 308 PRK06129, PRK06129, 3-hydroxyacyl-CoA dehydrogenas 2e-50
pfam02737180 pfam02737, 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenas 4e-48
COG1250 307 COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Li 4e-45
PRK06129308 PRK06129, PRK06129, 3-hydroxyacyl-CoA dehydrogenas 5e-45
PRK07531 495 PRK07531, PRK07531, bifunctional 3-hydroxyacyl-CoA 5e-35
PRK07531 495 PRK07531, PRK07531, bifunctional 3-hydroxyacyl-CoA 1e-33
pfam02737180 pfam02737, 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenas 2e-33
COG1250307 COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Li 9e-33
PRK07066321 PRK07066, PRK07066, 3-hydroxybutyryl-CoA dehydroge 9e-24
PRK08269314 PRK08269, PRK08269, 3-hydroxybutyryl-CoA dehydroge 1e-23
PRK06130 311 PRK06130, PRK06130, 3-hydroxybutyryl-CoA dehydroge 3e-23
PRK06130311 PRK06130, PRK06130, 3-hydroxybutyryl-CoA dehydroge 1e-22
PRK07066 321 PRK07066, PRK07066, 3-hydroxybutyryl-CoA dehydroge 1e-21
PRK08269 314 PRK08269, PRK08269, 3-hydroxybutyryl-CoA dehydroge 2e-21
PRK09260 288 PRK09260, PRK09260, 3-hydroxybutyryl-CoA dehydroge 2e-21
PRK06035 291 PRK06035, PRK06035, 3-hydroxyacyl-CoA dehydrogenas 2e-20
PRK08293 287 PRK08293, PRK08293, 3-hydroxybutyryl-CoA dehydroge 3e-20
PLN02545 295 PLN02545, PLN02545, 3-hydroxybutyryl-CoA dehydroge 5e-18
PRK08293287 PRK08293, PRK08293, 3-hydroxybutyryl-CoA dehydroge 7e-16
PLN02545295 PLN02545, PLN02545, 3-hydroxybutyryl-CoA dehydroge 4e-15
PRK09260288 PRK09260, PRK09260, 3-hydroxybutyryl-CoA dehydroge 3e-14
PRK06035291 PRK06035, PRK06035, 3-hydroxyacyl-CoA dehydrogenas 5e-14
TIGR02440 699 TIGR02440, FadJ, fatty oxidation complex, alpha su 6e-13
PRK07530 292 PRK07530, PRK07530, 3-hydroxybutyryl-CoA dehydroge 5e-12
PRK07819 286 PRK07819, PRK07819, 3-hydroxybutyryl-CoA dehydroge 5e-12
TIGR02440699 TIGR02440, FadJ, fatty oxidation complex, alpha su 2e-11
PRK05808 282 PRK05808, PRK05808, 3-hydroxybutyryl-CoA dehydroge 3e-11
PRK07819286 PRK07819, PRK07819, 3-hydroxybutyryl-CoA dehydroge 1e-09
PRK11154 708 PRK11154, fadJ, multifunctional fatty acid oxidati 1e-09
TIGR02279 503 TIGR02279, PaaC-3OHAcCoADH, 3-hydroxyacyl-CoA dehy 4e-09
PRK05808282 PRK05808, PRK05808, 3-hydroxybutyryl-CoA dehydroge 6e-09
PRK11154708 PRK11154, fadJ, multifunctional fatty acid oxidati 1e-08
PRK08268 507 PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogena 2e-08
TIGR02437714 TIGR02437, FadB, fatty oxidation complex, alpha su 1e-07
TIGR02437 714 TIGR02437, FadB, fatty oxidation complex, alpha su 2e-07
PRK11730 715 PRK11730, fadB, multifunctional fatty acid oxidati 4e-07
PRK11730715 PRK11730, fadB, multifunctional fatty acid oxidati 3e-06
TIGR02441 737 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation c 6e-06
TIGR02279 503 TIGR02279, PaaC-3OHAcCoADH, 3-hydroxyacyl-CoA dehy 6e-05
PRK07530292 PRK07530, PRK07530, 3-hydroxybutyryl-CoA dehydroge 5e-04
PRK08268 507 PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogena 8e-04
TIGR02441737 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation c 0.003
>gnl|CDD|235706 PRK06129, PRK06129, 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
 Score =  167 bits (426), Expect = 2e-50
 Identities = 64/168 (38%), Positives = 94/168 (55%), Gaps = 1/168 (0%)

Query: 123 GLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGL 182
           GLIG+AWA++FA AG++V L+D        A   I   L+D      L G  +P+     
Sbjct: 11  GLIGRAWAIVFARAGHEVRLWDADPAAAAAAPAYIAGRLEDLAAFDLLDGE-APDAVLAR 69

Query: 183 ISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEH 242
           I  T  L + + DA ++QES PE L++K  ++  +D     + IL+SSTS+ L S  +EH
Sbjct: 70  IRVTDSLADAVADADYVQESAPENLELKRALFAELDALAPPHAILASSTSALLASAFTEH 129

Query: 243 STHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMK 290
              R + +VAHP+NPPY IP+VE+VPA WT+   + R   +    G  
Sbjct: 130 LAGRERCLVAHPINPPYLIPVVEVVPAPWTAPATLARAEALYRAAGQS 177


Length = 308

>gnl|CDD|202367 pfam02737, 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|224170 COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|235706 PRK06129, PRK06129, 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236044 PRK07531, PRK07531, bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>gnl|CDD|236044 PRK07531, PRK07531, bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>gnl|CDD|202367 pfam02737, 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|224170 COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|168796 PRK07066, PRK07066, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181340 PRK08269, PRK08269, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235707 PRK06130, PRK06130, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235707 PRK06130, PRK06130, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|168796 PRK07066, PRK07066, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181340 PRK08269, PRK08269, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236434 PRK09260, PRK09260, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180361 PRK06035, PRK06035, 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181359 PRK08293, PRK08293, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215300 PLN02545, PLN02545, 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|181359 PRK08293, PRK08293, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215300 PLN02545, PLN02545, 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|236434 PRK09260, PRK09260, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180361 PRK06035, PRK06035, 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|131493 TIGR02440, FadJ, fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>gnl|CDD|181018 PRK07530, PRK07530, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181133 PRK07819, PRK07819, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|131493 TIGR02440, FadJ, fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>gnl|CDD|180269 PRK05808, PRK05808, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181133 PRK07819, PRK07819, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236864 PRK11154, fadJ, multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|188207 TIGR02279, PaaC-3OHAcCoADH, 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>gnl|CDD|180269 PRK05808, PRK05808, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236864 PRK11154, fadJ, multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|236211 PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>gnl|CDD|183293 PRK11730, fadB, multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|183293 PRK11730, fadB, multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|131494 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>gnl|CDD|188207 TIGR02279, PaaC-3OHAcCoADH, 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>gnl|CDD|181018 PRK07530, PRK07530, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236211 PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|131494 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 290
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 100.0
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 100.0
KOG2304|consensus298 100.0
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 100.0
COG1250 307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 100.0
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 100.0
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 100.0
PRK11730715 fadB multifunctional fatty acid oxidation complex 100.0
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 100.0
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 100.0
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PRK11154708 fadJ multifunctional fatty acid oxidation complex 100.0
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 100.0
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 100.0
PRK11730 715 fadB multifunctional fatty acid oxidation complex 100.0
KOG2304|consensus 298 100.0
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 100.0
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PRK08269 314 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 100.0
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 100.0
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.98
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.97
KOG2305|consensus 313 99.97
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.97
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.97
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.97
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.97
KOG1683|consensus380 99.96
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.96
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.96
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.96
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.96
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.95
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 99.95
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.95
KOG2305|consensus313 99.94
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.94
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.94
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.94
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.93
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.92
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.9
KOG1683|consensus 380 99.88
PRK07417 279 arogenate dehydrogenase; Reviewed 99.54
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 99.37
PRK06545 359 prephenate dehydrogenase; Validated 99.36
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transpor 99.34
PF02153 258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 99.31
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 99.25
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 99.24
PLN02688 266 pyrroline-5-carboxylate reductase 99.23
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 99.2
PRK08655 437 prephenate dehydrogenase; Provisional 99.2
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.19
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 99.19
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 99.19
PLN02712 667 arogenate dehydrogenase 99.15
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.14
PRK08507 275 prephenate dehydrogenase; Validated 99.12
PRK12557 342 H(2)-dependent methylenetetrahydromethanopterin de 99.12
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 99.11
PLN02256 304 arogenate dehydrogenase 99.07
PRK08818 370 prephenate dehydrogenase; Provisional 99.02
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 99.01
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 98.97
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 98.97
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 98.96
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 98.96
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 98.9
TIGR01692 288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 98.9
KOG0409|consensus 327 98.85
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 98.8
PRK12491 272 pyrroline-5-carboxylate reductase; Reviewed 98.77
PRK15059 292 tartronate semialdehyde reductase; Provisional 98.72
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 98.7
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 98.7
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 98.68
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 98.66
cd01339 300 LDH-like_MDH L-lactate dehydrogenase-like malate d 98.65
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 98.65
TIGR01724 341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 98.65
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 98.63
PLN02712 667 arogenate dehydrogenase 98.63
PLN02858 1378 fructose-bisphosphate aldolase 98.62
PRK07680 273 late competence protein ComER; Validated 98.61
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 98.59
PRK07417279 arogenate dehydrogenase; Reviewed 98.57
PTZ00082 321 L-lactate dehydrogenase; Provisional 98.57
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 98.55
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 98.52
PRK06928 277 pyrroline-5-carboxylate reductase; Reviewed 98.48
PTZ00117 319 malate dehydrogenase; Provisional 98.47
TIGR03376 342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 98.44
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.44
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 98.42
PRK05479 330 ketol-acid reductoisomerase; Provisional 98.42
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 98.41
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 98.41
PRK06476 258 pyrroline-5-carboxylate reductase; Reviewed 98.4
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 98.4
PLN02858 1378 fructose-bisphosphate aldolase 98.39
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 98.34
PRK12480330 D-lactate dehydrogenase; Provisional 98.32
PRK06223 307 malate dehydrogenase; Reviewed 98.3
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.29
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 98.27
PLN02688266 pyrroline-5-carboxylate reductase 98.26
PRK06545359 prephenate dehydrogenase; Validated 98.26
PTZ00431 260 pyrroline carboxylate reductase; Provisional 98.25
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 98.24
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 98.23
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 98.17
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.16
PTZ00082321 L-lactate dehydrogenase; Provisional 98.15
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 98.14
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 98.1
COG0345 266 ProC Pyrroline-5-carboxylate reductase [Amino acid 98.07
PTZ00117319 malate dehydrogenase; Provisional 98.05
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 98.02
PLN03139386 formate dehydrogenase; Provisional 97.95
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.94
TIGR00112 245 proC pyrroline-5-carboxylate reductase. This enzym 97.94
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 97.94
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.91
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 97.9
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.9
PLN02353 473 probable UDP-glucose 6-dehydrogenase 97.9
PRK08655437 prephenate dehydrogenase; Provisional 97.9
PRK07574385 formate dehydrogenase; Provisional 97.89
PRK06444197 prephenate dehydrogenase; Provisional 97.79
PRK07502307 cyclohexadienyl dehydrogenase; Validated 97.79
COG4007 340 Predicted dehydrogenase related to H2-forming N5,N 97.78
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshi 97.66
PRK13243333 glyoxylate reductase; Reviewed 97.63
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 97.62
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 97.62
PRK08605332 D-lactate dehydrogenase; Validated 97.6
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 97.59
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 97.59
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 97.59
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 97.59
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.58
PRK06436303 glycerate dehydrogenase; Provisional 97.41
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 97.41
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 97.4
PLN02256304 arogenate dehydrogenase 97.38
PRK13403 335 ketol-acid reductoisomerase; Provisional 97.37
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 97.33
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 97.32
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 97.27
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.26
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 97.25
PRK06223307 malate dehydrogenase; Reviewed 97.24
COG1023 300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 97.15
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.12
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 97.08
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 97.06
PRK06487317 glycerate dehydrogenase; Provisional 97.02
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 96.97
PLN02928347 oxidoreductase family protein 96.92
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 96.88
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 96.85
TIGR00745 293 apbA_panE 2-dehydropantoate 2-reductase. This mode 96.77
PRK15076 431 alpha-galactosidase; Provisional 96.73
PRK08507275 prephenate dehydrogenase; Validated 96.72
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 96.71
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 96.67
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 96.65
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.63
KOG2711|consensus 372 96.6
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 96.49
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 96.47
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 96.46
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 96.39
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 96.39
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.39
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 96.38
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.37
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 96.34
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 96.26
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 96.24
PRK06932314 glycerate dehydrogenase; Provisional 96.22
cd00300 300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 96.12
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 96.0
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.95
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 95.86
TIGR01723 340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 95.86
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 95.81
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 95.67
PLN02306386 hydroxypyruvate reductase 95.65
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 95.63
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 95.61
PRK05479330 ketol-acid reductoisomerase; Provisional 95.6
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 95.5
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 95.5
PRK05225 487 ketol-acid reductoisomerase; Validated 95.49
PRK08818370 prephenate dehydrogenase; Provisional 95.49
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 95.48
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.46
PLN02494477 adenosylhomocysteinase 95.44
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.34
PRK00961 342 H(2)-dependent methylenetetrahydromethanopterin de 95.33
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 95.3
COG1893 307 ApbA Ketopantoate reductase [Coenzyme metabolism] 95.21
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.16
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 95.15
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 95.1
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 95.08
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.07
PRK06141314 ornithine cyclodeaminase; Validated 95.02
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 95.01
cd05296 419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 94.83
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 94.78
PRK07680273 late competence protein ComER; Validated 94.76
PLN00106 323 malate dehydrogenase 94.68
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 94.63
TIGR01771 299 L-LDH-NAD L-lactate dehydrogenase. This model repr 94.6
cd05197 425 GH4_glycoside_hydrolases Glycoside Hydrases Family 94.56
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 94.53
KOG2380|consensus 480 94.48
cd05298 437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 94.28
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.2
PTZ00075476 Adenosylhomocysteinase; Provisional 94.16
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 94.13
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 94.09
PTZ00431260 pyrroline carboxylate reductase; Provisional 94.06
PRK08229341 2-dehydropantoate 2-reductase; Provisional 94.04
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 93.95
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 93.86
PLN02602 350 lactate dehydrogenase 93.79
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 93.77
PRK13302 271 putative L-aspartate dehydrogenase; Provisional 93.76
PRK08618325 ornithine cyclodeaminase; Validated 93.74
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 93.67
PRK13304 265 L-aspartate dehydrogenase; Reviewed 93.62
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.55
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.54
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.48
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 93.31
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.04
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.96
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 92.96
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 92.89
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 92.87
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 92.86
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 92.8
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 92.74
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 92.7
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 92.66
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 92.62
PRK04148134 hypothetical protein; Provisional 92.59
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.51
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.45
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.34
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.07
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.94
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.94
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 91.89
TIGR01757 387 Malate-DH_plant malate dehydrogenase, NADP-depende 91.87
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 91.86
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 91.79
TIGR01723340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 91.68
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 91.64
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.64
COG0078310 ArgF Ornithine carbamoyltransferase [Amino acid tr 91.48
PRK07340304 ornithine cyclodeaminase; Validated 91.33
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 91.32
PLN00112 444 malate dehydrogenase (NADP); Provisional 91.3
PRK05086 312 malate dehydrogenase; Provisional 91.29
COG0569225 TrkA K+ transport systems, NAD-binding component [ 91.28
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 91.23
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.2
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.06
PRK12549284 shikimate 5-dehydrogenase; Reviewed 91.0
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.95
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.85
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 90.81
PRK05442 326 malate dehydrogenase; Provisional 90.26
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 90.21
PF0072597 3HCDH: 3-hydroxyacyl-CoA dehydrogenase, C-terminal 90.13
COG4074 343 Mth H2-forming N5,N10-methylenetetrahydromethanopt 89.92
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.87
COG0039 313 Mdh Malate/lactate dehydrogenases [Energy producti 89.76
KOG0069|consensus336 89.55
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.47
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 89.44
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 89.38
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 89.33
COG1712 255 Predicted dinucleotide-utilizing enzyme [General f 89.24
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 89.18
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 89.15
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 89.12
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 89.07
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 89.06
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 89.03
PRK06407301 ornithine cyclodeaminase; Provisional 89.0
KOG3124|consensus 267 88.97
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 88.94
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 88.92
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 88.85
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 88.79
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 88.69
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 88.46
PTZ00325 321 malate dehydrogenase; Provisional 88.41
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.39
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 88.15
PRK08291330 ectoine utilization protein EutC; Validated 88.03
PRK10669558 putative cation:proton antiport protein; Provision 88.03
PRK06046326 alanine dehydrogenase; Validated 87.85
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.77
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 87.75
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 87.74
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 87.58
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 87.13
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.07
PRK03659601 glutathione-regulated potassium-efflux system prot 86.8
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 86.66
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 86.49
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.24
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 86.22
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.19
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 86.16
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 86.12
PRK15059292 tartronate semialdehyde reductase; Provisional 86.02
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 86.01
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 85.74
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.41
PRK06823315 ornithine cyclodeaminase; Validated 85.35
KOG0068|consensus 406 85.27
cd06533171 Glyco_transf_WecG_TagA The glycosyltransferase Wec 85.26
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 85.1
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 84.81
PRK00048 257 dihydrodipicolinate reductase; Provisional 84.71
CHL00194 317 ycf39 Ycf39; Provisional 84.63
PLN00203519 glutamyl-tRNA reductase 84.47
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 84.26
COG2910211 Putative NADH-flavin reductase [General function p 84.26
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.13
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 83.97
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 83.93
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 83.78
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 83.68
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 83.36
PRK03692243 putative UDP-N-acetyl-D-mannosaminuronic acid tran 83.12
PRK12480330 D-lactate dehydrogenase; Provisional 83.1
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 82.9
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 82.86
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 82.83
PRK09496 453 trkA potassium transporter peripheral membrane com 82.46
PLN03075296 nicotianamine synthase; Provisional 82.06
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 82.02
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 81.91
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 81.82
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 81.6
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 81.59
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 81.55
COG4074343 Mth H2-forming N5,N10-methylenetetrahydromethanopt 81.35
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 81.14
PLN00135 309 malate dehydrogenase 81.13
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 81.11
COG0300265 DltE Short-chain dehydrogenases of various substra 80.8
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 80.67
KOG1014|consensus312 80.44
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
Probab=100.00  E-value=8e-44  Score=342.22  Aligned_cols=280  Identities=15%  Similarity=0.134  Sum_probs=205.9

Q ss_pred             CcHHhhcccCcEEEEcccCChHHHHHHHHHHHhhcCCCcEEeecCCCCChHHHhcccCCCCceeeeccCCCCCCCCeeeE
Q psy17416          2 PVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEI   81 (290)
Q Consensus         2 ~~l~~~~~~~d~viea~~e~~~~K~~~~~~~~~~~~~~~i~~snts~~~~~~l~~~~~~~~r~~g~hf~~P~~~~~lvEi   81 (290)
                      +|++ ++++||+|||||+|++++|+.+|+++++.|++++|++||||++++++|++.+.+|+|++|+|||||++.|+|+||
T Consensus        79 ~~~~-~~~~aDlViEav~E~~~vK~~vf~~l~~~~~~~ailasntStl~i~~la~~~~~p~r~~G~hff~Pa~v~~LvEv  157 (507)
T PRK08268         79 EALA-DLADCDLVVEAIVERLDVKQALFAQLEAIVSPDCILATNTSSLSITAIAAALKHPERVAGLHFFNPVPLMKLVEV  157 (507)
T ss_pred             CCHH-HhCCCCEEEEcCcccHHHHHHHHHHHHhhCCCCcEEEECCCCCCHHHHHhhcCCcccEEEEeecCCcccCeeEEE
Confidence            5675 578999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeCCCCCHHHHHHHHHHHHHhCCccEEEeccceeeEEecccchhHHHHHHHHHHcCceeEEecCCHHHHHHHHHH-----
Q psy17416         82 VPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIHGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNT-----  156 (290)
Q Consensus        82 v~~~~t~~~~~~~~~~~~~~lgk~~v~v~~d~~gf~~nri~G~~g~~ia~~~~~~G~~V~l~d~~~e~l~~a~~~-----  156 (290)
                      ++|..|++++++.+..+++++||.|+.+ +|+|||++||++..+..+...++.+.|       .+++++++++..     
T Consensus       158 v~g~~Ts~~~~~~~~~l~~~lgk~pv~v-~d~pGfi~Nrll~~~~~Ea~~l~~~g~-------~~~~~iD~al~~~~G~~  229 (507)
T PRK08268        158 VSGLATDPAVADALYALARAWGKTPVRA-KDTPGFIVNRAARPYYTEALRVLEEGV-------ADPATIDAILREAAGFR  229 (507)
T ss_pred             eCCCCCCHHHHHHHHHHHHHcCCceEEe-cCCCChHHHHHHHHHHHHHHHHHHcCC-------CCHHHHHHHHHhcCCCC
Confidence            9999999999999999999999999999 799999999999888888666655554       567777777642     


Q ss_pred             -----------HH---HHHHHHHHcCCCCCCCChhhhhcc---------------cccCCchHhhcccCcE--EEE----
Q psy17416        157 -----------IQ---HTLQDYHQKGCLKGSLSPEEQFGL---------------ISGTPVLRECLEDAIF--IQE----  201 (290)
Q Consensus       157 -----------i~---~~~~~~~~~g~~~~~~~~~~~~~~---------------i~~~~~l~~~l~~aDl--Vie----  201 (290)
                                 +.   +....+...........+...+..               ..+...-...-.+.+.  +..    
T Consensus       230 mGPf~l~D~~Gldv~~~v~~~~~~~~~~~~~~~~~~~~~~lv~~g~lG~ksG~GfY~y~~~~~~~~~~~~~~~~~~~~~~  309 (507)
T PRK08268        230 MGPFELMDLIGLDVNHAVMESVYRQFYQEPRFRPSLIQQELVAAGRLGRKSGQGFYRYADGAKQPPAEAAPPAALPPVWV  309 (507)
T ss_pred             cCHHHHHHHhchHHHHHHHHHHHHHhcCCCcCCccHHHHHHHHCCCCccccCCeeeECCCCCCCCCCCccccccCccccc
Confidence                       00   000011110000000100000000               1110000000000000  000    


Q ss_pred             --ccccchHHHHHHHHHH-------hhhCCCCcEEEeCCCCcCHHHHhccCCCCCcEEEeccCCCCCCCCeEEEecCCCC
Q psy17416        202 --SVPEILQIKHQVYRAI-------DIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWT  272 (290)
Q Consensus       202 --avpe~~~~k~~~~~~l-------~~~~~~~~ii~s~ts~~~~~~la~~~~~~~r~ig~Hf~~p~~~~~lvEvv~~~~t  272 (290)
                        ..+........++.+.       ...+.++++++++.++.+.+..+....+|+|++|+|||+|++.++++||+++++|
T Consensus       310 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~r~vg~Hf~~P~~~~~lvEvv~~~~T  389 (507)
T PRK08268        310 SADVEGDLAALARLLERLGATIETGEGPSADGLVLLAPTGGDTTTAAAREGLDAARVVLIDLLLDYAAAKRRTLMAAPAT  389 (507)
T ss_pred             cccccchhHHHHHHHHhhccccccccccccccceEeeccCcchHHHHHHhcCCcccEEEEeccCCcccCceEEEeCCCCC
Confidence              0011111112222111       2356788889888888888888877788999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHcCCC
Q psy17416        273 SERVITRTREIMTEIGMK  290 (290)
Q Consensus       273 ~~e~~~~~~~~~~~lgk~  290 (290)
                      ++++++++.+|++.+||+
T Consensus       390 s~e~~~~~~~~~~~~gk~  407 (507)
T PRK08268        390 SPAARDAAHALFQQDGKA  407 (507)
T ss_pred             CHHHHHHHHHHHHHcCCe
Confidence            999999999999999995



>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG2305|consensus Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1683|consensus Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>KOG2305|consensus Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1683|consensus Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>KOG0409|consensus Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>KOG2711|consensus Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>KOG2380|consensus Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PF00725 3HCDH: 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR006108 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG4074 Mth H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>KOG3124|consensus Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>KOG0068|consensus Back     alignment and domain information
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK03692 putative UDP-N-acetyl-D-mannosaminuronic acid transferase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>COG4074 Mth H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PLN00135 malate dehydrogenase Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
3f3s_A 313 The Crystal Structure Of Human Lambda-Crystallin, C 8e-35
3ado_A 319 Crystal Structure Of The Rabbit L-Gulonate 3-Dehydr 2e-32
3hdh_A 302 Pig Heart Short Chain L-3-Hydroxyacyl Coa Dehydroge 2e-05
1f12_A 310 L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With 3- 3e-05
4dyd_A 283 Substrate-Directed Dual Catalysis Of Dicarbonyl Com 3e-05
1lso_A 302 Crystal Structure Of The S137a Mutant Of L-3-Hydrox 6e-05
1f0y_A 302 L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With Ac 6e-05
1m75_A 302 Crystal Structure Of The N208s Mutant Of L-3-Hydrox 6e-05
2wtb_A 725 Arabidopsis Thaliana Multifuctional Protein, Mfp2 L 7e-05
1m76_A 302 Crystal Structure Of The S137c Mutant Of L-3-Hydrox 8e-05
1lsj_A 302 Crystal Structure Of The E110q Mutant Of L-3-hydrox 2e-04
1il0_A 302 X-Ray Crystal Structure Of The E170q Mutant Of Huma 2e-04
1zej_A 293 Crystal Structure Of The 3-Hydroxyacyl-Coa Dehydrog 2e-04
3had_A 308 Biochemical Characterization And Structure Determin 8e-04
>pdb|3F3S|A Chain A, The Crystal Structure Of Human Lambda-Crystallin, Cryl1 Length = 313 Back     alignment and structure

Iteration: 1

Score = 144 bits (362), Expect = 8e-35, Method: Compositional matrix adjust. Identities = 72/166 (43%), Positives = 100/166 (60%) Query: 123 GLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGL 182 G+IG++WAM+FAS G++V LYD+ +QI NA I+ ++ Q G LKGSLS EEQ L Sbjct: 12 GVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEEQLSL 71 Query: 183 ISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMXXXXXXXXXXXXXXXXXXXEH 242 ISG P ++E +E A+ IQE VPE L++K +++ +D + Sbjct: 72 ISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAG 131 Query: 243 STHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIG 288 H Q IVAHPVNPPY+IPLVE+VP T+ + RT +M +IG Sbjct: 132 LVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIG 177
>pdb|3ADO|A Chain A, Crystal Structure Of The Rabbit L-Gulonate 3-Dehydrogenase Length = 319 Back     alignment and structure
>pdb|3HDH|A Chain A, Pig Heart Short Chain L-3-Hydroxyacyl Coa Dehydrogenase Revisited: Sequence Analysis And Crystal Structure Determination Length = 302 Back     alignment and structure
>pdb|1F12|A Chain A, L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With 3- Hydroxybutyryl-Coa Length = 310 Back     alignment and structure
>pdb|4DYD|A Chain A, Substrate-Directed Dual Catalysis Of Dicarbonyl Compounds By Diketoreductase Length = 283 Back     alignment and structure
>pdb|1LSO|A Chain A, Crystal Structure Of The S137a Mutant Of L-3-Hydroxyacyl- Coa Dehydrogenase In Complex With Nad Length = 302 Back     alignment and structure
>pdb|1F0Y|A Chain A, L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With Acetoacetyl-Coa And Nad+ Length = 302 Back     alignment and structure
>pdb|1M75|A Chain A, Crystal Structure Of The N208s Mutant Of L-3-Hydroxyacyl- Coa Dehydrogenase In Complex With Nad And Acetoacetyl-Coa Length = 302 Back     alignment and structure
>pdb|2WTB|A Chain A, Arabidopsis Thaliana Multifuctional Protein, Mfp2 Length = 725 Back     alignment and structure
>pdb|1M76|A Chain A, Crystal Structure Of The S137c Mutant Of L-3-Hydroxyacyl- Coa Dehydrogenase In Complex With Nad And Acetoacetyl-Coa Length = 302 Back     alignment and structure
>pdb|1LSJ|A Chain A, Crystal Structure Of The E110q Mutant Of L-3-hydroxyacyl- Coa Dehydrogenase In Complex With Nad Length = 302 Back     alignment and structure
>pdb|1IL0|A Chain A, X-Ray Crystal Structure Of The E170q Mutant Of Human L-3- Hydroxyacyl-Coa Dehydrogenase Length = 302 Back     alignment and structure
>pdb|1ZEJ|A Chain A, Crystal Structure Of The 3-Hydroxyacyl-Coa Dehydrogenase (Hbd-9, Af2017) From Archaeoglobus Fulgidus Dsm 4304 At 2.00 A Resolution Length = 293 Back     alignment and structure
>pdb|3HAD|A Chain A, Biochemical Characterization And Structure Determination Of Human Heart Short Chain L-3-Hydroxyacyl Coa Dehydrogenase Provide Insight Into Catalytic Mechanism Length = 308 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 8e-71
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 9e-54
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 7e-26
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 2e-17
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 3e-25
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 8e-17
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 5e-06
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 2e-22
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 1e-14
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 3e-22
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 9e-14
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 5e-22
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 2e-14
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 8e-22
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 3e-14
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 1e-21
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 6e-17
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 1e-19
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Length = 302 Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Length = 302 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Length = 483 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Length = 483 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Length = 483 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Length = 463 Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Length = 463 Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Length = 293 Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Length = 293 Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Length = 460 Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Length = 460 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query290
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 100.0
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 100.0
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 100.0
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 100.0
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 100.0
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 100.0
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 99.98
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 99.97
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 99.97
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.96
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.96
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.96
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.96
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.95
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.95
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.95
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.95
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.95
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.95
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.94
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.94
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.94
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 99.64
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.6
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.58
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 99.4
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 99.31
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 99.3
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.29
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 99.29
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.26
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.24
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 99.24
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 99.24
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.24
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 99.2
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 99.16
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 99.15
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.14
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.14
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.13
3qha_A 296 Putative oxidoreductase; seattle structural genomi 99.11
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.09
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.09
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.08
2rcy_A 262 Pyrroline carboxylate reductase; malaria, structur 99.07
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 99.03
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 99.02
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 99.0
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 98.99
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 98.99
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 98.98
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 98.98
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 98.96
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 98.95
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 98.94
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 98.93
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 98.91
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 98.9
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 98.87
4ezb_A 317 Uncharacterized conserved protein; structural geno 98.86
3dfu_A 232 Uncharacterized protein from 6-phosphogluconate de 98.84
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 98.83
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 98.82
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 98.82
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 98.81
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 98.8
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 98.8
2i76_A 276 Hypothetical protein; NADP, dehydrogenase, TM1727, 98.79
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 98.77
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 98.74
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 98.71
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 98.7
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 98.69
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 98.68
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 98.68
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 98.67
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 98.66
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 98.65
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 98.64
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 98.63
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 98.62
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 98.59
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 98.58
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 98.58
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 98.56
1i36_A 264 Conserved hypothetical protein MTH1747; NADP bindi 98.55
2i6t_A 303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 98.53
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 98.52
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 98.51
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 98.48
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 98.45
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 98.45
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 98.44
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 98.4
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 98.4
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 98.37
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 98.36
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 98.35
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 98.35
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 98.35
4fgw_A 391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 98.34
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 98.34
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 98.33
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 98.31
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 98.3
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 98.29
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 98.28
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 98.27
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 98.26
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 98.25
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 98.23
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 98.21
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 98.2
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.19
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 98.18
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 98.18
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 98.16
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 98.16
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 98.14
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 98.14
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 98.13
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 98.12
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 98.06
2d4a_B 308 Malate dehydrogenase; archaea, hyperthermophIle, o 98.05
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 98.05
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 98.05
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 98.04
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 98.02
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 98.01
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 98.01
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 98.0
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 97.96
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 97.95
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 97.95
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 97.94
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.93
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 97.92
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 97.9
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 97.12
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 97.88
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 97.88
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 97.87
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 97.87
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.87
3qha_A296 Putative oxidoreductase; seattle structural genomi 97.86
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 97.84
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 97.83
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.81
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 97.79
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.78
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.77
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 97.74
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.74
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.73
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.73
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.73
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 97.71
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 97.7
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 97.7
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.68
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 97.67
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 97.66
3tl2_A 315 Malate dehydrogenase; center for structural genomi 97.66
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 97.65
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 97.65
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.64
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 97.62
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.61
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 97.6
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 97.6
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 97.6
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 97.58
1yb4_A295 Tartronic semialdehyde reductase; structural genom 97.57
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 97.55
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 97.54
1vpd_A299 Tartronate semialdehyde reductase; structural geno 97.51
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 97.51
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 97.5
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 97.5
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 97.49
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 97.49
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 97.47
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.46
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 97.43
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 97.4
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 97.4
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 97.34
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 97.34
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 97.32
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 97.3
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 97.3
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 97.28
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 97.25
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 97.21
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.15
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 97.14
4ezb_A317 Uncharacterized conserved protein; structural geno 97.1
3l6d_A306 Putative oxidoreductase; structural genomics, prot 97.1
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 97.04
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 97.04
1s6y_A 450 6-phospho-beta-glucosidase; hydrolase, structural 97.03
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 96.98
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 96.98
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 96.95
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 96.95
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 96.91
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.86
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 96.82
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 96.81
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 96.79
3ctv_A110 HBD-10, 3-hydroxyacyl-COA dehydrogenase; structura 96.75
3g17_A 294 Similar to 2-dehydropantoate 2-reductase; structur 96.69
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 96.62
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 96.6
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 96.6
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 96.6
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 96.58
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.52
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 96.52
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 96.51
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.5
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 96.49
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.47
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 96.43
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 96.38
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.38
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.37
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 96.37
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 96.36
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 96.3
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 96.29
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 96.26
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 96.24
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.19
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 96.17
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 96.17
2rir_A300 Dipicolinate synthase, A chain; structural genomic 96.16
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 96.14
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 96.11
2xxj_A 310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 96.04
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 96.01
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 96.01
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 96.0
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.97
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 95.96
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 95.93
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.93
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 95.79
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 95.74
1o6z_A 303 MDH, malate dehydrogenase; halophilic, ION-binding 95.73
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 95.72
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 95.72
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 95.69
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 95.59
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 95.58
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 95.56
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 95.55
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 95.55
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 95.53
2b0j_A 358 5,10-methenyltetrahydromethanopterin hydrogenase; 95.49
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 95.48
1up7_A 417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 95.42
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 95.41
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 95.32
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 95.29
2x0j_A 294 Malate dehydrogenase; oxidoreductase, hyperthermop 95.23
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 95.23
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 95.08
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 94.97
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 94.75
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 94.7
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 94.7
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 94.68
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 94.67
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 94.66
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.57
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 94.41
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 94.15
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 94.13
3u95_A 477 Glycoside hydrolase, family 4; hydrolysis, cytosol 94.08
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 93.98
4h7p_A 345 Malate dehydrogenase; ssgcid, structural G seattle 93.7
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 93.65
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 93.59
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 93.56
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 93.53
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 93.49
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 93.34
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 93.28
2duw_A145 Putative COA-binding protein; ligand binding prote 93.25
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 93.16
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 92.96
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 92.87
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 92.76
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 92.68
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 92.68
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 92.62
5mdh_A 333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 92.61
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 92.48
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 92.33
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 92.32
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 92.28
3hhp_A 312 Malate dehydrogenase; MDH, citric acid cycle, TCA 92.26
3tl2_A315 Malate dehydrogenase; center for structural genomi 92.24
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 92.11
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 92.0
1id1_A153 Putative potassium channel protein; RCK domain, E. 91.91
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 91.84
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 91.46
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 91.17
1hye_A 313 L-lactate/malate dehydrogenase; nucleotide binding 91.14
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 91.05
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 90.89
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 90.73
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 90.58
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 90.56
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 90.49
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 90.09
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 89.96
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 89.96
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 89.79
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 89.56
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 89.34
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 89.18
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 89.15
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 88.95
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 88.88
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 88.84
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 88.81
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 88.67
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 88.49
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 88.33
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 88.26
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 88.15
4f3y_A 272 DHPR, dihydrodipicolinate reductase; structural ge 88.07
1iuk_A140 Hypothetical protein TT1466; structural genomics, 88.05
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 88.02
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 87.85
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 87.34
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 87.25
3qy9_A 243 DHPR, dihydrodipicolinate reductase; rossmann fold 86.45
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 86.43
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 86.35
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 86.34
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 86.27
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 85.97
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 85.97
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 85.89
3u95_A477 Glycoside hydrolase, family 4; hydrolysis, cytosol 85.84
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 85.19
2d59_A144 Hypothetical protein PH1109; COA binding, structur 85.18
3fbg_A346 Putative arginate lyase; structural genomics, unkn 84.9
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 84.88
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 84.59
3p2o_A285 Bifunctional protein fold; structural genomics, ce 84.34
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 84.27
7mdh_A 375 Protein (malate dehydrogenase); chloroplastic mala 84.06
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 84.04
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 83.9
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 83.74
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 84.04
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 83.47
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 83.28
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 82.74
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 82.16
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 82.15
4amu_A365 Ornithine carbamoyltransferase, catabolic; ornithi 82.12
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 82.06
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 82.06
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 82.04
3l07_A285 Bifunctional protein fold; structural genomics, ID 82.0
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 81.62
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 81.61
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 81.37
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 81.22
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 81.07
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 80.99
1ydw_A 362 AX110P-like protein; structural genomics, protein 80.96
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 80.7
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 80.65
4g65_A 461 TRK system potassium uptake protein TRKA; structur 80.17
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-44  Score=326.53  Aligned_cols=148  Identities=39%  Similarity=0.592  Sum_probs=141.4

Q ss_pred             CCcHHhhcccCcEEEEcccCChHHHHHHHHHHHhhcCCCcEEeecCCCCChHHHhcccCCCCceeeeccCCCCCCCCeee
Q psy17416          1 TPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVE   80 (290)
Q Consensus         1 ~~~l~~~~~~~d~viea~~e~~~~K~~~~~~~~~~~~~~~i~~snts~~~~~~l~~~~~~~~r~~g~hf~~P~~~~~lvE   80 (290)
                      ++|+++++++||+|||||+|++++|+++|++||++|+||||||||||+|++++|++.++||+||+|+||||||++|||||
T Consensus        78 ~~~l~~a~~~ad~ViEav~E~l~iK~~lf~~l~~~~~~~aIlaSNTSsl~is~ia~~~~~p~r~ig~HffNP~~~m~LVE  157 (319)
T 3ado_A           78 CTNLAEAVEGVVHIQECVPENLDLKRKIFAQLDSIVDDRVVLSSSSSCLLPSKLFTGLAHVKQCIVAHPVNPPYYIPLVE  157 (319)
T ss_dssp             ECCHHHHTTTEEEEEECCCSCHHHHHHHHHHHHTTCCSSSEEEECCSSCCHHHHHTTCTTGGGEEEEEECSSTTTCCEEE
T ss_pred             ccchHhHhccCcEEeeccccHHHHHHHHHHHHHHHhhhcceeehhhhhccchhhhhhccCCCcEEEecCCCCccccchHH
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeeCCCCCHHHHHHHHHHHHHhCCccEEEeccceeeEEecccchhHHHHHHHHHHcCceeEEecCCHHHHHHHHH
Q psy17416         81 IVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIHGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKN  155 (290)
Q Consensus        81 iv~~~~t~~~~~~~~~~~~~~lgk~~v~v~~d~~gf~~nri~G~~g~~ia~~~~~~G~~V~l~d~~~e~l~~a~~  155 (290)
                      ||+|+.||+++++.+.+|++++||+|+++++|+|||++||++..+.++...++..++       .+++++|+++.
T Consensus       158 iv~g~~Ts~~~~~~~~~~~~~~gk~pv~v~kd~pGFi~NRl~~~~~~EA~~lv~eGv-------as~edID~~~~  225 (319)
T 3ado_A          158 LVPHPETSPATVDRTHALMRKIGQSPVRVLKEIDGFVLNRLQYAIISEAWRLVEEGI-------VSPSDLDLVMS  225 (319)
T ss_dssp             EEECTTCCHHHHHHHHHHHHHTTCEEEECSSCCTTTTHHHHHHHHHHHHHHHHHTTS-------SCHHHHHHHHH
T ss_pred             hcCCCCCcHHHHHHHHHHHHHhCCccCCcCCCCCCEeHHHHHHHHHHHHHHHHHhCC-------CCHHHHHHHHH
Confidence            999999999999999999999999999888999999999999999999777776654       78999999886



>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3ctv_A HBD-10, 3-hydroxyacyl-COA dehydrogenase; structural genomics, APC7539, PSI-2, protein structure initiative; 2.46A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 290
d1f0ya2192 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA 2e-25
d1f0ya2192 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA 4e-16
d1wdka3186 c.2.1.6 (A:311-496) Fatty oxidation complex alpha 3e-23
d1wdka3186 c.2.1.6 (A:311-496) Fatty oxidation complex alpha 2e-15
d2b0ja2242 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopt 6e-08
d2b0ja2242 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopt 2e-07
d1bg6a2184 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin 0.002
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Short chain L-3-hydroxyacyl CoA dehydrogenase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 98.1 bits (243), Expect = 2e-25
 Identities = 39/172 (22%), Positives = 83/172 (48%), Gaps = 4/172 (2%)

Query: 123 GLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLK----GSLSPEE 178
           GL+G   A + A+ G+ V L D   + +  +K  I+ +L+   +K   +    G    E+
Sbjct: 13  GLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEK 72

Query: 179 QFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSV 238
               I+ +      +     + E++ E L++K+++++ +D F + +TI +S+TSS   + 
Sbjct: 73  TLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITS 132

Query: 239 LSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMK 290
           ++  +T + +F   H  NP   + LVE++    TS++      +    +G  
Sbjct: 133 IANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKH 184


>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Length = 186 Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Length = 186 Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 242 Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 242 Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query290
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 100.0
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 100.0
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 100.0
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 100.0
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.62
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 99.52
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.51
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 99.27
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.2
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.17
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.08
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 98.96
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 98.91
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 98.86
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 98.8
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 98.78
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.68
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 98.5
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 98.49
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 98.26
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 98.23
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 98.21
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 98.01
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.66
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.36
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 97.3
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.23
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.16
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.11
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 97.1
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.04
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.0
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.99
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 96.79
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.68
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.62
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 96.62
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.6
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.57
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 96.53
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.49
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.38
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 96.36
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 96.31
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.26
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 96.19
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 96.18
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.18
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 96.12
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.05
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.02
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 95.89
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 95.89
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 95.85
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 95.69
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.66
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 95.62
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 95.56
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.46
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 95.38
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 95.1
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.07
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 94.77
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 94.72
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 94.43
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 94.37
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 94.34
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.21
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 94.07
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 93.68
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 93.46
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.03
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 92.91
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 92.76
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.71
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 92.59
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 92.13
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 91.55
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 91.52
d1f0ya199 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 90.47
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 90.14
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 89.7
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 89.11
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 88.82
d1wdka1124 Fatty oxidation complex alpha subunit, C-terminal 88.77
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 88.65
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 88.5
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 88.48
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 88.46
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 88.44
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 88.29
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 88.15
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 88.04
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 87.74
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 87.65
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 87.17
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 87.05
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 87.04
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 86.79
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 86.6
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 86.56
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 86.54
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 86.21
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 86.04
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 85.91
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 85.86
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 85.66
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 85.44
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 84.86
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 84.83
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 84.75
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 84.66
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 84.52
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 84.49
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 84.41
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 83.73
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 83.71
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 83.64
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 83.47
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 83.12
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 82.98
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 82.83
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 82.51
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 82.15
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 82.11
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 81.78
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 81.78
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 81.77
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 81.6
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 81.17
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 81.12
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 80.97
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 80.88
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 80.33
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Short chain L-3-hydroxyacyl CoA dehydrogenase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.2e-39  Score=273.86  Aligned_cols=169  Identities=22%  Similarity=0.371  Sum_probs=158.6

Q ss_pred             cchhHHHHHHHHHHcCceeEEecCCHHHHHHHHHHHHHHHHHHHHcCCCCCCCC----hhhhhcccccCCchHhhcccCc
Q psy17416        122 HGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLS----PEEQFGLISGTPVLRECLEDAI  197 (290)
Q Consensus       122 ~G~~g~~ia~~~~~~G~~V~l~d~~~e~l~~a~~~i~~~~~~~~~~g~~~~~~~----~~~~~~~i~~~~~l~~~l~~aD  197 (290)
                      +|.||++||..++..|++|.+||++++.++++.+++++.++.+++++.......    ....+.++.+++|+.+++++||
T Consensus        12 aG~mG~~iA~~~a~~G~~V~l~D~~~~~l~~a~~~i~~~l~~~~~~~~~~~~~~~~~~~~~~l~~i~~~~d~~~a~~~ad   91 (192)
T d1f0ya2          12 GGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTD   91 (192)
T ss_dssp             CSHHHHHHHHHHHHTTCEEEEECSCHHHHHHHHHHHHHHHHHHHHTTSSSCHHHHHHHHHHHHHTEEEESCHHHHTTSCS
T ss_pred             cCHHHHHHHHHHHhCCCcEEEEECChHHHHHHHhhHHHHHHHHHHhhhhccchhhHHHHHHHHhhccccchhHhhhcccc
Confidence            699999999999999999999999999999999999999999998887654211    2345688999999999999999


Q ss_pred             EEEEccccchHHHHHHHHHHhhhCCCCcEEEeCCCCcCHHHHhccCCCCCcEEEeccCCCCCCCCeEEEecCCCCCHHHH
Q psy17416        198 FIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVI  277 (290)
Q Consensus       198 lVieavpe~~~~k~~~~~~l~~~~~~~~ii~s~ts~~~~~~la~~~~~~~r~ig~Hf~~p~~~~~lvEvv~~~~t~~e~~  277 (290)
                      +||||+||++++|+++|++|++.+++++||+||||++++++++..+.+|+||+|+||||||+.+|+|||++|++|+++++
T Consensus        92 ~ViEav~E~l~~K~~v~~~l~~~~~~~~ilasnTS~l~i~~la~~~~~p~r~ig~HffnP~~~~~lVEIv~g~~T~~~~i  171 (192)
T d1f0ya2          92 LVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTF  171 (192)
T ss_dssp             EEEECCCSCHHHHHHHHHHHTTTSCTTCEEEECCSSSCHHHHHTTSSCGGGEEEEEECSSTTTCCEEEEECCTTCCHHHH
T ss_pred             eehhhcccchhHHHHHHHHHhhhcccCceeeccCcccccchhhhhccCHhHEEeeccccccCcccEEEEcCCCCCCHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHcCCC
Q psy17416        278 TRTREIMTEIGMK  290 (290)
Q Consensus       278 ~~~~~~~~~lgk~  290 (290)
                      +++.+|++.+||+
T Consensus       172 ~~~~~~~~~lgk~  184 (192)
T d1f0ya2         172 ESLVDFSKALGKH  184 (192)
T ss_dssp             HHHHHHHHHTTCE
T ss_pred             HHHHHHHHHcCCE
Confidence            9999999999984



>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f0ya1 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka1 a.100.1.3 (A:497-620) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure