Psyllid ID: psy17417

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MAELLQTERTYVKDLDTCIKVFLQESRSHPNLPPGLVGKHDIIFGNIEEIRDFHRDIFLKELEKYENMPEDLGHCFVTWWWFVRPKT
cHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEccHHHHHHHHHHHHHHHHHHHHHccHHHccEEEEEEEEccccc
MAELLQTERTYVKDLDTCIKVFLQesrshpnlppglvgkhdiifgNIEEIRDFHRDIFLKELEKyenmpedlghcfvtwwwfvrpkt
MAELLQTERTYVKDLDTCIKVFLQesrshpnlppglvgkHDIIFGNIEEIRDFHRDIFLKELEKYENMPEDLGHCFVTWWWFVRPKT
MAELLQTERTYVKDLDTCIKVFLQESRSHPNLPPGLVGKHDIIFGNIEEIRDFHRDIFLKELEKYENMPEDLGHCFVTWWWFVRPKT
********RTYVKDLDTCIKVFLQESR**PNLPPGLVGKHDIIFGNIEEIRDFHRDIFLKELEKYENMPEDLGHCFVTWWWFV****
MAELLQTERTYVKDLDTCIKVFLQESRSHPNL***LVGKHDIIFGNIEEIRDFHRDIFLKELEKYENMPEDLGHCFVTWWWFVRP**
MAELLQTERTYVKDLDTCIKVFLQESRSHPNLPPGLVGKHDIIFGNIEEIRDFHRDIFLKELEKYENMPEDLGHCFVTWWWFVRPKT
MAELLQTERTYVKDLDTCIKVFLQESRSHPNLPPGLVGKHDIIFGNIEEIRDFHRDIFLKELEKYENMPEDLGHCFVTWWWFVR***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAELLQTERTYVKDLDTCIKVFLQESRSHPNLPPGLVGKHDIIFGNIEEIRDFHRDIFLKELEKYENMPEDLGHCFVTWWWFVRPKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
A2CG49 2964 Kalirin OS=Mus musculus G yes N/A 0.908 0.026 0.637 5e-25
O60229 2985 Kalirin OS=Homo sapiens G yes N/A 0.908 0.026 0.637 5e-25
P97924 2959 Kalirin OS=Rattus norvegi yes N/A 0.908 0.026 0.637 5e-25
Q0KL02 3102 Triple functional domain no N/A 0.908 0.025 0.612 9e-24
O75962 3097 Triple functional domain no N/A 0.908 0.025 0.612 9e-24
Q1LUA6 3028 Triple functional domain yes N/A 0.908 0.026 0.587 2e-23
Q96PX9 1271 Pleckstrin homology domai no N/A 0.873 0.059 0.428 5e-12
O15068 1137 Guanine nucleotide exchan no N/A 0.873 0.066 0.456 1e-11
P10911 925 Proto-oncogene DBL OS=Hom no N/A 0.873 0.082 0.444 6e-11
Q58EX7 1191 Puratrophin-1 OS=Homo sap no N/A 0.873 0.063 0.376 1e-09
>sp|A2CG49|KALRN_MOUSE Kalirin OS=Mus musculus GN=Kalrn PE=1 SV=1 Back     alignment and function desciption
 Score =  112 bits (281), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 51/80 (63%), Positives = 63/80 (78%), Gaps = 1/80 (1%)

Query: 1    MAELLQTERTYVKDLDTCIKVFLQESRSH-PNLPPGLVGKHDIIFGNIEEIRDFHRDIFL 59
            MAELLQTE+ YV+DL  C++ +L E  S    +PPG++ K  IIFGNI+EI DFH +IFL
Sbjct: 1259 MAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHIIFGNIQEIYDFHNNIFL 1318

Query: 60   KELEKYENMPEDLGHCFVTW 79
            KELEKYE +PED+GHCFVTW
Sbjct: 1319 KELEKYEQLPEDVGHCFVTW 1338
Promotes the exchange of GDP by GTP. Activates specific Rho GTPase family members, thereby inducing various signaling mechanisms that regulate neuronal shape, growth, and plasticity, through their effects on the actin cytoskeleton. Induces lamellipodia independent of its GEF activity.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|O60229|KALRN_HUMAN Kalirin OS=Homo sapiens GN=KALRN PE=1 SV=2 Back     alignment and function description
>sp|P97924|KALRN_RAT Kalirin OS=Rattus norvegicus GN=Kalrn PE=1 SV=3 Back     alignment and function description
>sp|Q0KL02|TRIO_MOUSE Triple functional domain protein OS=Mus musculus GN=Trio PE=1 SV=3 Back     alignment and function description
>sp|O75962|TRIO_HUMAN Triple functional domain protein OS=Homo sapiens GN=TRIO PE=1 SV=2 Back     alignment and function description
>sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 Back     alignment and function description
>sp|Q96PX9|PKH4B_HUMAN Pleckstrin homology domain-containing family G member 4B OS=Homo sapiens GN=PLEKHG4B PE=2 SV=4 Back     alignment and function description
>sp|O15068|MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens GN=MCF2L PE=1 SV=2 Back     alignment and function description
>sp|P10911|MCF2_HUMAN Proto-oncogene DBL OS=Homo sapiens GN=MCF2 PE=1 SV=3 Back     alignment and function description
>sp|Q58EX7|PKHG4_HUMAN Puratrophin-1 OS=Homo sapiens GN=PLEKHG4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
328706376 2254 PREDICTED: triple functional domain prot 0.827 0.031 0.746 8e-30
328706380 2247 PREDICTED: triple functional domain prot 0.827 0.032 0.746 8e-30
328706374 2227 PREDICTED: triple functional domain prot 0.827 0.032 0.746 9e-30
328706378 2220 PREDICTED: triple functional domain prot 0.827 0.032 0.746 1e-29
194748609 2260 GF10082 [Drosophila ananassae] gi|190624 0.839 0.032 0.721 3e-28
195125141 2277 GI12715 [Drosophila mojavensis] gi|19391 0.885 0.033 0.734 7e-28
198463564 2398 GA28275 [Drosophila pseudoobscura pseudo 0.839 0.030 0.696 9e-28
195175661 1688 GL16679 [Drosophila persimilis] gi|19410 0.908 0.046 0.696 1e-27
345483533 3031 PREDICTED: kalirin-like [Nasonia vitripe 0.908 0.026 0.712 1e-27
270003787 2475 hypothetical protein TcasGA2_TC003063 [T 0.862 0.030 0.734 1e-27
>gi|328706376|ref|XP_003243073.1| PREDICTED: triple functional domain protein-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 59/79 (74%), Positives = 69/79 (87%)

Query: 1    MAELLQTERTYVKDLDTCIKVFLQESRSHPNLPPGLVGKHDIIFGNIEEIRDFHRDIFLK 60
            MAELLQTERTYVKDLD CIK +L E R+  N+P GL G+ DI+FGNIE+IR+FHRD+F+K
Sbjct: 1287 MAELLQTERTYVKDLDVCIKAYLDEIRALQNVPIGLHGRIDILFGNIEDIRNFHRDVFIK 1346

Query: 61   ELEKYENMPEDLGHCFVTW 79
            ELEKYE MPED+GHCFVTW
Sbjct: 1347 ELEKYETMPEDVGHCFVTW 1365

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328706380|ref|XP_003243075.1| PREDICTED: triple functional domain protein-like isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328706374|ref|XP_003243072.1| PREDICTED: triple functional domain protein-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328706378|ref|XP_003243074.1| PREDICTED: triple functional domain protein-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|194748609|ref|XP_001956737.1| GF10082 [Drosophila ananassae] gi|190624019|gb|EDV39543.1| GF10082 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195125141|ref|XP_002007041.1| GI12715 [Drosophila mojavensis] gi|193918650|gb|EDW17517.1| GI12715 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|198463564|ref|XP_002135528.1| GA28275 [Drosophila pseudoobscura pseudoobscura] gi|198151312|gb|EDY74155.1| GA28275 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195175661|ref|XP_002028548.1| GL16679 [Drosophila persimilis] gi|194104875|gb|EDW26918.1| GL16679 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|345483533|ref|XP_001599496.2| PREDICTED: kalirin-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|270003787|gb|EFA00235.1| hypothetical protein TcasGA2_TC003063 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
FB|FBgn0024277 2263 trio "trio" [Drosophila melano 0.908 0.034 0.670 8.5e-25
UNIPROTKB|I3L9A9 335 I3L9A9 "Uncharacterized protei 0.908 0.235 0.612 2.9e-23
UNIPROTKB|F1M462 1360 Kalrn "Kalirin" [Rattus norveg 0.908 0.058 0.637 3.6e-23
UNIPROTKB|I3L821 1406 KALRN "Uncharacterized protein 0.908 0.056 0.637 3.8e-23
UNIPROTKB|F1M4V6 1621 Kalrn "Kalirin" [Rattus norveg 0.908 0.048 0.637 4.6e-23
UNIPROTKB|C9IZQ6 1654 KALRN "HCG2022551, isoform CRA 0.908 0.047 0.637 4.7e-23
UNIPROTKB|F1PUI1 2201 KALRN "Uncharacterized protein 0.908 0.035 0.637 6.7e-23
UNIPROTKB|I3LAJ5 2863 KALRN "Uncharacterized protein 0.908 0.027 0.637 9.2e-23
UNIPROTKB|F1LZV1 2934 Kalrn "Kalirin" [Rattus norveg 0.908 0.026 0.637 9.4e-23
UNIPROTKB|F1M257 2935 Kalrn "Kalirin" [Rattus norveg 0.908 0.026 0.637 9.4e-23
FB|FBgn0024277 trio "trio" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 299 (110.3 bits), Expect = 8.5e-25, P = 8.5e-25
 Identities = 53/79 (67%), Positives = 65/79 (82%)

Query:     1 MAELLQTERTYVKDLDTCIKVFLQESRSHPNLPPGLVGKHDIIFGNIEEIRDFHRDIFLK 60
             MAEL+QTER YV DL TCIK FL+E R+  ++P  L+G+ D+IFGNI+EI  FH+ IFL+
Sbjct:  1288 MAELMQTERAYVNDLATCIKCFLEEFRAGKSVPSALIGQEDVIFGNIKEIHHFHQKIFLR 1347

Query:    61 ELEKYENMPEDLGHCFVTW 79
             ELEKYE MPED+GHCFVTW
Sbjct:  1348 ELEKYETMPEDVGHCFVTW 1366
GO:0005089 "Rho guanyl-nucleotide exchange factor activity" evidence=ISS;IDA;NAS
GO:0007422 "peripheral nervous system development" evidence=IGI;IMP
GO:0007411 "axon guidance" evidence=IGI;IMP;TAS
GO:0007417 "central nervous system development" evidence=IGI;IMP
GO:0030036 "actin cytoskeleton organization" evidence=IEP;IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0007266 "Rho protein signal transduction" evidence=IDA
GO:0035023 "regulation of Rho protein signal transduction" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005543 "phospholipid binding" evidence=IEA
GO:0050770 "regulation of axonogenesis" evidence=IGI
GO:0016319 "mushroom body development" evidence=IMP
GO:0048675 "axon extension" evidence=IMP
GO:0045887 "positive regulation of synaptic growth at neuromuscular junction" evidence=IMP
GO:0071772 "response to BMP stimulus" evidence=IGI
GO:0007412 "axon target recognition" evidence=IGI
GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
UNIPROTKB|I3L9A9 I3L9A9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1M462 Kalrn "Kalirin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3L821 KALRN "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1M4V6 Kalrn "Kalirin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|C9IZQ6 KALRN "HCG2022551, isoform CRA_j" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PUI1 KALRN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LAJ5 KALRN "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1LZV1 Kalrn "Kalirin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M257 Kalrn "Kalirin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O60229KALRN_HUMAN2, ., 7, ., 1, 1, ., 10.63750.90800.0264yesN/A
P97924KALRN_RAT2, ., 7, ., 1, 1, ., 10.63750.90800.0266yesN/A
A2CG49KALRN_MOUSE2, ., 7, ., 1, 1, ., 10.63750.90800.0266yesN/A
Q1LUA6TRIO_DANRE2, ., 7, ., 1, 1, ., 10.58750.90800.0260yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
pfam00621179 pfam00621, RhoGEF, RhoGEF domain 2e-19
smart00325180 smart00325, RhoGEF, Guanine nucleotide exchange fa 9e-18
cd00160181 cd00160, RhoGEF, Guanine nucleotide exchange facto 1e-16
>gnl|CDD|216028 pfam00621, RhoGEF, RhoGEF domain Back     alignment and domain information 
 Score = 76.9 bits (190), Expect = 2e-19
 Identities = 32/82 (39%), Positives = 48/82 (58%), Gaps = 7/82 (8%)

Query: 1  MAELLQTERTYVKDLDTCIKVFLQESRSHPNLPPGLVGKHDIIFGNIEEIRDFHRDIFLK 60
          + ELLQTER+YV+DL   ++VFL+  R  P L      +   IF NIEEI + H++ FL+
Sbjct: 2  IQELLQTERSYVRDLKILVEVFLKPLRESPILSE---EEIKTIFSNIEEILELHQE-FLE 57

Query: 61 ELEK---YENMPEDLGHCFVTW 79
          ELE+        + +G  F+ +
Sbjct: 58 ELEERLEEWPDIQRIGDIFLKF 79

Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Also called Dbl-homologous (DH) domain. It appears that pfam00169 domains invariably occur C-terminal to RhoGEF/DH domains. Length = 179
>gnl|CDD|214619 smart00325, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Back     alignment and domain information
>gnl|CDD|238091 cd00160, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
smart00325180 RhoGEF Guanine nucleotide exchange factor for Rho/ 99.73
cd00160181 RhoGEF Guanine nucleotide exchange factor for Rho/ 99.73
KOG3518|consensus 521 99.71
KOG4240|consensus 1025 99.67
PF00621180 RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho 99.61
KOG0689|consensus 448 99.47
KOG2996|consensus 865 99.47
KOG4424|consensus 623 99.44
KOG2070|consensus 661 99.4
KOG4305|consensus 1029 99.37
KOG3519|consensus 756 99.33
COG5422 1175 ROM1 RhoGEF, Guanine nucleotide exchange factor fo 99.21
KOG3523|consensus 695 98.9
KOG3522|consensus 925 98.83
KOG3520|consensus 1167 98.83
KOG3521|consensus 846 98.7
KOG3531|consensus 1036 97.94
KOG3524|consensus 850 95.71
PF0061191 FCH: Fes/CIP4, and EFC/F-BAR homology domain; Inte 88.79
cd07652 234 F-BAR_Rgd1 The F-BAR (FES-CIP4 Homology and Bin/Am 81.76
>smart00325 RhoGEF Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Back     alignment and domain information 
Probab=99.73  E-value=9.6e-18  Score=107.18  Aligned_cols=82  Identities=44%  Similarity=0.697  Sum_probs=72.7

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHHhhCCC-CCCcchhhhHHhHhcCHHHHHHHhHHHHHHHHHhhhcC----CcchHHH
Q psy17417          1 MAELLQTERTYVKDLDTCIKVFLQESRSHP-NLPPGLVGKHDIIFGNIEEIRDFHRDIFLKELEKYENM----PEDLGHC   75 (87)
Q Consensus         1 i~ELi~TE~~Yv~~L~~i~~~~~~~l~~~~-~~p~~~~~~~~~lF~ni~~I~~~h~~~fl~~Le~~~~~----~~~ig~~   75 (87)
                      |+||++||+.||++|+.+++.|+.|+.... .++.   .+.+.||+|+++|+.+|+ .|+.+|+++...    ...+|++
T Consensus         2 i~Eli~tE~~Yv~~L~~l~~~y~~~l~~~~~~~~~---~~~~~iF~~i~~i~~~h~-~~l~~l~~~~~~~~~~~~~i~~~   77 (180)
T smart00325        2 LKELLQTERNYVRDLKLLVEVFLKPLKKELKLLSP---NELETLFGNIEEIYEFHR-DFLDELEERIEEWDDSPERIGDV   77 (180)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCH---HHHHHHhcCHHHHHHHHH-HHHHHHHHHHhcccccccHHHHH
Confidence            589999999999999999999999999875 3443   578999999999999999 699999998754    4689999


Q ss_pred             HHhcccccCcC
Q psy17417         76 FVTWWWFVRPK   86 (87)
Q Consensus        76 Fl~~~~~f~~~   86 (87)
                      |+++.+.|++|
T Consensus        78 f~~~~~~~~~Y   88 (180)
T smart00325       78 FLKLEEFFKIY   88 (180)
T ss_pred             HHHhhHHHHHH
Confidence            99998888776

Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Also called Dbl-homologous (DH) domain. It appears that PH domains invariably occur C-terminal to RhoGEF/DH domains. Improved coverage.
>cd00160 RhoGEF Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain Back     alignment and domain information
>KOG3518|consensus Back     alignment and domain information
>KOG4240|consensus Back     alignment and domain information
>PF00621 RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho family GTPases Rho, Rac and CDC42 regulate a diverse array of cellular processes Back     alignment and domain information
>KOG0689|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG4305|consensus Back     alignment and domain information
>KOG3519|consensus Back     alignment and domain information
>COG5422 ROM1 RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG3522|consensus Back     alignment and domain information
>KOG3520|consensus Back     alignment and domain information
>KOG3521|consensus Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>KOG3524|consensus Back     alignment and domain information
>PF00611 FCH: Fes/CIP4, and EFC/F-BAR homology domain; InterPro: IPR001060 The FCH domain is a short conserved region of around 60 amino acids first described as a region of homology between FER and CIP4 proteins [] Back     alignment and domain information
>cd07652 F-BAR_Rgd1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Saccharomyces cerevisiae Rho GTPase activating protein Rgd1 and similar proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
2kr9_A190 Kalirin Dh1 Nmr Structure Length = 190 9e-25
2nz8_B 313 N-Terminal Dhph Cassette Of Trio In Complex With Nu 7e-24
1nty_A 311 Crystal Structure Of The First DhPH DOMAIN OF TRIO 7e-24
1rj2_A 353 Crystal Structure Of The DhPH FRAGMENT OF DBS WITHO 5e-10
1lb1_A 353 Crystal Structure Of The Dbl And Pleckstrin Homolog 5e-10
1kzg_A 353 Dbscdc42(Y889f) Length = 353 5e-10
2rgn_B 354 Crystal Structure Of P63rhogef Complex With Galpha- 8e-10
1kz7_A 353 Crystal Structure Of The DhPH FRAGMENT OF MURINE DB 2e-09
1foe_A 377 Crystal Structure Of Rac1 In Complex With The Guani 3e-04
>pdb|2KR9|A Chain A, Kalirin Dh1 Nmr Structure Length = 190 Back     alignment and structure 
Iteration: 1

 Score =  108 bits (269), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 63/80 (78%), Gaps = 1/80 (1%)
Query: 1  MAELLQTERTYVKDLDTCIKVFLQESRSH-PNLPPGLVGKHDIIFGNIEEIRDFHRDIFL 59
          MAELLQTE+ YV+DL  C++ +L E  S    +PPG++ K  IIFGNI+EI DFH +IFL
Sbjct: 17 MAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHIIFGNIQEIYDFHNNIFL 76
Query: 60 KELEKYENMPEDLGHCFVTW 79
          KELEKYE +PED+GHCFVTW
Sbjct: 77 KELEKYEQLPEDVGHCFVTW 96
>pdb|2NZ8|B Chain B, N-Terminal Dhph Cassette Of Trio In Complex With Nucleotide- Free Rac1 Length = 313 Back     alignment and structure
>pdb|1NTY|A Chain A, Crystal Structure Of The First DhPH DOMAIN OF TRIO TO 1.7 A Length = 311 Back     alignment and structure
>pdb|1RJ2|A Chain A, Crystal Structure Of The DhPH FRAGMENT OF DBS WITHOUT Bound Gtpase Length = 353 Back     alignment and structure
>pdb|1LB1|A Chain A, Crystal Structure Of The Dbl And Pleckstrin Homology Domains Of Dbs In Complex With Rhoa Length = 353 Back     alignment and structure
>pdb|1KZG|A Chain A, Dbscdc42(Y889f) Length = 353 Back     alignment and structure
>pdb|2RGN|B Chain B, Crystal Structure Of P63rhogef Complex With Galpha-Q And Rhoa Length = 354 Back     alignment and structure
>pdb|1KZ7|A Chain A, Crystal Structure Of The DhPH FRAGMENT OF MURINE DBS IN Complex With The Placental Isoform Of Human Cdc42 Length = 353 Back     alignment and structure
>pdb|1FOE|A Chain A, Crystal Structure Of Rac1 In Complex With The Guanine Nucleotide Exchange Region Of Tiam1 Length = 377 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
1nty_A 311 Triple functional domain protein; DBL, pleckstrin, 3e-28
2rgn_B 354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 3e-27
1kz7_A 353 Guanine nucleotide exchange factor DBS; guanine nu 8e-26
1by1_A 209 Protein (PIX); RHO-GTPase exchange factor, transpo 2e-24
2dfk_A 402 Collybistin II; DH domain, PH domain, cell cycle; 5e-21
2vrw_B 406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 2e-20
1dbh_A 354 Protein (human SOS 1); guanine nucleotide exchange 4e-20
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 5e-19
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 1e-18
1foe_A 377 T-lymphoma invasion and metastasis inducing protei 5e-18
3mpx_A 434 FYVE, rhogef and PH domain-containing protein 5; s 2e-17
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 2e-16
2z0q_A 346 XPLN, RHO guanine nucleotide exchange factor 3; DH 2e-15
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 3e-15
3odw_A 536 RHO guanine nucleotide exchange factor 1; regulati 2e-14
3t06_A 418 PDZ-rhogef, RHO guanine nucleotide exchange factor 3e-14
1xcg_A 368 PDZ-rhogef, RHO guanine nucleotide exchange factor 4e-14
1txd_A 385 RHO guanine nucleotide exchange factor 12; helical 8e-14
3p6a_A 377 RHO guanine nucleotide exchange factor 1; regulati 2e-13
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 1e-11
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Length = 311 Back     alignment and structure
 Score =  102 bits (256), Expect = 3e-28
 Identities = 49/80 (61%), Positives = 61/80 (76%), Gaps = 1/80 (1%)

Query: 1  MAELLQTERTYVKDLDTCIKVFLQESRSHPNL-PPGLVGKHDIIFGNIEEIRDFHRDIFL 59
          MAEL+QTE+ YV+DL  C+  +L E  S     PPG+V K  IIFGN++EI +FH +IFL
Sbjct: 14 MAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFL 73

Query: 60 KELEKYENMPEDLGHCFVTW 79
          KELEKYE +PED+GHCFVTW
Sbjct: 74 KELEKYEQLPEDVGHCFVTW 93
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Length = 354 Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Length = 353 Back     alignment and structure
>1by1_A Protein (PIX); RHO-GTPase exchange factor, transport protein; NMR {Homo sapiens} SCOP: a.87.1.1 Length = 209 Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Length = 377 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Length = 346 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Length = 536 Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Length = 418 Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Length = 368 Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Length = 385 Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Length = 377 Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
1nty_A 311 Triple functional domain protein; DBL, pleckstrin, 99.86
1kz7_A 353 Guanine nucleotide exchange factor DBS; guanine nu 99.86
1by1_A 209 Protein (PIX); RHO-GTPase exchange factor, transpo 99.85
2rgn_B 354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 99.84
2z0q_A 346 XPLN, RHO guanine nucleotide exchange factor 3; DH 99.81
1foe_A 377 T-lymphoma invasion and metastasis inducing protei 99.81
1dbh_A 354 Protein (human SOS 1); guanine nucleotide exchange 99.79
2dfk_A 402 Collybistin II; DH domain, PH domain, cell cycle; 99.78
2vrw_B 406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 99.77
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 99.77
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 99.76
1xcg_A 368 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.73
3t06_A 418 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.72
3mpx_A 434 FYVE, rhogef and PH domain-containing protein 5; s 99.72
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 99.72
3p6a_A 377 RHO guanine nucleotide exchange factor 1; regulati 99.72
1txd_A 385 RHO guanine nucleotide exchange factor 12; helical 99.7
3odw_A 536 RHO guanine nucleotide exchange factor 1; regulati 99.69
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 99.69
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 99.68
4gou_A 518 EHRGS-rhogef; RGS domain, DH domain, PH domain, RH 96.28
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
Probab=99.86  E-value=6.8e-22  Score=135.30  Aligned_cols=87  Identities=56%  Similarity=0.995  Sum_probs=78.0

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHHhhCCC-CCCcchhhhHHhHhcCHHHHHHHhHHHHHHHHHhhhcCCcchHHHHHhc
Q psy17417          1 MAELLQTERTYVKDLDTCIKVFLQESRSHP-NLPPGLVGKHDIIFGNIEEIRDFHRDIFLKELEKYENMPEDLGHCFVTW   79 (87)
Q Consensus         1 i~ELi~TE~~Yv~~L~~i~~~~~~~l~~~~-~~p~~~~~~~~~lF~ni~~I~~~h~~~fl~~Le~~~~~~~~ig~~Fl~~   79 (87)
                      |+||++||++||++|+.+++.|+.|+.+.. .+|+.+.++++.||+|+++|+++|++.|+.+|+++.+.|.+||+||+++
T Consensus        14 i~El~~TE~~Yv~~L~~l~~~y~~~l~~~~~~l~~~~~~~~~~iF~ni~~i~~~h~~~fl~~L~~~~~~~~~ig~~f~~~   93 (311)
T 1nty_A           14 MAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTW   93 (311)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCSCCCTTTTTCHHHHHTTHHHHHHHHHHTHHHHHHHTTTCGGGTHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCChhhhhhHHHhhcCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHH
Confidence            479999999999999999999999998753 4787666788999999999999998339999999988889999999999


Q ss_pred             ccccCcCC
Q psy17417         80 WWFVRPKT   87 (87)
Q Consensus        80 ~~~f~~~~   87 (87)
                      .+.|+.|+
T Consensus        94 ~~~~~~Y~  101 (311)
T 1nty_A           94 ADKFQMYV  101 (311)
T ss_dssp             TTTTHHHH
T ss_pred             HHHhHHHH
Confidence            99998873
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>1by1_A Protein (PIX); RHO-GTPase exchange factor, transport protein; NMR {Homo sapiens} SCOP: a.87.1.1 Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>4gou_A EHRGS-rhogef; RGS domain, DH domain, PH domain, RHO guanine nucleotide EXC factor, signaling protein, GTPase accelerating protein; 2.30A {Entamoeba histolytica} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 87
d1ntya1184 a.87.1.1 (A:1231-1414) Triple functional domain pr 6e-21
d1kz7a1195 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse 2e-17
d1by1a_ 209 a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxI 2e-16
d1foea1 206 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma in 3e-15
d2dfka1203 a.87.1.1 (A:37-239) Rho guanine nucleotide exchang 2e-14
d1ki1b1 210 a.87.1.1 (B:1229-1438) GEF of intersectin {Human ( 1e-12
d1xcga1 228 a.87.1.1 (A:714-941) Rho guanine nucleotide exchan 2e-12
d1dbha1 207 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {H 3e-12
d1txda1 234 a.87.1.1 (A:766-999) Rho guanine nucleotide exchan 7e-12
d1f5xa_208 a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [Ta 8e-12
>d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Back     information, alignment and structure

class: All alpha proteins
fold: DBL homology domain (DH-domain)
superfamily: DBL homology domain (DH-domain)
family: DBL homology domain (DH-domain)
domain: Triple functional domain protein TRIO
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 79.4 bits (195), Expect = 6e-21
 Identities = 48/80 (60%), Positives = 62/80 (77%), Gaps = 1/80 (1%)

Query: 1  MAELLQTERTYVKDLDTCIKVFLQE-SRSHPNLPPGLVGKHDIIFGNIEEIRDFHRDIFL 59
          MAEL+QTE+ YV+DL  C+  +L E +     +PPG+V K  IIFGN++EI +FH +IFL
Sbjct: 8  MAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFL 67

Query: 60 KELEKYENMPEDLGHCFVTW 79
          KELEKYE +PED+GHCFVTW
Sbjct: 68 KELEKYEQLPEDVGHCFVTW 87
>d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Length = 195 Back     information, alignment and structure
>d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxId: 9606]} Length = 209 Back     information, alignment and structure
>d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 206 Back     information, alignment and structure
>d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 203 Back     information, alignment and structure
>d1ki1b1 a.87.1.1 (B:1229-1438) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 210 Back     information, alignment and structure
>d1xcga1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} Length = 208 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d1ntya1184 Triple functional domain protein TRIO {Human (Homo 99.84
d1kz7a1195 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 99.8
d1by1a_ 209 beta-pix {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1foea1206 GEF of TIAM1 (T-Lymphoma invasion and metastasis i 99.77
d1dbha1 207 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 99.77
d2dfka1203 Rho guanine nucleotide exchange factor 9, Collybis 99.77
d1f5xa_208 RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} 99.74
d1ki1b1 210 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 99.74
d1xcga1 228 Rho guanine nucleotide exchange factor 11, PDZ-Rho 99.62
d1txda1 234 Rho guanine nucleotide exchange factor 12 {Human ( 99.57
>d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DBL homology domain (DH-domain)
superfamily: DBL homology domain (DH-domain)
family: DBL homology domain (DH-domain)
domain: Triple functional domain protein TRIO
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.84  E-value=3.1e-21  Score=122.25  Aligned_cols=86  Identities=57%  Similarity=1.007  Sum_probs=76.0

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHHhhCCCC-CCcchhhhHHhHhcCHHHHHHHhHHHHHHHHHhhhcCCcchHHHHHhc
Q psy17417          1 MAELLQTERTYVKDLDTCIKVFLQESRSHPN-LPPGLVGKHDIIFGNIEEIRDFHRDIFLKELEKYENMPEDLGHCFVTW   79 (87)
Q Consensus         1 i~ELi~TE~~Yv~~L~~i~~~~~~~l~~~~~-~p~~~~~~~~~lF~ni~~I~~~h~~~fl~~Le~~~~~~~~ig~~Fl~~   79 (87)
                      |+||++||++||++|+.+.+.|+.|+..... .|....++...||+|+++|+.+|++.|++.++.+.+.+.+||+||+++
T Consensus         8 i~El~~TE~~Yv~~L~~l~~~y~~pl~~~~~~~~~~~~~~~~~iF~ni~~i~~~h~~~ll~~l~~~~~~~~~ig~~fl~~   87 (184)
T d1ntya1           8 MAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTW   87 (184)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCSCCCTTTTTCHHHHHTTHHHHHHHHHHTHHHHHHHTTTCGGGTHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccCCccchhHHHHHHhhHHHHHHHHHHHHHHHHHHhhcCchHHHHHHHHH
Confidence            5899999999999999999999999987543 555555677889999999999998668899999888889999999999


Q ss_pred             ccccCcC
Q psy17417         80 WWFVRPK   86 (87)
Q Consensus        80 ~~~f~~~   86 (87)
                      .+.|+.|
T Consensus        88 ~~~~~~Y   94 (184)
T d1ntya1          88 ADKFQMY   94 (184)
T ss_dssp             TTTTHHH
T ss_pred             HHHHHHH
Confidence            9999877
>d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ki1b1 a.87.1.1 (B:1229-1438) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure