Psyllid ID: psy17510


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTADGLYEGLTWLTSNHKL
cccccccccccccHHcccccEEEEEEEcccHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHcccc
EEcccHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHccHHHcccEEEEEEEcccccccccHHHHHHHccHHHcccccEEEEEcEccccEcHHHHHHHHHHHccc
dvggqdkirplwrhyytgtqgliFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAnkqdlpdamkphEIQEKLGltrirdrnwyvqpscattadGLYEGLTWLTSNHKL
dvggqdkirplwrhyytgtqgliFVVDCADRDRIDEARQELhriindremRDAIILIFankqdlpdamkPHEIQEKLgltrirdrnwyVQPSCATTADGLYEGLTWLTSNHKL
DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTADGLYEGLTWLTSNHKL
*******IRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAM*PHEIQEKLGLTRIRDRNWYVQPSCATTADGLYEGLTWLT*****
DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTADGLYEGLTWLTSNHKL
DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTADGLYEGLTWLTSNHKL
DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTADGLYEGLTWLTSNHKL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTADGLYEGLTWLTSNHKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query113 2.2.26 [Sep-21-2011]
P26990175 ADP-ribosylation factor 6 yes N/A 0.991 0.64 0.982 6e-62
P62332175 ADP-ribosylation factor 6 yes N/A 0.991 0.64 0.973 1e-61
Q007T5175 ADP-ribosylation factor 6 yes N/A 0.991 0.64 0.973 1e-61
P62331175 ADP-ribosylation factor 6 yes N/A 0.991 0.64 0.973 1e-61
P62330175 ADP-ribosylation factor 6 yes N/A 0.991 0.64 0.973 1e-61
P40946175 ADP-ribosylation factor 3 yes N/A 1.0 0.645 0.955 2e-60
P51645175 ADP-ribosylation factor 6 N/A N/A 0.991 0.64 0.955 2e-60
P49076181 ADP-ribosylation factor O N/A N/A 0.973 0.607 0.690 2e-43
Q9Y7Z2184 ADP-ribosylation factor 6 yes N/A 1.0 0.614 0.690 2e-43
Q94650181 ADP-ribosylation factor 1 yes N/A 0.964 0.602 0.697 3e-43
>sp|P26990|ARF6_CHICK ADP-ribosylation factor 6 OS=Gallus gallus GN=ARF6 PE=2 SV=3 Back     alignment and function desciption
 Score =  235 bits (599), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 110/112 (98%), Positives = 111/112 (99%)

Query: 1   DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN 60
           DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN
Sbjct: 63  DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN 122

Query: 61  KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTADGLYEGLTWLTSNHK 112
           KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATT DGLYEGLTWLTSN+K
Sbjct: 123 KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNYK 174




GTP-binding protein involved in protein trafficking; regulates endocytic recycling and cytoskeleton remodeling. May modulate vesicle budding and uncoating within the Golgi apparatus. May contribute to the regulation of dendritic branching, filopodia extension and dendritic spine development.
Gallus gallus (taxid: 9031)
>sp|P62332|ARF6_RAT ADP-ribosylation factor 6 OS=Rattus norvegicus GN=Arf6 PE=1 SV=2 Back     alignment and function description
>sp|Q007T5|ARF6_PIG ADP-ribosylation factor 6 OS=Sus scrofa GN=ARF6 PE=2 SV=1 Back     alignment and function description
>sp|P62331|ARF6_MOUSE ADP-ribosylation factor 6 OS=Mus musculus GN=Arf6 PE=1 SV=2 Back     alignment and function description
>sp|P62330|ARF6_HUMAN ADP-ribosylation factor 6 OS=Homo sapiens GN=ARF6 PE=1 SV=2 Back     alignment and function description
>sp|P40946|ARF3_DROME ADP-ribosylation factor 3 OS=Drosophila melanogaster GN=Arf51F PE=2 SV=3 Back     alignment and function description
>sp|P51645|ARF6_XENLA ADP-ribosylation factor 6 OS=Xenopus laevis GN=arf6 PE=2 SV=2 Back     alignment and function description
>sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 SV=2 Back     alignment and function description
>sp|Q9Y7Z2|ARF6_SCHPO ADP-ribosylation factor 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arf6 PE=3 SV=1 Back     alignment and function description
>sp|Q94650|ARF1_PLAFA ADP-ribosylation factor 1 OS=Plasmodium falciparum GN=ARF1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
322785548180 hypothetical protein SINV_14695 [Solenop 1.0 0.627 0.991 2e-61
340721293175 PREDICTED: ADP-ribosylation factor 6-lik 1.0 0.645 0.991 3e-61
291403824 507 PREDICTED: mCG3164-like [Oryctolagus cun 0.991 0.220 0.973 4e-61
301773242 370 PREDICTED: hypothetical protein LOC10047 0.991 0.302 0.973 6e-61
242009948175 ADP-ribosylation factor, putative [Pedic 1.0 0.645 0.982 7e-61
170057334175 conserved hypothetical protein [Culex qu 1.0 0.645 0.982 7e-61
307192533175 ADP-ribosylation factor 6 [Harpegnathos 0.991 0.64 0.991 8e-61
357629652175 hypothetical protein KGM_17559 [Danaus p 1.0 0.645 0.973 1e-60
157107947175 adp-ribosylation factor, arf [Aedes aegy 1.0 0.645 0.973 1e-60
91076080175 PREDICTED: similar to ADP-ribosylation f 1.0 0.645 0.973 2e-60
>gi|322785548|gb|EFZ12210.1| hypothetical protein SINV_14695 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  238 bits (608), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 112/113 (99%), Positives = 112/113 (99%)

Query: 1   DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN 60
           DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN
Sbjct: 68  DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN 127

Query: 61  KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTADGLYEGLTWLTSNHKL 113
           KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATT DGLYEGLTWLTSNHKL
Sbjct: 128 KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNHKL 180




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340721293|ref|XP_003399058.1| PREDICTED: ADP-ribosylation factor 6-like [Bombus terrestris] gi|345498024|ref|XP_003428126.1| PREDICTED: ADP-ribosylation factor 6-like isoform 2 [Nasonia vitripennis] gi|345498026|ref|XP_001603804.2| PREDICTED: ADP-ribosylation factor 6-like isoform 1 [Nasonia vitripennis] gi|350406774|ref|XP_003487878.1| PREDICTED: ADP-ribosylation factor 6-like [Bombus impatiens] gi|380019019|ref|XP_003693415.1| PREDICTED: ADP-ribosylation factor 6-like [Apis florea] gi|383847271|ref|XP_003699278.1| PREDICTED: ADP-ribosylation factor 6-like [Megachile rotundata] gi|307169171|gb|EFN61987.1| ADP-ribosylation factor 6 [Camponotus floridanus] gi|332017829|gb|EGI58489.1| ADP-ribosylation factor 6 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|291403824|ref|XP_002718343.1| PREDICTED: mCG3164-like [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|301773242|ref|XP_002922050.1| PREDICTED: hypothetical protein LOC100473890 [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|242009948|ref|XP_002425743.1| ADP-ribosylation factor, putative [Pediculus humanus corporis] gi|212509647|gb|EEB13005.1| ADP-ribosylation factor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|170057334|ref|XP_001864438.1| conserved hypothetical protein [Culex quinquefasciatus] gi|94469094|gb|ABF18396.1| ADP-ribosylation factor 6 [Aedes aegypti] gi|167876760|gb|EDS40143.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|307192533|gb|EFN75721.1| ADP-ribosylation factor 6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|357629652|gb|EHJ78283.1| hypothetical protein KGM_17559 [Danaus plexippus] Back     alignment and taxonomy information
>gi|157107947|ref|XP_001650010.1| adp-ribosylation factor, arf [Aedes aegypti] gi|108879449|gb|EAT43674.1| AAEL004913-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|91076080|ref|XP_967713.1| PREDICTED: similar to ADP-ribosylation factor 6 [Tribolium castaneum] gi|270014695|gb|EFA11143.1| hypothetical protein TcasGA2_TC004744 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
UNIPROTKB|P26990175 ARF6 "ADP-ribosylation factor 0.991 0.64 0.982 5.1e-58
ZFIN|ZDB-GENE-030131-9056160 arf6b "ADP-ribosylation factor 0.991 0.7 0.982 5.1e-58
UNIPROTKB|G3N3N1175 ARF6 "Uncharacterized protein" 0.991 0.64 0.973 1.4e-57
UNIPROTKB|E2RHL4175 ARF6 "Uncharacterized protein" 0.991 0.64 0.973 1.4e-57
UNIPROTKB|P62330175 ARF6 "ADP-ribosylation factor 0.991 0.64 0.973 1.4e-57
UNIPROTKB|Q007T5175 ARF6 "ADP-ribosylation factor 0.991 0.64 0.973 1.4e-57
MGI|MGI:99435175 Arf6 "ADP-ribosylation factor 0.991 0.64 0.973 1.4e-57
RGD|621279175 Arf6 "ADP-ribosylation factor 0.991 0.64 0.973 1.4e-57
UNIPROTKB|P51645175 arf6 "ADP-ribosylation factor 0.991 0.64 0.955 1.6e-56
FB|FBgn0013750175 Arf51F "ADP ribosylation facto 1.0 0.645 0.955 2e-56
UNIPROTKB|P26990 ARF6 "ADP-ribosylation factor 6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 596 (214.9 bits), Expect = 5.1e-58, P = 5.1e-58
 Identities = 110/112 (98%), Positives = 111/112 (99%)

Query:     1 DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN 60
             DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN
Sbjct:    63 DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN 122

Query:    61 KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTADGLYEGLTWLTSNHK 112
             KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATT DGLYEGLTWLTSN+K
Sbjct:   123 KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNYK 174




GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0007399 "nervous system development" evidence=IEA
GO:0015031 "protein transport" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0030154 "cell differentiation" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IEA
GO:0010008 "endosome membrane" evidence=IEA
GO:0031527 "filopodium membrane" evidence=IEA
GO:0005768 "endosome" evidence=ISS
GO:0001726 "ruffle" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISS
GO:0005938 "cell cortex" evidence=ISS
GO:0030838 "positive regulation of actin filament polymerization" evidence=ISS
GO:0030866 "cortical actin cytoskeleton organization" evidence=ISS
GO:0031529 "ruffle organization" evidence=ISS
GO:0035020 "regulation of Rac protein signal transduction" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISS
ZFIN|ZDB-GENE-030131-9056 arf6b "ADP-ribosylation factor 6b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3N3N1 ARF6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHL4 ARF6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P62330 ARF6 "ADP-ribosylation factor 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q007T5 ARF6 "ADP-ribosylation factor 6" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:99435 Arf6 "ADP-ribosylation factor 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621279 Arf6 "ADP-ribosylation factor 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P51645 arf6 "ADP-ribosylation factor 6" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
FB|FBgn0013750 Arf51F "ADP ribosylation factor at 51F" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9Y7Z2ARF6_SCHPONo assigned EC number0.69021.00.6141yesN/A
P51645ARF6_XENLANo assigned EC number0.95530.99110.64N/AN/A
P36397ARF1_ARATHNo assigned EC number0.67270.97340.6077yesN/A
P0DH91ARF2B_ARATHNo assigned EC number0.67270.97340.6077yesN/A
P51823ARF2_ORYSJNo assigned EC number0.66360.97340.6077yesN/A
Q94650ARF1_PLAFANo assigned EC number0.69720.96460.6022yesN/A
Q007T5ARF6_PIGNo assigned EC number0.97320.99110.64yesN/A
Q7KQL3ARF1_PLAF7No assigned EC number0.69720.96460.6022yesN/A
P40946ARF3_DROMENo assigned EC number0.95571.00.6457yesN/A
Q06396ARF1_ORYSJNo assigned EC number0.66360.97340.6077yesN/A
Q9LQC8ARF2A_ARATHNo assigned EC number0.67270.97340.6077yesN/A
P62330ARF6_HUMANNo assigned EC number0.97320.99110.64yesN/A
P62331ARF6_MOUSENo assigned EC number0.97320.99110.64yesN/A
P62332ARF6_RATNo assigned EC number0.97320.99110.64yesN/A
P26990ARF6_CHICKNo assigned EC number0.98210.99110.64yesN/A
Q75A26ARF_ASHGONo assigned EC number0.64280.99110.6187yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
cd04149168 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) 1e-79
smart00177175 smart00177, ARF, ARF-like small GTPases; ARF, ADP- 3e-78
cd04150159 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (A 3e-67
pfam00025174 pfam00025, Arf, ADP-ribosylation factor family 2e-65
PTZ00133182 PTZ00133, PTZ00133, ADP-ribosylation factor; Provi 7e-64
cd00878158 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf 5e-63
PLN00223181 PLN00223, PLN00223, ADP-ribosylation factor; Provi 2e-60
cd04153174 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) 2e-50
cd04151158 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) 9e-46
cd04155174 cd04155, Arl3, Arf-like 3 (Arl3) GTPase 2e-44
cd04156160 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 1e-41
cd04154173 cd04154, Arl2, Arf-like 2 (Arl2) GTPase 9e-39
cd04158169 cd04158, ARD1, (ADP-ribosylation factor domain pro 1e-36
cd04152183 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) 2e-34
cd04157162 cd04157, Arl6, Arf-like 6 (Arl6) GTPase 3e-33
cd04160168 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) 2e-27
cd04162164 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp 7e-27
cd04159159 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl 2e-25
cd04161167 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (A 1e-23
cd00879191 cd00879, Sar1, Sar1 is an essential component of C 2e-21
smart00178184 smart00178, SAR, Sar1p-like members of the Ras-fam 6e-19
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 2e-17
COG2229187 COG2229, COG2229, Predicted GTPase [General functi 1e-12
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 3e-10
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 5e-10
cd04105202 cd04105, SR_beta, Signal recognition particle rece 7e-10
cd01863161 cd01863, Rab18, Rab GTPase family 18 (Rab18) 6e-07
pfam00503329 pfam00503, G-alpha, G-protein alpha subunit 1e-06
cd01869166 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t 2e-06
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 4e-06
pfam09439181 pfam09439, SRPRB, Signal recognition particle rece 7e-06
smart00275342 smart00275, G_alpha, G protein alpha subunit 7e-05
cd04108170 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab3 1e-04
PTZ00099176 PTZ00099, PTZ00099, rab6; Provisional 2e-04
pfam00071162 pfam00071, Ras, Ras family 4e-04
cd04123162 cd04123, Rab21, Rab GTPase family 21 (Rab21) 4e-04
cd01867167 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie 7e-04
cd04113161 cd04113, Rab4, Rab GTPase family 4 (Rab4) 7e-04
cd01860163 cd01860, Rab5_related, Rab-related GTPase family i 0.001
smart00175164 smart00175, RAB, Rab subfamily of small GTPases 0.001
cd04119168 cd04119, RJL, Rab GTPase family J-like (RabJ-like) 0.001
cd00066315 cd00066, G-alpha, Alpha subunit of G proteins (gua 0.001
PLN03110216 PLN03110, PLN03110, Rab GTPase; Provisional 0.001
cd01898170 cd01898, Obg, Obg GTPase 0.001
cd04110199 cd04110, Rab35, Rab GTPase family 35 (Rab35) 0.002
>gnl|CDD|206716 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) Back     alignment and domain information
 Score =  230 bits (589), Expect = 1e-79
 Identities = 103/110 (93%), Positives = 108/110 (98%)

Query: 1   DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN 60
           DVGGQDKIRPLWRHYYTGTQGLIFVVD ADRDRIDEARQELHRIINDREMRDA++L+FAN
Sbjct: 59  DVGGQDKIRPLWRHYYTGTQGLIFVVDSADRDRIDEARQELHRIINDREMRDALLLVFAN 118

Query: 61  KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTADGLYEGLTWLTSN 110
           KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCAT+ DGLYEGLTWL+SN
Sbjct: 119 KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLSSN 168


Arf6 subfamily. Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions. In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis. Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling. Arf6 is required for and enhances Rac formation of ruffles. Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection. In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells. Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis. Arf6 is believed to function at multiple sites on the plasma membrane through interaction with a specific set of GEFs, GAPs, and effectors. Arf6 has been implicated in breast cancer and melanoma cell invasion, and in actin remodelling at the invasion site of Chlamydia infection. Length = 168

>gnl|CDD|128474 smart00177, ARF, ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>gnl|CDD|206717 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (Arf1) and ADP-ribosylation factor-5 (Arf5) Back     alignment and domain information
>gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family Back     alignment and domain information
>gnl|CDD|173423 PTZ00133, PTZ00133, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases Back     alignment and domain information
>gnl|CDD|165788 PLN00223, PLN00223, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|133353 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) GTPases Back     alignment and domain information
>gnl|CDD|206718 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) Back     alignment and domain information
>gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase Back     alignment and domain information
>gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) Back     alignment and domain information
>gnl|CDD|206720 cd04154, Arl2, Arf-like 2 (Arl2) GTPase Back     alignment and domain information
>gnl|CDD|206723 cd04158, ARD1, (ADP-ribosylation factor domain protein 1 (ARD1) Back     alignment and domain information
>gnl|CDD|206719 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) GTPases Back     alignment and domain information
>gnl|CDD|206722 cd04157, Arl6, Arf-like 6 (Arl6) GTPase Back     alignment and domain information
>gnl|CDD|206725 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) Back     alignment and domain information
>gnl|CDD|133362 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp2-like GTPase Back     alignment and domain information
>gnl|CDD|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases Back     alignment and domain information
>gnl|CDD|133361 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (Arl2l1) and Arl13 Back     alignment and domain information
>gnl|CDD|206645 cd00879, Sar1, Sar1 is an essential component of COPII vesicle coats Back     alignment and domain information
>gnl|CDD|197556 smart00178, SAR, Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|225138 COG2229, COG2229, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|206691 cd04105, SR_beta, Signal recognition particle receptor, beta subunit (SR-beta), together with SR-alpha, forms the heterodimeric signal recognition particle (SRP) Back     alignment and domain information
>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) Back     alignment and domain information
>gnl|CDD|215955 pfam00503, G-alpha, G-protein alpha subunit Back     alignment and domain information
>gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 Back     alignment and domain information
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|204242 pfam09439, SRPRB, Signal recognition particle receptor beta subunit Back     alignment and domain information
>gnl|CDD|214595 smart00275, G_alpha, G protein alpha subunit Back     alignment and domain information
>gnl|CDD|206693 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab34) and 36 (Rab36) Back     alignment and domain information
>gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional Back     alignment and domain information
>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21) Back     alignment and domain information
>gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) Back     alignment and domain information
>gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4) Back     alignment and domain information
>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion Back     alignment and domain information
>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like) Back     alignment and domain information
>gnl|CDD|206639 cd00066, G-alpha, Alpha subunit of G proteins (guanine nucleotide binding) Back     alignment and domain information
>gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional Back     alignment and domain information
>gnl|CDD|206685 cd01898, Obg, Obg GTPase Back     alignment and domain information
>gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 113
PLN00223181 ADP-ribosylation factor; Provisional 99.94
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.93
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.93
KOG0084|consensus205 99.93
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.93
PTZ00133182 ADP-ribosylation factor; Provisional 99.92
KOG0078|consensus207 99.92
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.92
KOG0092|consensus200 99.92
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.92
KOG0070|consensus181 99.91
KOG0094|consensus221 99.91
KOG0075|consensus186 99.91
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.91
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.91
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.91
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.91
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.91
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.91
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.91
KOG0071|consensus180 99.91
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.9
PTZ00099176 rab6; Provisional 99.9
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.9
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.9
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.89
KOG0087|consensus222 99.89
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.89
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.89
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.89
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.89
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.89
KOG0073|consensus185 99.89
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.89
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.89
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.88
KOG0098|consensus216 99.88
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.88
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.88
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.88
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.88
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.88
PTZ00369189 Ras-like protein; Provisional 99.88
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.88
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.88
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.87
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.87
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.87
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.87
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.87
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.87
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.87
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.87
KOG0080|consensus209 99.87
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.86
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.86
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.86
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.86
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.86
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.86
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.86
KOG0091|consensus213 99.86
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.86
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.86
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.86
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.86
KOG0088|consensus218 99.86
KOG0093|consensus193 99.86
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.86
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.86
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.86
KOG0079|consensus198 99.85
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.85
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.85
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.85
KOG0081|consensus219 99.85
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.85
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.85
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.85
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.85
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.84
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.84
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.84
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.84
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.84
KOG0394|consensus210 99.84
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.84
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.84
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.84
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.84
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.84
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.84
KOG0095|consensus213 99.84
KOG0395|consensus196 99.84
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.84
KOG0076|consensus197 99.83
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.83
PLN03110216 Rab GTPase; Provisional 99.83
KOG0086|consensus214 99.83
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.83
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.83
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.83
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.83
PLN03118211 Rab family protein; Provisional 99.82
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.82
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.82
KOG0072|consensus182 99.81
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.81
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.81
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.81
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.81
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.81
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.81
PLN03108210 Rab family protein; Provisional 99.81
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.81
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.8
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.8
KOG0083|consensus192 99.8
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.79
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.78
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.78
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.78
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.78
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.78
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.78
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.77
KOG0393|consensus198 99.75
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.75
KOG0074|consensus185 99.74
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.74
KOG0097|consensus215 99.74
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.71
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.7
COG2229187 Predicted GTPase [General function prediction only 99.69
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.69
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.69
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.68
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.65
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.65
PRK12299335 obgE GTPase CgtA; Reviewed 99.64
cd00881189 GTP_translation_factor GTP translation factor fami 99.64
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.61
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.61
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.61
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.61
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.6
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.6
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.6
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.6
PRK03003472 GTP-binding protein Der; Reviewed 99.6
KOG4252|consensus246 99.6
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.6
TIGR00157 245 ribosome small subunit-dependent GTPase A. The Aqu 99.59
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.59
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.58
PRK04213201 GTP-binding protein; Provisional 99.56
cd04105203 SR_beta Signal recognition particle receptor, beta 99.56
PLN00023 334 GTP-binding protein; Provisional 99.56
PRK05433 600 GTP-binding protein LepA; Provisional 99.56
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.55
PRK03003 472 GTP-binding protein Der; Reviewed 99.55
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.55
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.55
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.54
CHL00189 742 infB translation initiation factor 2; Provisional 99.54
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.54
PRK05306 787 infB translation initiation factor IF-2; Validated 99.53
KOG1673|consensus205 99.53
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.52
KOG3883|consensus198 99.52
TIGR00436 270 era GTP-binding protein Era. Era is an essential G 99.52
COG1100219 GTPase SAR1 and related small G proteins [General 99.51
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.51
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 99.51
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.5
KOG0096|consensus216 99.49
PRK15494 339 era GTPase Era; Provisional 99.49
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.49
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.48
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.48
PRK12297424 obgE GTPase CgtA; Reviewed 99.48
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.48
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.47
PRK00093435 GTP-binding protein Der; Reviewed 99.47
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.46
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.45
KOG1145|consensus 683 99.44
PRK04000 411 translation initiation factor IF-2 subunit gamma; 99.44
PRK11058426 GTPase HflX; Provisional 99.44
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.43
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.43
KOG0077|consensus193 99.42
PRK12296 500 obgE GTPase CgtA; Reviewed 99.42
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.41
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 99.41
KOG4423|consensus229 99.4
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.39
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 99.39
PRK12298390 obgE GTPase CgtA; Reviewed 99.39
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.39
PRK10218 607 GTP-binding protein; Provisional 99.38
PRK00093 435 GTP-binding protein Der; Reviewed 99.38
PRK00089 292 era GTPase Era; Reviewed 99.38
KOG0462|consensus 650 99.38
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 99.38
PRK04004 586 translation initiation factor IF-2; Validated 99.38
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.38
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.37
PRK14845 1049 translation initiation factor IF-2; Provisional 99.36
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 99.35
PRK12317 425 elongation factor 1-alpha; Reviewed 99.35
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.34
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.34
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.33
KOG0090|consensus238 99.32
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.31
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.31
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.28
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.28
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.27
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.25
PRK12736 394 elongation factor Tu; Reviewed 99.25
PRK12289 352 GTPase RsgA; Reviewed 99.25
COG1159 298 Era GTPase [General function prediction only] 99.24
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.22
PRK09866 741 hypothetical protein; Provisional 99.21
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.21
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.19
PRK13768253 GTPase; Provisional 99.19
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.19
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.19
PRK12735 396 elongation factor Tu; Reviewed 99.17
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.17
COG1160444 Predicted GTPases [General function prediction onl 99.16
PLN00043 447 elongation factor 1-alpha; Provisional 99.16
cd01854 287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 99.15
TIGR00485 394 EF-Tu translation elongation factor TU. This align 99.14
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.13
COG1160 444 Predicted GTPases [General function prediction onl 99.13
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.13
PRK00098 298 GTPase RsgA; Reviewed 99.12
PRK13351 687 elongation factor G; Reviewed 99.12
KOG1489|consensus366 99.12
PTZ00141 446 elongation factor 1- alpha; Provisional 99.12
KOG0082|consensus354 99.11
CHL00071 409 tufA elongation factor Tu 99.1
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.09
PRK12288 347 GTPase RsgA; Reviewed 99.08
cd01896233 DRG The developmentally regulated GTP-binding prot 99.08
COG0486454 ThdF Predicted GTPase [General function prediction 99.07
PRK00049 396 elongation factor Tu; Reviewed 99.07
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.07
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.06
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.06
PRK12740 668 elongation factor G; Reviewed 99.05
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 99.04
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.03
TIGR00503 527 prfC peptide chain release factor 3. This translat 99.02
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.01
PLN03127 447 Elongation factor Tu; Provisional 99.0
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 98.99
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 98.98
PLN03126 478 Elongation factor Tu; Provisional 98.95
KOG1144|consensus 1064 98.93
KOG1707|consensus 625 98.93
COG2262411 HflX GTPases [General function prediction only] 98.9
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 98.9
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.9
COG0218200 Predicted GTPase [General function prediction only 98.89
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.89
PRK12739 691 elongation factor G; Reviewed 98.87
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 98.85
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.83
KOG1423|consensus 379 98.8
PRK09563 287 rbgA GTPase YlqF; Reviewed 98.79
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 98.78
PRK00007 693 elongation factor G; Reviewed 98.76
COG1217 603 TypA Predicted membrane GTPase involved in stress 98.76
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 98.7
COG0536369 Obg Predicted GTPase [General function prediction 98.68
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 98.66
PRK01889 356 GTPase RsgA; Reviewed 98.65
KOG1490|consensus 620 98.65
PRK13796 365 GTPase YqeH; Provisional 98.64
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.64
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 98.63
COG4917148 EutP Ethanolamine utilization protein [Amino acid 98.61
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 98.6
COG3276 447 SelB Selenocysteine-specific translation elongatio 98.59
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 98.51
PRK09435332 membrane ATPase/protein kinase; Provisional 98.5
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 98.46
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.45
COG1084346 Predicted GTPase [General function prediction only 98.44
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.43
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.41
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.37
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.35
KOG0085|consensus359 98.3
KOG0099|consensus379 98.29
KOG0458|consensus 603 98.26
PTZ00416 836 elongation factor 2; Provisional 98.24
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 98.24
PLN00116 843 translation elongation factor EF-2 subunit; Provis 98.22
COG1162 301 Predicted GTPases [General function prediction onl 98.21
PRK07560 731 elongation factor EF-2; Reviewed 98.17
KOG1191|consensus531 98.15
COG5258 527 GTPBP1 GTPase [General function prediction only] 98.15
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 98.06
COG0050 394 TufB GTPases - translation elongation factors [Tra 98.03
KOG0461|consensus 522 97.98
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 97.87
KOG0466|consensus 466 97.84
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 97.84
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 97.82
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 97.82
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 97.8
KOG0460|consensus 449 97.8
KOG0468|consensus 971 97.79
KOG1707|consensus625 97.78
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 97.77
PRK09602 396 translation-associated GTPase; Reviewed 97.77
KOG1424|consensus 562 97.76
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 97.68
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 97.68
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 97.64
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 97.64
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 97.57
COG3596296 Predicted GTPase [General function prediction only 97.5
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 97.43
COG1161 322 Predicted GTPases [General function prediction onl 97.38
KOG1532|consensus 366 97.35
KOG0465|consensus 721 97.3
KOG1143|consensus 591 97.1
COG1163365 DRG Predicted GTPase [General function prediction 97.05
KOG2484|consensus 435 96.95
KOG0463|consensus 641 96.95
KOG3886|consensus 295 96.76
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 96.57
cd03110179 Fer4_NifH_child This protein family's function is 96.53
KOG1954|consensus 532 96.34
KOG0448|consensus 749 96.19
KOG0705|consensus 749 96.19
KOG0467|consensus 887 96.1
KOG3905|consensus 473 95.88
KOG0464|consensus 753 95.77
KOG0459|consensus 501 95.63
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 95.6
KOG2485|consensus 335 95.41
KOG2423|consensus 572 95.16
COG1149284 MinD superfamily P-loop ATPase containing an inser 95.13
cd03111106 CpaE_like This protein family consists of proteins 94.89
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 94.74
COG4963366 CpaE Flp pilus assembly protein, ATPase CpaE [Intr 94.62
KOG0447|consensus 980 94.56
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 94.46
KOG2486|consensus320 94.36
cd03112158 CobW_like The function of this protein family is u 94.29
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 93.74
KOG0410|consensus410 93.62
PF14331 266 ImcF-related_N: ImcF-related N-terminal domain 93.6
COG0523 323 Putative GTPases (G3E family) [General function pr 93.29
PF1008797 DUF2325: Uncharacterized protein conserved in bact 93.09
cd02036179 MinD Bacterial cell division requires the formatio 92.94
cd03114148 ArgK-like The function of this protein family is u 92.65
TIGR00064272 ftsY signal recognition particle-docking protein F 92.44
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 92.25
KOG3887|consensus 347 91.47
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 91.42
KOG0469|consensus 842 90.74
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein Y 89.15
PRK10416318 signal recognition particle-docking protein FtsY; 88.44
PRK14974336 cell division protein FtsY; Provisional 88.21
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 87.84
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 87.74
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 87.52
cd02117212 NifH_like This family contains the NifH (iron prot 86.56
CHL00175281 minD septum-site determining protein; Validated 85.76
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 85.16
TIGR01968261 minD_bact septum site-determining protein MinD. Th 84.4
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 84.0
cd02032267 Bchl_like This family of proteins contains bchL an 83.94
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 83.87
PRK13849231 putative crown gall tumor protein VirC1; Provision 82.93
PF02662124 FlpD: Methyl-viologen-reducing hydrogenase, delta 82.59
KOG1486|consensus364 81.92
PRK11537 318 putative GTP-binding protein YjiA; Provisional 81.86
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 81.62
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 81.12
PRK13505 557 formate--tetrahydrofolate ligase; Provisional 80.94
PHA02518211 ParA-like protein; Provisional 80.68
CHL00072290 chlL photochlorophyllide reductase subunit L 80.51
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
Probab=99.94  E-value=1.1e-25  Score=136.55  Aligned_cols=111  Identities=67%  Similarity=1.236  Sum_probs=96.8

Q ss_pred             CCCCccCchhhHHhhhcCCcEEEEEEECCChhhHHHHHHHHHHHHcCcCCCCCeEEEEEeCCCCCCCCCHHHHHHHhCCC
Q psy17510          1 DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLT   80 (113)
Q Consensus         1 D~~G~~~~~~~~~~~~~~~~~vi~v~d~~~~~~~~~~~~~~~~~~~~~~~~~~p~ilv~nK~D~~~~~~~~~~~~~~~~~   80 (113)
                      ||||+++++.+|..|++++|++|+|+|.+++.++.....++..+.......++|+++++||+|+++....+++.+.++..
T Consensus        67 D~~Gq~~~~~~~~~~~~~a~~iI~V~D~s~~~s~~~~~~~l~~~l~~~~~~~~piilv~NK~Dl~~~~~~~~~~~~l~l~  146 (181)
T PLN00223         67 DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLH  146 (181)
T ss_pred             ECCCCHHHHHHHHHHhccCCEEEEEEeCCcHHHHHHHHHHHHHHhcCHhhCCCCEEEEEECCCCCCCCCHHHHHHHhCcc
Confidence            89999999999999999999999999999998999888888887655444679999999999998877778888888766


Q ss_pred             ccCCCCeEEEeccccCCCCHHHHHHHHHhhc
Q psy17510         81 RIRDRNWYVQPSCATTADGLYEGLTWLTSNH  111 (113)
Q Consensus        81 ~~~~~~~~~~~~sa~~~~~i~~~~~~l~~~~  111 (113)
                      ....+.+.++++||++|+|+.++|+||...+
T Consensus       147 ~~~~~~~~~~~~Sa~~g~gv~e~~~~l~~~~  177 (181)
T PLN00223        147 SLRQRHWYIQSTCATSGEGLYEGLDWLSNNI  177 (181)
T ss_pred             ccCCCceEEEeccCCCCCCHHHHHHHHHHHH
Confidence            5555677788999999999999999998765



>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>KOG1673|consensus Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>KOG3883|consensus Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>KOG0096|consensus Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>KOG0077|consensus Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>KOG4423|consensus Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>KOG0082|consensus Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>KOG0085|consensus Back     alignment and domain information
>KOG0099|consensus Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0466|consensus Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>KOG0465|consensus Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>KOG0463|consensus Back     alignment and domain information
>KOG3886|consensus Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>KOG1954|consensus Back     alignment and domain information
>KOG0448|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0467|consensus Back     alignment and domain information
>KOG3905|consensus Back     alignment and domain information
>KOG0464|consensus Back     alignment and domain information
>KOG0459|consensus Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>KOG2423|consensus Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0447|consensus Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>PF14331 ImcF-related_N: ImcF-related N-terminal domain Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>KOG3887|consensus Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>KOG0469|consensus Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>PF02662 FlpD: Methyl-viologen-reducing hydrogenase, delta subunit; InterPro: IPR003813 Methyl-viologen-reducing hydrogenase (MVH) is one of the enzymes involved in methanogenesis and coded in the mth-flp-mvh-mrt cluster of methane genes in Methanothermobacter thermautotrophicus (Methanobacterium thermoformicicum) [] Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PRK13505 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
3lvr_E497 The Crystal Structure Of Asap3 In Complex With Arf6 5e-63
2a5d_A175 Structural Basis For The Activation Of Cholera Toxi 1e-62
1e0s_A174 Small G Protein Arf6-Gdp Length = 174 1e-62
3n5c_A162 Crystal Structure Of Arf6delta13 Complexed With Gdp 2e-62
2a5g_A175 Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length 6e-62
4fme_C160 Espg-Rab1-Arf6 Complex Length = 160 1e-61
2w83_A165 Crystal Structure Of The Arf6 Gtpase In Complex Wit 1e-61
3vhx_A172 The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesi 1e-61
3pcr_B162 Structure Of Espg-Arf6 Complex Length = 162 1e-60
3lrp_A181 Crystal Structure Of Plasmodium Falciparum Adp-Ribo 2e-44
3aq4_A184 Molecular Insights Into Plant Cell Proliferation Di 2e-43
1rrg_A181 Non-Myristoylated Rat Adp-Ribosylation Factor-1 Com 2e-42
1hur_A180 Human Adp-Ribosylation Factor 1 Complexed With Gdp, 2e-42
1re0_A164 Structure Of Arf1-Gdp Bound To Sec7 Domain Complexe 3e-42
3o47_A329 Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le 7e-42
3rd1_A178 Structure Of An Adp Ribosylation Factor From Entamo 8e-42
1j2j_A166 Crystal Structure Of Gga1 Gat N-terminal Region In 2e-41
1mr3_F181 Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 9e-40
2k5u_A181 Solution Structure Of Myirstoylated Yeast Arf1 Prot 6e-39
3tjz_A164 Crystal Structure Of Arf1 Bound To The GammaZETA-Co 1e-38
2b6h_A192 Structure Of Human Adp-Ribosylation Factor 5 Length 9e-38
2ksq_A181 The Myristoylated Yeast Arf1 In A Gtp And Bicelle B 2e-37
1z6x_A180 Structure Of Human Adp-Ribosylation Factor 4 Length 2e-37
2x77_A189 Crystal Structure Of Leishmania Major Adp Ribosylat 3e-28
1moz_A183 Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharo 6e-28
1zj6_A187 Crystal Structure Of Human Arl5 Length = 187 7e-27
1z6y_A179 Structure Of Human Adp-Ribosylation Factor-Like 5 L 7e-27
1r4a_A165 Crystal Structure Of Gtp-Bound Adp-Ribosylation Fac 1e-26
2h16_A183 Structure Of Human Adp-Ribosylation Factor-Like 5 ( 1e-26
2h17_A181 Structure Of Human Adp-Ribosylation Factor-Like 5 ( 1e-26
1yzg_A179 Structure Of Human Adp-ribosylation Factor-like 8 L 4e-26
4dcn_A166 Crystal Structure Analysis Of The Arfaptin2 Bar Dom 5e-25
1ksh_A186 Complex Of Arl2 And Pde Delta, Crystal Form 2 (Nati 2e-23
1ksg_A186 Complex Of Arl2 And Pde Delta, Crystal Form 1 Lengt 2e-23
1ksj_A186 Complex Of Arl2 And Pde Delta, Crystal Form 2 (Seme 3e-23
3doe_A192 Complex Of Arl2 And Bart, Crystal Form 1 Length = 1 3e-23
4gok_B169 The Crystal Structure Of Arl2gppnhp In Complex With 2e-22
4goj_A189 The Crystal Structure Of Full Length Arl3gppnhp In 1e-21
1fzq_A181 Crystal Structure Of Murine Arl3-Gdp Length = 181 1e-21
3bh7_A164 Crystal Structure Of The Rp2-Arl3 Complex Bound To 1e-21
3bh6_A164 Crystal Structure Of The Rp2-Arl3 Complex Bound To 9e-21
1upt_A171 Structure Of A Complex Of The Golgin-245 Grip Domai 1e-19
2h57_A190 Crystal Structure Of Human Adp-Ribosylation Factor- 6e-19
2al7_A186 Structure Of Human Adp-Ribosylation Factor-Like 10c 5e-17
1zd9_A188 Structure Of Human Adp-Ribosylation Factor-Like 10b 2e-16
2h18_A193 Structure Of Human Adp-Ribosylation Factor-Like 10b 2e-16
2qtv_B167 Structure Of Sec23-Sar1 Complexed With The Active F 1e-14
1m2o_B190 Crystal Structure Of The Sec23-Sar1 Complex Length 2e-14
2fmx_A195 An Open Conformation Of Switch I Revealed By Sar1-g 4e-13
1f6b_A198 Crystal Structure Of Sar1-Gdp Complex Length = 198 4e-13
2fa9_A189 The Crystal Structure Of Sar1[h79g]-gdp Provides In 6e-13
2gao_A208 Crystal Structure Of Human Sar1a In Complex With Gd 6e-13
4bas_A199 Structure Of The Arl6 Bbs3 Small Gtpase From Trypan 2e-11
3ffb_A360 Crystal Structure Of A Fast Activating G Protein Mu 1e-05
2zjy_A356 Structure Of The K349p Mutant Of Gi Alpha 1 Subunit 1e-05
3d7m_A354 Crystal Structure Of The G Protein Fast-Exchange Do 1e-05
3onw_A328 Structure Of A G-Alpha-I1 Mutant With Enhanced Affi 1e-05
1svk_A353 Structure Of The K180p Mutant Of Gi Alpha Subunit B 1e-05
2g83_A313 Structure Of Activated G-alpha-i1 Bound To A Nucleo 1e-05
2xns_A327 Crystal Structure Of Human G Alpha I1 Bound To A De 1e-05
2ik8_A324 Crystal Structure Of The Heterodimeric Complex Of H 1e-05
1as0_A353 Gtp-Gamma-S Bound G42v Gia1 Length = 353 1e-05
1gp2_A353 G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 Wi 1e-05
1bh2_A315 A326s Mutant Of An Inhibitory Alpha Subunit Length 1e-05
2gtp_A323 Crystal Structure Of The Heterodimeric Complex Of H 1e-05
3qe0_A325 A Galpha-I1 P-Loop Mutation Prevents Transition To 1e-05
3qi2_A328 A Galpha P-Loop Mutation Prevents Transition To The 1e-05
1fqj_A325 Crystal Structure Of The Heterotrimeric Complex Of 1e-05
4g5q_A330 Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 1e-05
3v00_C356 Studies Of A Constitutively Active G-Alpha Subunit 1e-05
1kjy_A325 Crystal Structure Of Human G[alpha]i1 Bound To The 1e-05
1y3a_A329 Structure Of G-Alpha-I1 Bound To A Gdp-Selective Pe 1e-05
2rhd_A175 Crystal Structure Of Cryptosporidium Parvum Small G 2e-05
2ihb_A323 Crystal Structure Of The Heterodimeric Complex Of H 4e-05
4g5o_A330 Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length 4e-05
4g5r_A330 Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 4e-05
1got_A350 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 4e-05
2ode_A350 Crystal Structure Of The Heterodimeric Complex Of H 5e-05
3ums_A354 Crystal Structure Of The G202a Mutant Of Human G-Al 6e-05
1gg2_A353 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 6e-05
1gil_A353 Structure Of Active Conformations Of Gia1 And The M 1e-04
3umr_A354 Crystal Structure Of The G202d Mutant Of Human G-Al 1e-04
1shz_A340 Crystal Structure Of The P115rhogef Rgrgs Domain In 1e-04
3l0i_B199 Complex Structure Of Sidm/drra With The Wild Type R 1e-04
4fmd_F164 Espg-Rab1 Complex Structure At 3.05 A Length = 164 1e-04
1ukv_Y206 Structure Of Rabgdp-Dissociation Inhibitor In Compl 2e-04
3tkl_A196 Crystal Structure Of The Gtp-Bound Rab1a In Complex 2e-04
2bcg_Y206 Structure Of Doubly Prenylated Ypt1:gdi Complex Len 2e-04
3sfv_A181 Crystal Structure Of The Gdp-Bound Rab1a S25n Mutan 2e-04
4fmb_B171 Vira-Rab1 Complex Structure Length = 171 2e-04
4fmc_B171 Espg-Rab1 Complex Length = 171 2e-04
2fol_A191 Crystal Structure Of Human Rab1a In Complex With Gd 2e-04
1yzn_A185 Gppnhp-Bound Ypt1p Gtpase Length = 185 2e-04
1z0a_A174 Gdp-Bound Rab2a Gtpase Length = 174 2e-04
3jza_A175 Crystal Structure Of Human Rab1b In Complex With Th 2e-04
4i1o_A181 Crystal Structure Of The Legionella Pneumophila Gap 3e-04
3c7k_A333 Molecular Architecture Of Galphao And The Structura 3e-04
3cx7_A338 Crystal Structure Of Pdzrhogef Rgrgs Domain In A Co 4e-04
1zcb_A362 Crystal Structure Of G Alpha 13 In Complex With Gdp 5e-04
4fmc_F117 Espg-Rab1 Complex Length = 117 7e-04
>pdb|3LVR|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Soaked With Calcium Length = 497 Back     alignment and structure

Iteration: 1

Score = 235 bits (599), Expect = 5e-63, Method: Compositional matrix adjust. Identities = 109/112 (97%), Positives = 111/112 (99%) Query: 1 DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN 60 DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN Sbjct: 372 DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN 431 Query: 61 KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTADGLYEGLTWLTSNHK 112 KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCAT+ DGLYEGLTWLTSN+K Sbjct: 432 KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK 483
>pdb|2A5D|A Chain A, Structural Basis For The Activation Of Cholera Toxin By Human Arf6-Gtp Length = 175 Back     alignment and structure
>pdb|1E0S|A Chain A, Small G Protein Arf6-Gdp Length = 174 Back     alignment and structure
>pdb|3N5C|A Chain A, Crystal Structure Of Arf6delta13 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|2A5G|A Chain A, Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length = 175 Back     alignment and structure
>pdb|4FME|C Chain C, Espg-Rab1-Arf6 Complex Length = 160 Back     alignment and structure
>pdb|2W83|A Chain A, Crystal Structure Of The Arf6 Gtpase In Complex With A Specific Effector, Jip4 Length = 165 Back     alignment and structure
>pdb|3VHX|A Chain A, The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesin-Like Protein 1) Complex Length = 172 Back     alignment and structure
>pdb|3PCR|B Chain B, Structure Of Espg-Arf6 Complex Length = 162 Back     alignment and structure
>pdb|3LRP|A Chain A, Crystal Structure Of Plasmodium Falciparum Adp-Ribosylation Factor 1 Length = 181 Back     alignment and structure
>pdb|3AQ4|A Chain A, Molecular Insights Into Plant Cell Proliferation Disturbance By Agrobacterium Protein 6b Length = 184 Back     alignment and structure
>pdb|1RRG|A Chain A, Non-Myristoylated Rat Adp-Ribosylation Factor-1 Complexed With Gdp, Dimeric Crystal Form Length = 181 Back     alignment and structure
>pdb|1HUR|A Chain A, Human Adp-Ribosylation Factor 1 Complexed With Gdp, Full Length = 180 Back     alignment and structure
>pdb|1RE0|A Chain A, Structure Of Arf1-Gdp Bound To Sec7 Domain Complexed With Brefeldin A Length = 164 Back     alignment and structure
>pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 Back     alignment and structure
>pdb|3RD1|A Chain A, Structure Of An Adp Ribosylation Factor From Entamoeba Histolytica Hm- 1:imss Bound To Mg-Gdp Length = 178 Back     alignment and structure
>pdb|1J2J|A Chain A, Crystal Structure Of Gga1 Gat N-terminal Region In Complex With Arf1 Gtp Form Length = 166 Back     alignment and structure
>pdb|1MR3|F Chain F, Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 (Scarf2) Complexed With Gdp-3'p At 1.6a Resolution Length = 181 Back     alignment and structure
>pdb|2K5U|A Chain A, Solution Structure Of Myirstoylated Yeast Arf1 Protein, Gdp- Bound Length = 181 Back     alignment and structure
>pdb|3TJZ|A Chain A, Crystal Structure Of Arf1 Bound To The GammaZETA-Cop Core Complex Length = 164 Back     alignment and structure
>pdb|2B6H|A Chain A, Structure Of Human Adp-Ribosylation Factor 5 Length = 192 Back     alignment and structure
>pdb|2KSQ|A Chain A, The Myristoylated Yeast Arf1 In A Gtp And Bicelle Bound Conformation Length = 181 Back     alignment and structure
>pdb|1Z6X|A Chain A, Structure Of Human Adp-Ribosylation Factor 4 Length = 180 Back     alignment and structure
>pdb|2X77|A Chain A, Crystal Structure Of Leishmania Major Adp Ribosylation Factor-Like 1. Length = 189 Back     alignment and structure
>pdb|1MOZ|A Chain A, Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharomyces Cerevisiae Length = 183 Back     alignment and structure
>pdb|1ZJ6|A Chain A, Crystal Structure Of Human Arl5 Length = 187 Back     alignment and structure
>pdb|1Z6Y|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 Length = 179 Back     alignment and structure
>pdb|1R4A|A Chain A, Crystal Structure Of Gtp-Bound Adp-Ribosylation Factor Like Protein 1 (Arl1) And Grip Domain Of Golgin245 Complex Length = 165 Back     alignment and structure
>pdb|2H16|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 (Arl5) Length = 183 Back     alignment and structure
>pdb|2H17|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 (Arl5) (Casp Target) Length = 181 Back     alignment and structure
>pdb|1YZG|A Chain A, Structure Of Human Adp-ribosylation Factor-like 8 Length = 179 Back     alignment and structure
>pdb|4DCN|A Chain A, Crystal Structure Analysis Of The Arfaptin2 Bar Domain In Complex With Arl1 Length = 166 Back     alignment and structure
>pdb|1KSH|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Native) Length = 186 Back     alignment and structure
>pdb|1KSG|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 1 Length = 186 Back     alignment and structure
>pdb|1KSJ|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Semet) Length = 186 Back     alignment and structure
>pdb|3DOE|A Chain A, Complex Of Arl2 And Bart, Crystal Form 1 Length = 192 Back     alignment and structure
>pdb|4GOK|B Chain B, The Crystal Structure Of Arl2gppnhp In Complex With Unc119a Length = 169 Back     alignment and structure
>pdb|4GOJ|A Chain A, The Crystal Structure Of Full Length Arl3gppnhp In Complex With Unc119a Length = 189 Back     alignment and structure
>pdb|1FZQ|A Chain A, Crystal Structure Of Murine Arl3-Gdp Length = 181 Back     alignment and structure
>pdb|3BH7|A Chain A, Crystal Structure Of The Rp2-Arl3 Complex Bound To Gdp-Alf4 Length = 164 Back     alignment and structure
>pdb|3BH6|A Chain A, Crystal Structure Of The Rp2-Arl3 Complex Bound To Gppnhp Length = 164 Back     alignment and structure
>pdb|1UPT|A Chain A, Structure Of A Complex Of The Golgin-245 Grip Domain With Arl1 Length = 171 Back     alignment and structure
>pdb|2H57|A Chain A, Crystal Structure Of Human Adp-Ribosylation Factor-Like 6 Length = 190 Back     alignment and structure
>pdb|2AL7|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10c Length = 186 Back     alignment and structure
>pdb|1ZD9|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b Length = 188 Back     alignment and structure
>pdb|2H18|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b (Arl10b) Length = 193 Back     alignment and structure
>pdb|2QTV|B Chain B, Structure Of Sec23-Sar1 Complexed With The Active Fragment Of Sec31 Length = 167 Back     alignment and structure
>pdb|1M2O|B Chain B, Crystal Structure Of The Sec23-Sar1 Complex Length = 190 Back     alignment and structure
>pdb|2FMX|A Chain A, An Open Conformation Of Switch I Revealed By Sar1-gdp Crystal Structure At Low Mg(2+) Length = 195 Back     alignment and structure
>pdb|1F6B|A Chain A, Crystal Structure Of Sar1-Gdp Complex Length = 198 Back     alignment and structure
>pdb|2FA9|A Chain A, The Crystal Structure Of Sar1[h79g]-gdp Provides Insight Into The Coat-controlled Gtp Hydrolysis In The Disassembly Of Cop Ii Length = 189 Back     alignment and structure
>pdb|2GAO|A Chain A, Crystal Structure Of Human Sar1a In Complex With Gdp Length = 208 Back     alignment and structure
>pdb|4BAS|A Chain A, Structure Of The Arl6 Bbs3 Small Gtpase From Trypanosoma Brucei With Bound Nucleotide Analogue Gppnp Length = 199 Back     alignment and structure
>pdb|2ZJY|A Chain A, Structure Of The K349p Mutant Of Gi Alpha 1 Subunit Bound To Alf4 And Gdp Length = 356 Back     alignment and structure
>pdb|3D7M|A Chain A, Crystal Structure Of The G Protein Fast-Exchange Double Mutant I56cQ333C Length = 354 Back     alignment and structure
>pdb|3ONW|A Chain A, Structure Of A G-Alpha-I1 Mutant With Enhanced Affinity For The Rgs14 Goloco Motif. Length = 328 Back     alignment and structure
>pdb|1SVK|A Chain A, Structure Of The K180p Mutant Of Gi Alpha Subunit Bound To Alf4 And Gdp Length = 353 Back     alignment and structure
>pdb|2G83|A Chain A, Structure Of Activated G-alpha-i1 Bound To A Nucleotide- State-selective Peptide: Minimal Determinants For Recognizing The Active Form Of A G Protein Alpha Subunit Length = 313 Back     alignment and structure
>pdb|2XNS|A Chain A, Crystal Structure Of Human G Alpha I1 Bound To A Designed Helical Peptide Derived From The Goloco Motif Of Rgs14 Length = 327 Back     alignment and structure
>pdb|2IK8|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs16 And Activated Gi Alpha 1 Length = 324 Back     alignment and structure
>pdb|1AS0|A Chain A, Gtp-Gamma-S Bound G42v Gia1 Length = 353 Back     alignment and structure
>pdb|1GP2|A Chain A, G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 With Gdp Bound Length = 353 Back     alignment and structure
>pdb|1BH2|A Chain A, A326s Mutant Of An Inhibitory Alpha Subunit Length = 315 Back     alignment and structure
>pdb|2GTP|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs1 And Activated Gi Alpha 1 Length = 323 Back     alignment and structure
>pdb|3QE0|A Chain A, A Galpha-I1 P-Loop Mutation Prevents Transition To The Activated State Length = 325 Back     alignment and structure
>pdb|3QI2|A Chain A, A Galpha P-Loop Mutation Prevents Transition To The Activated State: G42r Bound To Rgs14 Goloco Length = 328 Back     alignment and structure
>pdb|1FQJ|A Chain A, Crystal Structure Of The Heterotrimeric Complex Of The Rgs Domain Of Rgs9, The Gamma Subunit Of Phosphodiesterase And The GtI1 CHIMERA ALPHA SUBUNIT [(RGS9)-(Pdegamma)- (GtI1ALPHA)-(Gdp)-(Alf4-)-(Mg2+)] Length = 325 Back     alignment and structure
>pdb|4G5Q|A Chain A, Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 Back     alignment and structure
>pdb|3V00|C Chain C, Studies Of A Constitutively Active G-Alpha Subunit Provide Insights Into The Mechanism Of G Protein Activation. Length = 356 Back     alignment and structure
>pdb|1KJY|A Chain A, Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14 Length = 325 Back     alignment and structure
>pdb|1Y3A|A Chain A, Structure Of G-Alpha-I1 Bound To A Gdp-Selective Peptide Provides Insight Into Guanine Nucleotide Exchange Length = 329 Back     alignment and structure
>pdb|2RHD|A Chain A, Crystal Structure Of Cryptosporidium Parvum Small Gtpase Rab1a Length = 175 Back     alignment and structure
>pdb|2IHB|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs10 And Activated Gi Alpha 3 Length = 323 Back     alignment and structure
>pdb|4G5O|A Chain A, Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length = 330 Back     alignment and structure
>pdb|4G5R|A Chain A, Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 Back     alignment and structure
>pdb|1GOT|A Chain A, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 350 Back     alignment and structure
>pdb|2ODE|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs8 And Activated Gi Alpha 3 Length = 350 Back     alignment and structure
>pdb|3UMS|A Chain A, Crystal Structure Of The G202a Mutant Of Human G-Alpha-I1 Length = 354 Back     alignment and structure
>pdb|1GG2|A Chain A, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 353 Back     alignment and structure
>pdb|1GIL|A Chain A, Structure Of Active Conformations Of Gia1 And The Mechanism Of Gtp Hydrolysis Length = 353 Back     alignment and structure
>pdb|3UMR|A Chain A, Crystal Structure Of The G202d Mutant Of Human G-Alpha-I1 Length = 354 Back     alignment and structure
>pdb|1SHZ|A Chain A, Crystal Structure Of The P115rhogef Rgrgs Domain In A Complex With Galpha(13):galpha(i1) Chimera Length = 340 Back     alignment and structure
>pdb|3L0I|B Chain B, Complex Structure Of Sidm/drra With The Wild Type Rab1 Length = 199 Back     alignment and structure
>pdb|4FMD|F Chain F, Espg-Rab1 Complex Structure At 3.05 A Length = 164 Back     alignment and structure
>pdb|1UKV|Y Chain Y, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 206 Back     alignment and structure
>pdb|3TKL|A Chain A, Crystal Structure Of The Gtp-Bound Rab1a In Complex With The Coiled- Coil Domain Of Lida From Legionella Pneumophila Length = 196 Back     alignment and structure
>pdb|2BCG|Y Chain Y, Structure Of Doubly Prenylated Ypt1:gdi Complex Length = 206 Back     alignment and structure
>pdb|3SFV|A Chain A, Crystal Structure Of The Gdp-Bound Rab1a S25n Mutant In Complex With The Coiled-Coil Domain Of Lida From Legionella Pneumophila Length = 181 Back     alignment and structure
>pdb|4FMB|B Chain B, Vira-Rab1 Complex Structure Length = 171 Back     alignment and structure
>pdb|4FMC|B Chain B, Espg-Rab1 Complex Length = 171 Back     alignment and structure
>pdb|2FOL|A Chain A, Crystal Structure Of Human Rab1a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|1YZN|A Chain A, Gppnhp-Bound Ypt1p Gtpase Length = 185 Back     alignment and structure
>pdb|1Z0A|A Chain A, Gdp-Bound Rab2a Gtpase Length = 174 Back     alignment and structure
>pdb|3JZA|A Chain A, Crystal Structure Of Human Rab1b In Complex With The Gef Domain Of DrraSIDM FROM LEGIONELLA PNEUMOPHILA Length = 175 Back     alignment and structure
>pdb|4I1O|A Chain A, Crystal Structure Of The Legionella Pneumophila Gap Domain Of Lepb In Complex With Rab1b Bound To Gdp And Bef3 Length = 181 Back     alignment and structure
>pdb|3C7K|A Chain A, Molecular Architecture Of Galphao And The Structural Basis For Rgs16-Mediated Deactivation Length = 333 Back     alignment and structure
>pdb|3CX7|A Chain A, Crystal Structure Of Pdzrhogef Rgrgs Domain In A Complex With Galpha-13 Bound To Gdp-Alf4 Length = 338 Back     alignment and structure
>pdb|1ZCB|A Chain A, Crystal Structure Of G Alpha 13 In Complex With Gdp Length = 362 Back     alignment and structure
>pdb|4FMC|F Chain F, Espg-Rab1 Complex Length = 117 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 2e-70
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 8e-68
3o47_A329 ADP-ribosylation factor GTPase-activating protein 9e-68
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 1e-67
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 2e-67
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 2e-67
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 3e-67
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 7e-67
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 8e-67
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 1e-66
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 1e-66
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-66
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 5e-66
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 1e-65
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 4e-64
3t1o_A198 Gliding protein MGLA; G domain containing protein, 1e-46
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 2e-46
2fh5_B214 SR-beta, signal recognition particle receptor beta 5e-46
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 3e-39
1nrj_B218 SR-beta, signal recognition particle receptor beta 3e-38
2ged_A193 SR-beta, signal recognition particle receptor beta 4e-37
3llu_A196 RAS-related GTP-binding protein C; structural geno 1e-19
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 1e-16
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 2e-09
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 1e-05
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 2e-05
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 2e-05
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 3e-05
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 3e-05
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 3e-05
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 6e-05
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 6e-05
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 6e-05
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 6e-05
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 6e-05
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 7e-05
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 8e-05
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 9e-05
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 9e-05
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 9e-05
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 1e-04
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 1e-04
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 1e-04
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 1e-04
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 1e-04
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 1e-04
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 1e-04
3bbp_A211 RAB-6, RAS-related protein RAB-6A; golgi complex, 1e-04
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 1e-04
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 2e-04
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 2e-04
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 2e-04
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 2e-04
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 2e-04
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 2e-04
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 3e-04
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 3e-04
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 3e-04
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 3e-04
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 3e-04
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 3e-04
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 3e-04
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 4e-04
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 4e-04
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 4e-04
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 5e-04
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 5e-04
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 5e-04
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 5e-04
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 5e-04
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 5e-04
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 6e-04
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 6e-04
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 6e-04
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 6e-04
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 6e-04
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 6e-04
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 7e-04
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 7e-04
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 9e-04
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 9e-04
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Back     alignment and structure
 Score =  207 bits (529), Expect = 2e-70
 Identities = 35/112 (31%), Positives = 64/112 (57%)

Query: 1   DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN 60
           D+GGQ + R +W  Y  G   ++++VD AD+++I+ ++ ELH +++  +++   +L+  N
Sbjct: 73  DIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGN 132

Query: 61  KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTADGLYEGLTWLTSNHK 112
           K+DLP A+   E+ EK+ L+ I+DR            D +   L WL  + K
Sbjct: 133 KRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSK 184


>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Length = 190 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Length = 198 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Length = 227 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 331 Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Length = 362 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Length = 354 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Length = 402 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Length = 353 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Length = 208 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 Back     alignment and structure
>3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.93
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.93
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.92
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.92
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.92
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.92
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.91
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.91
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.91
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.91
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.91
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.91
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.91
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.91
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.9
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.89
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.89
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 99.89
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.88
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.87
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.86
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.86
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 99.85
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.85
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.85
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.85
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.85
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.85
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.85
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.85
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.84
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.84
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.84
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.84
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.84
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.84
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.84
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.84
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.84
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.84
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.83
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.83
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.83
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.83
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.83
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.83
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.83
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.83
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.83
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.83
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.83
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.83
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.83
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.83
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.83
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.83
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.83
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.83
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.83
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.83
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.83
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.83
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.82
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.82
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.82
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.82
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.82
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.82
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.82
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.82
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.82
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.82
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.82
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.82
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.82
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.82
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.82
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.82
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.82
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.81
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.81
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.81
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.81
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 99.81
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.81
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.81
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.81
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.81
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.81
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.81
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.81
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.81
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.81
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.8
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.8
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.8
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.8
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.8
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.8
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.8
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 99.8
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.79
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.79
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.78
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 99.78
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.78
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.77
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.64
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.76
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.76
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.75
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.73
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.73
1u0l_A 301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.71
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.71
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.7
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.7
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.69
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.69
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.68
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.67
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.67
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.66
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.65
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.63
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.62
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 99.61
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.6
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.6
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.6
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.6
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.59
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.59
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.59
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.59
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.58
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 99.58
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.58
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.57
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.57
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.56
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.56
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.55
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.55
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.54
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.54
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.54
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.53
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.53
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.53
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.53
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.51
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.51
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 99.5
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 99.49
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.47
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.47
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.46
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.45
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.45
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 99.45
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.45
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.43
2ged_A193 SR-beta, signal recognition particle receptor beta 99.43
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.42
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.41
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.41
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.38
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.37
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.36
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.32
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.31
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 99.31
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.3
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.29
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.28
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 99.26
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.25
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.23
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.22
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.21
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.2
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.19
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 99.15
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 99.14
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.12
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 99.11
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.1
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.09
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.01
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.01
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.0
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 98.97
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 98.96
3lxw_A247 GTPase IMAP family member 1; immunity, structural 98.93
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 98.93
3lxx_A239 GTPase IMAP family member 4; structural genomics c 98.86
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 98.84
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.83
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 98.81
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 98.76
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 98.74
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 98.72
2www_A349 Methylmalonic aciduria type A protein, mitochondri 98.72
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 98.64
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.59
1t9h_A 307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.59
1wxq_A 397 GTP-binding protein; structural genomics, riken st 98.58
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 98.43
2rcn_A 358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.34
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.28
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.26
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.25
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 97.88
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 97.83
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 96.83
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 96.6
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 94.9
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 94.9
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 94.11
3end_A307 Light-independent protochlorophyllide reductase ir 93.22
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 92.7
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 92.23
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 91.54
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 91.48
3cwq_A209 Para family chromosome partitioning protein; alpha 90.83
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 90.62
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 90.06
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 89.76
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 88.57
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 88.42
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 87.96
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 85.48
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 85.14
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 83.92
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 83.82
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 81.12
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
Probab=99.93  E-value=1.8e-24  Score=127.59  Aligned_cols=112  Identities=64%  Similarity=1.214  Sum_probs=97.8

Q ss_pred             CCCCccCchhhHHhhhcCCcEEEEEEECCChhhHHHHHHHHHHHHcCcCCCCCeEEEEEeCCCCCCCCCHHHHHHHhCCC
Q psy17510          1 DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLT   80 (113)
Q Consensus         1 D~~G~~~~~~~~~~~~~~~~~vi~v~d~~~~~~~~~~~~~~~~~~~~~~~~~~p~ilv~nK~D~~~~~~~~~~~~~~~~~   80 (113)
                      ||||+++++.++..++.++|++++|+|++++.+++....|+..+.......+.|+++++||+|+.+.....++.+.++..
T Consensus        50 Dt~G~~~~~~~~~~~~~~~d~~i~v~d~~~~~s~~~~~~~~~~~~~~~~~~~~piilv~nK~Dl~~~~~~~~~~~~~~~~  129 (164)
T 1r8s_A           50 DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLH  129 (164)
T ss_dssp             ECCCCGGGHHHHHHHTTTCSEEEEEEETTCGGGHHHHHHHHHHHHTCGGGTTCEEEEEEECTTSTTCCCHHHHHHHTTGG
T ss_pred             EcCCChhhHHHHHHHhccCCEEEEEEECCCHHHHHHHHHHHHHHHhchhhcCCeEEEEEECcCCcCCCCHHHHHHHhCcc
Confidence            89999999999999999999999999999999999999999988765445689999999999998776677787777765


Q ss_pred             ccCCCCeEEEeccccCCCCHHHHHHHHHhhcC
Q psy17510         81 RIRDRNWYVQPSCATTADGLYEGLTWLTSNHK  112 (113)
Q Consensus        81 ~~~~~~~~~~~~sa~~~~~i~~~~~~l~~~~~  112 (113)
                      .....+++++++||+++.|++++++++.+.+.
T Consensus       130 ~~~~~~~~~~~~Sa~~~~gi~~l~~~l~~~i~  161 (164)
T 1r8s_A          130 SLRHRNWYIQATCATSGDGLYEGLDWLSNQLR  161 (164)
T ss_dssp             GCSSCCEEEEECBTTTTBTHHHHHHHHHHHC-
T ss_pred             cccCccEEEEEcccCCCcCHHHHHHHHHHHHh
Confidence            55566789999999999999999999988763



>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 113
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 7e-27
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 3e-17
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 2e-16
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 1e-15
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 2e-15
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 2e-14
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 2e-12
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 2e-12
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 8e-12
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 5e-11
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 1e-10
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 2e-10
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 7e-10
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 7e-10
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 3e-09
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 1e-08
d1azta2221 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub 1e-08
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 7e-08
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 9e-08
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-07
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 6e-07
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 5e-05
d1svsa1195 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub 2e-04
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 4e-04
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 8e-04
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 9e-04
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARF6 [TaxId: 9606]
 Score = 95.4 bits (236), Expect = 7e-27
 Identities = 109/112 (97%), Positives = 111/112 (99%)

Query: 1   DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN 60
           DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN
Sbjct: 62  DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN 121

Query: 61  KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTADGLYEGLTWLTSNHK 112
           KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCAT+ DGLYEGLTWLTSN+K
Sbjct: 122 KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK 173


>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.94
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.93
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.93
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.93
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.92
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.88
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.88
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.88
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.87
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.87
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.87
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.87
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.87
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.87
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.87
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.86
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.85
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.85
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.83
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.82
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.82
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.82
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.8
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.78
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.78
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.75
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.73
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.62
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.62
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.6
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.58
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.58
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.56
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.53
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.51
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.5
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.49
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.49
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.47
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.47
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.44
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.42
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.39
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.37
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.36
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.28
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.25
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.24
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.16
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.07
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.05
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 98.98
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 98.97
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.85
d1u0la2 225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.77
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.75
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.73
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.6
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 98.56
d1t9ha2 231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.55
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 98.41
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.1
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.02
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 97.49
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 96.45
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 96.21
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 93.85
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 93.75
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 93.69
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARF6 [TaxId: 9606]
Probab=99.94  E-value=1.6e-25  Score=132.47  Aligned_cols=112  Identities=97%  Similarity=1.540  Sum_probs=102.0

Q ss_pred             CCCCccCchhhHHhhhcCCcEEEEEEECCChhhHHHHHHHHHHHHcCcCCCCCeEEEEEeCCCCCCCCCHHHHHHHhCCC
Q psy17510          1 DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLT   80 (113)
Q Consensus         1 D~~G~~~~~~~~~~~~~~~~~vi~v~d~~~~~~~~~~~~~~~~~~~~~~~~~~p~ilv~nK~D~~~~~~~~~~~~~~~~~   80 (113)
                      |+||++.++..+..++.+++++++|+|.++..++.....|+....+.....+.|+++++||+|+++.....++.+.+++.
T Consensus        62 D~~g~~~~~~~~~~~~~~~~~ii~v~D~s~~~~~~~~~~~l~~~~~~~~~~~~piiiv~NK~Dl~~~~~~~~i~~~~~~~  141 (173)
T d1e0sa_          62 DVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLT  141 (173)
T ss_dssp             EESCCGGGHHHHGGGTTTCCEEEEEEETTCGGGHHHHHHHHHHHHTSGGGTTCEEEEEEECTTSTTCCCHHHHHHHTTGG
T ss_pred             cCCCcchhhhHHHhhhcccceEEEEEecccchhHHHHHHHHHHHhhhcccccceeeeeeecccccccccHHHHHHHHHHH
Confidence            78999999999999999999999999999999999998888888776666789999999999998888888888888877


Q ss_pred             ccCCCCeEEEeccccCCCCHHHHHHHHHhhcC
Q psy17510         81 RIRDRNWYVQPSCATTADGLYEGLTWLTSNHK  112 (113)
Q Consensus        81 ~~~~~~~~~~~~sa~~~~~i~~~~~~l~~~~~  112 (113)
                      .+....+++++|||++|+|++++|+||.+.++
T Consensus       142 ~~~~~~~~~~e~SA~tg~gv~e~~~~l~~~~k  173 (173)
T d1e0sa_         142 RIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK  173 (173)
T ss_dssp             GCCSSCEEEEECBTTTTBTHHHHHHHHHHHCC
T ss_pred             HHHhCCCEEEEeeCCCCcCHHHHHHHHHHhcC
Confidence            77777899999999999999999999998764



>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure