Psyllid ID: psy17620
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 741 | ||||||
| 242015590 | 4870 | ciliary dynein heavy chain, putative [Pe | 0.534 | 0.081 | 0.628 | 1e-170 | |
| 328717563 | 3313 | PREDICTED: dynein heavy chain 10, axonem | 0.537 | 0.120 | 0.624 | 1e-169 | |
| 443721104 | 4363 | hypothetical protein CAPTEDRAFT_221643 [ | 0.539 | 0.091 | 0.617 | 1e-169 | |
| 292613807 | 4559 | PREDICTED: dynein heavy chain 10, axonem | 0.543 | 0.088 | 0.618 | 1e-169 | |
| 383849047 | 4926 | PREDICTED: dynein heavy chain 10, axonem | 0.546 | 0.082 | 0.614 | 1e-169 | |
| 345490720 | 4875 | PREDICTED: dynein heavy chain 10, axonem | 0.546 | 0.083 | 0.624 | 1e-169 | |
| 410923098 | 4484 | PREDICTED: dynein heavy chain 10, axonem | 0.534 | 0.088 | 0.618 | 1e-168 | |
| 291230734 | 4610 | PREDICTED: predicted protein-like [Sacco | 0.543 | 0.087 | 0.62 | 1e-168 | |
| 449476739 | 4480 | PREDICTED: LOW QUALITY PROTEIN: dynein h | 0.543 | 0.089 | 0.615 | 1e-168 | |
| 194214400 | 4500 | PREDICTED: dynein heavy chain 10, axonem | 0.546 | 0.09 | 0.617 | 1e-168 |
| >gi|242015590|ref|XP_002428436.1| ciliary dynein heavy chain, putative [Pediculus humanus corporis] gi|212513048|gb|EEB15698.1| ciliary dynein heavy chain, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 603 bits (1556), Expect = e-170, Method: Compositional matrix adjust.
Identities = 310/493 (62%), Positives = 347/493 (70%), Gaps = 97/493 (19%)
Query: 314 IMDAEEFQWESQLRYYWKKSYLDWKDSLVIIQCSGSFEYGYEHEYMGLNGSFEYGYEYMG 373
I D++EF+WESQLR+YW K D+L++ QC+G FEYGY EYMG
Sbjct: 2152 ITDSQEFEWESQLRFYWIKE----ADNLMVKQCTGIFEYGY---------------EYMG 2192
Query: 374 LNGRLVITPLTDRIYLTITQALSMRLGAAPAG---------------------------- 405
LNGRLVITPLTDRIYLTITQALSM+LG APAG
Sbjct: 2193 LNGRLVITPLTDRIYLTITQALSMQLGGAPAGPAGTGKTETTKDLAKALGLLCMVTNCGE 2252
Query: 406 -MDFLAFGKILSGLSQCGAWGCFDEFNRIDVSVLSVISTQLLTIRTALLINATRFQFEGH 464
MD AFGKIL+GL QCGAWGCFDEFNRID+SVLSVISTQL TIR A L+ +F FE
Sbjct: 2253 GMDHKAFGKILNGLCQCGAWGCFDEFNRIDISVLSVISTQLQTIRNAKLLKLKKFNFENQ 2312
Query: 465 DIIMNNKVGIFITMNPGYAGRTELPESVKALFRPVVCIVPDFELICQIMLFSEGFLEAKV 524
+I +++KVGIF+TMNPGYAGRTELPESVKALFRPVVCIVPD E+IC IMLFSEGFLEAK+
Sbjct: 2313 EITLDSKVGIFVTMNPGYAGRTELPESVKALFRPVVCIVPDLEMICLIMLFSEGFLEAKI 2372
Query: 525 LAKKMAVLYKLSKEQLSKQCHYDFGMRALKSVLVMAGELKRAALQLEESVVLMRALRDMN 584
LAKKM VLYKL++EQLSKQ HYDFG+RALKSVLVMAGELKR A +L E VVLMRALRDMN
Sbjct: 2373 LAKKMTVLYKLAQEQLSKQSHYDFGLRALKSVLVMAGELKRGAQELPEDVVLMRALRDMN 2432
Query: 585 LPKFVSED-----------------------------------------------VVQMY 597
LPKF+ +D VVQMY
Sbjct: 2433 LPKFIFDDVPLFLGLITDLFPGLECPRVGYPNFNAAVEKALREDNYEILPDQMDKVVQMY 2492
Query: 598 ETMLTRHSTMIVGPTGGGKSVVINALVKTSTVLGYPARTYTLNPKAVSVIELYGVLNPET 657
ETM+TRHSTMIVGPTGGGK+VVI L K T L P + Y LNPKA SV ELYGVL+P T
Sbjct: 2493 ETMMTRHSTMIVGPTGGGKTVVIQTLQKAQTALDLPTKLYVLNPKACSVTELYGVLDPVT 2552
Query: 658 RDWYDGLLSNIFRAVNKPLDPGSKERKYILFDGDVDALWIENMNSVMDDNKILTLANGER 717
RDW DGLLS IFR +NKP++ + ER+YILFDGDVDALWIENMNSVMDDNK+LTLANGER
Sbjct: 2553 RDWTDGLLSCIFREINKPIE--NPERRYILFDGDVDALWIENMNSVMDDNKLLTLANGER 2610
Query: 718 IRLLAHCQLLFEI 730
IRLL HC LLFE+
Sbjct: 2611 IRLLPHCALLFEV 2623
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328717563|ref|XP_003246241.1| PREDICTED: dynein heavy chain 10, axonemal-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|443721104|gb|ELU10552.1| hypothetical protein CAPTEDRAFT_221643 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|292613807|ref|XP_698507.4| PREDICTED: dynein heavy chain 10, axonemal [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|383849047|ref|XP_003700158.1| PREDICTED: dynein heavy chain 10, axonemal-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|345490720|ref|XP_001601632.2| PREDICTED: dynein heavy chain 10, axonemal [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|410923098|ref|XP_003975019.1| PREDICTED: dynein heavy chain 10, axonemal-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|291230734|ref|XP_002735320.1| PREDICTED: predicted protein-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|449476739|ref|XP_004176474.1| PREDICTED: LOW QUALITY PROTEIN: dynein heavy chain 10, axonemal [Taeniopygia guttata] | Back alignment and taxonomy information |
|---|
| >gi|194214400|ref|XP_001915485.1| PREDICTED: dynein heavy chain 10, axonemal [Equus caballus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 741 | ||||||
| ZFIN|ZDB-GENE-060531-163 | 3330 | si:dkeyp-86b9.1 "si:dkeyp-86b9 | 0.369 | 0.082 | 0.631 | 9e-167 | |
| UNIPROTKB|F1RFM8 | 4479 | DNAH10 "Uncharacterized protei | 0.372 | 0.061 | 0.617 | 3.7e-164 | |
| UNIPROTKB|J9JHE6 | 4028 | DNAH10 "Uncharacterized protei | 0.369 | 0.068 | 0.614 | 1.3e-162 | |
| UNIPROTKB|F1NQP3 | 4033 | F1NQP3 "Uncharacterized protei | 0.369 | 0.067 | 0.621 | 1.7e-162 | |
| UNIPROTKB|F1PMG2 | 4291 | DNAH10 "Uncharacterized protei | 0.369 | 0.063 | 0.614 | 1.7e-162 | |
| UNIPROTKB|F1LR86 | 3322 | Dnah10 "Protein Dnah10" [Rattu | 0.369 | 0.082 | 0.621 | 1.9e-162 | |
| UNIPROTKB|Q8IVF4 | 4471 | DNAH10 "Dynein heavy chain 10, | 0.369 | 0.061 | 0.625 | 3.3e-162 | |
| UNIPROTKB|F1MSP8 | 4470 | Bt.11479 "Uncharacterized prot | 0.369 | 0.061 | 0.619 | 8.8e-162 | |
| UNIPROTKB|E2RMJ8 | 4436 | DNAH10 "Uncharacterized protei | 0.369 | 0.061 | 0.612 | 1.8e-161 | |
| FB|FBgn0013813 | 5080 | Dhc98D "Dynein heavy chain at | 0.369 | 0.053 | 0.587 | 5.9e-152 |
| ZFIN|ZDB-GENE-060531-163 si:dkeyp-86b9.1 "si:dkeyp-86b9.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 866 (309.9 bits), Expect = 9.0e-167, Sum P(3) = 9.0e-167
Identities = 187/296 (63%), Positives = 215/296 (72%)
Query: 314 IMDAEEFQWESQLRYYWKKSYLDWKDSLVIIQCSGSFEYGYEHEYMGLNGSFEY----GY 369
I DA EF+WESQLR+YW K D L + QCS F YGYE YMGLNG
Sbjct: 614 ITDAREFEWESQLRFYWVKE----PDELFVRQCSAQFCYGYE--YMGLNGRLVITPLTDR 667
Query: 370 EYMGLNGRLVI----TPL----TDRIYLT--ITQALSMRLGAAPAG--MDFLAFGKILSG 417
Y+ L L + P T + T + +AL + G MD++A GKILSG
Sbjct: 668 IYLTLTQALSMFLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKILSG 727
Query: 418 LSQCGAWGCFDEFNRIDVSVLSVISTQLLTIRTALLINATRFQFEGHDIIMNNKVGIFIT 477
L+QCGAWGCFDEFNRID SVLSVIS+Q+ TIR AL+++ RF FEG +I ++N++GIFIT
Sbjct: 728 LAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALMLHLQRFHFEGQEISLDNRIGIFIT 787
Query: 478 MNPGYAGRTELPESVKALFRPVVCIVPDFELICQIMLFSEGFLEAKVLAKKMAVLYKLSK 537
MNPGYAGRTELPESVKALFRPVV IVPD + IC+IMLFSEGFL AKVLAKKM VLYKL++
Sbjct: 788 MNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLVAKVLAKKMTVLYKLAR 847
Query: 538 EQLSKQCHYDFGMRALKSVLVMAGELKRAALQLEESVVLMRALRDMNLPKFVSEDV 593
EQLSKQ HYDFG+RALKSVLVMAGELKR + L E VVLMRALRDMNLPKFV EDV
Sbjct: 848 EQLSKQSHYDFGLRALKSVLVMAGELKRGSPNLSEDVVLMRALRDMNLPKFVFEDV 903
|
|
| UNIPROTKB|F1RFM8 DNAH10 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9JHE6 DNAH10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NQP3 F1NQP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PMG2 DNAH10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LR86 Dnah10 "Protein Dnah10" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IVF4 DNAH10 "Dynein heavy chain 10, axonemal" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MSP8 Bt.11479 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RMJ8 DNAH10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0013813 Dhc98D "Dynein heavy chain at 89D" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 741 | |||
| pfam12774 | 231 | pfam12774, AAA_6, Hydrolytic ATP binding site of d | 3e-83 | |
| pfam08393 | 408 | pfam08393, DHC_N2, Dynein heavy chain, N-terminal | 3e-26 | |
| COG5245 | 3164 | COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | 7e-07 | |
| COG5245 | 3164 | COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | 2e-05 |
| >gnl|CDD|193250 pfam12774, AAA_6, Hydrolytic ATP binding site of dynein motor region D1 | Back alignment and domain information |
|---|
Score = 263 bits (673), Expect = 3e-83
Identities = 124/229 (54%), Positives = 153/229 (66%), Gaps = 29/229 (12%)
Query: 367 YGYEYMGLNGRLVITPLTDRIYLTITQALSMRLGAAPAG--------------------- 405
Y YEY+G RLVITPLTDR Y+T+TQ+L + + APAG
Sbjct: 1 YSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMV 60
Query: 406 --------MDFLAFGKILSGLSQCGAWGCFDEFNRIDVSVLSVISTQLLTIRTALLINAT 457
MD+ + G I GL+Q GAWGCFDEFNRI V VLSV++ Q+ ++ A+
Sbjct: 61 YVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCVQDAIRDKKQ 120
Query: 458 RFQFEGHDIIMNNKVGIFITMNPGYAGRTELPESVKALFRPVVCIVPDFELICQIMLFSE 517
F F G +I + VGIFITMNPGYAGRTELPE++KALFRP +VPDFELIC+IML +E
Sbjct: 121 WFNFLGEEISLIPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAE 180
Query: 518 GFLEAKVLAKKMAVLYKLSKEQLSKQCHYDFGMRALKSVLVMAGELKRA 566
GFLEA++LA+K LY L KE LSKQ HYD+G+RA+KSVLV+AG LKR
Sbjct: 181 GFLEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRG 229
|
the 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380 kDa motor unit contains a concatenated chain of six AAA modules, of which four correspond to the ATP binding sites with P-loop signatures described previously, and two are modules in which the P loop has been lost in evolution. This particular family is the D1 unit of the motor and contains the hydrolytic ATP binding site. Length = 231 |
| >gnl|CDD|219818 pfam08393, DHC_N2, Dynein heavy chain, N-terminal region 2 | Back alignment and domain information |
|---|
| >gnl|CDD|227570 COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|227570 COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 741 | |||
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 100.0 | |
| COG5245 | 3164 | DYN1 Dynein, heavy chain [Cytoskeleton] | 99.97 | |
| PF08393 | 408 | DHC_N2: Dynein heavy chain, N-terminal region 2; I | 99.9 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 99.83 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 99.75 | |
| COG5245 | 3164 | DYN1 Dynein, heavy chain [Cytoskeleton] | 99.75 | |
| KOG1808|consensus | 1856 | 99.46 | ||
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 99.25 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 98.98 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 98.94 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 98.86 | |
| KOG1808|consensus | 1856 | 98.8 | ||
| PHA02244 | 383 | ATPase-like protein | 98.71 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 98.54 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 98.26 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 98.23 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 98.03 | |
| PHA02244 | 383 | ATPase-like protein | 97.95 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 97.7 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 97.6 | |
| KOG0730|consensus | 693 | 97.58 | ||
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 97.54 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 97.26 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 97.17 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.17 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 97.1 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 97.08 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 97.04 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 97.02 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.0 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 96.93 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 96.86 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 96.84 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 96.82 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.8 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 96.79 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 96.69 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 96.55 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 96.54 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 96.52 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.48 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 96.46 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.42 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 96.41 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 96.34 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 96.27 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 96.22 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 96.21 | |
| KOG0736|consensus | 953 | 96.17 | ||
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 96.13 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 96.11 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 96.09 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 96.06 | |
| PF05729 | 166 | NACHT: NACHT domain | 96.04 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 96.03 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 96.01 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 96.0 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 96.0 | |
| PRK06526 | 254 | transposase; Provisional | 95.95 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 95.95 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 95.94 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 95.94 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 95.92 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 95.91 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 95.91 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 95.9 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 95.89 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 95.85 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 95.8 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 95.77 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 95.74 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 95.74 | |
| PRK08181 | 269 | transposase; Validated | 95.73 | |
| PF13173 | 128 | AAA_14: AAA domain | 95.72 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 95.65 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.65 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 95.65 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 95.64 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 95.59 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 95.55 | |
| COG3911 | 183 | Predicted ATPase [General function prediction only | 95.54 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 95.53 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 95.52 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 95.5 | |
| KOG1533|consensus | 290 | 95.5 | ||
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 95.48 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 95.45 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 95.44 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 95.43 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 95.38 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 95.35 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 95.33 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 95.3 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 95.29 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 95.27 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 95.26 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 95.25 | |
| PRK06217 | 183 | hypothetical protein; Validated | 95.24 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 95.22 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 95.19 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 95.18 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.18 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 95.17 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 95.14 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 95.14 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 95.14 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 95.13 | |
| KOG3062|consensus | 281 | 95.12 | ||
| KOG1534|consensus | 273 | 95.11 | ||
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 95.11 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 95.1 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 95.1 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.1 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 95.1 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 95.09 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 95.08 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 95.08 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 95.04 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 95.03 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 95.01 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 95.01 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 95.0 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 95.0 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 94.97 | |
| PRK03839 | 180 | putative kinase; Provisional | 94.94 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 94.94 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 94.9 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 94.9 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 94.88 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 94.87 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 94.86 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 94.86 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 94.83 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 94.82 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 94.8 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 94.78 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 94.77 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 94.77 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 94.76 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 94.73 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 94.73 | |
| PLN02842 | 505 | nucleotide kinase | 94.72 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 94.72 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 94.72 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 94.71 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 94.7 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 94.7 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 94.7 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 94.65 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 94.64 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 94.64 | |
| KOG0741|consensus | 744 | 94.64 | ||
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 94.62 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 94.6 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 94.57 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 94.56 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 94.55 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 94.52 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 94.52 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 94.51 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 94.49 | |
| COG1221 | 403 | PspF Transcriptional regulators containing an AAA- | 94.49 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 94.48 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 94.47 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 94.47 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 94.44 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 94.42 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 94.42 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 94.41 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 94.39 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 94.39 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 94.37 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 94.37 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 94.34 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 94.33 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 94.32 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 94.32 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 94.32 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 94.3 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 94.3 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 94.28 | |
| PRK07667 | 193 | uridine kinase; Provisional | 94.26 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 94.25 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 94.25 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 94.22 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 94.22 | |
| KOG0743|consensus | 457 | 94.22 | ||
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 94.21 | |
| PRK13768 | 253 | GTPase; Provisional | 94.21 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 94.2 | |
| PF13479 | 213 | AAA_24: AAA domain | 94.19 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 94.17 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 94.16 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 94.15 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 94.14 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 94.13 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 94.11 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 94.09 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 94.07 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 94.07 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 94.06 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 94.06 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 94.05 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 94.03 | |
| COG1239 | 423 | ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis | 94.02 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 94.02 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 94.02 | |
| KOG0745|consensus | 564 | 94.01 | ||
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 94.0 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 94.0 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 93.97 | |
| KOG0744|consensus | 423 | 93.97 | ||
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 93.96 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 93.95 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 93.93 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 93.92 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 93.92 | |
| KOG0733|consensus | 802 | 93.91 | ||
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 93.91 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 93.91 | |
| PRK06696 | 223 | uridine kinase; Validated | 93.89 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 93.88 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 93.84 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 93.83 | |
| KOG0738|consensus | 491 | 93.83 | ||
| KOG0727|consensus | 408 | 93.83 | ||
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 93.81 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 93.81 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 93.81 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 93.81 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 93.8 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 93.78 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 93.77 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 93.76 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 93.73 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 93.71 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 93.7 | |
| PF09439 | 181 | SRPRB: Signal recognition particle receptor beta s | 93.67 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 93.67 | |
| COG3604 | 550 | FhlA Transcriptional regulator containing GAF, AAA | 93.66 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 93.64 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 93.63 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 93.61 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 93.61 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 93.58 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 93.58 | |
| KOG0733|consensus | 802 | 93.57 | ||
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 93.56 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 93.55 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 93.55 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 93.53 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 93.53 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 93.49 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 93.47 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 93.46 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 93.46 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 93.44 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 93.44 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 93.44 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 93.42 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 93.41 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 93.41 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 93.39 | |
| KOG0991|consensus | 333 | 93.37 | ||
| PRK14528 | 186 | adenylate kinase; Provisional | 93.37 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 93.35 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 93.34 | |
| PRK13764 | 602 | ATPase; Provisional | 93.33 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 93.32 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 93.31 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 93.29 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 93.29 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 93.27 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 93.26 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 93.25 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 93.25 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 93.22 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 93.21 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 93.21 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 93.16 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 93.14 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 93.13 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 93.1 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 93.02 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 93.02 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 93.01 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 92.99 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 92.96 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.92 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 92.92 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 92.89 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 92.87 | |
| PRK12377 | 248 | putative replication protein; Provisional | 92.87 | |
| PLN02200 | 234 | adenylate kinase family protein | 92.86 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 92.85 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 92.84 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 92.83 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 92.83 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 92.83 | |
| PRK06620 | 214 | hypothetical protein; Validated | 92.82 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 92.81 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 92.81 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 92.81 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 92.78 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 92.77 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 92.77 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 92.74 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 92.7 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 92.7 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 92.67 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 92.66 | |
| KOG0054|consensus | 1381 | 92.66 | ||
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 92.65 | |
| PRK08727 | 233 | hypothetical protein; Validated | 92.64 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 92.64 | |
| KOG1970|consensus | 634 | 92.61 | ||
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 92.57 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 92.57 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 92.55 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 92.54 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 92.53 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 92.51 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 92.49 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 92.49 | |
| KOG2228|consensus | 408 | 92.47 | ||
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 92.47 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 92.47 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 92.46 | |
| KOG0055|consensus | 1228 | 92.46 | ||
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 92.4 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 92.4 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 92.38 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 92.35 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 92.34 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 92.34 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 92.31 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 92.31 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 92.31 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 92.31 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 92.3 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 92.29 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 92.29 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 92.27 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 92.26 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 92.26 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 92.25 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 92.25 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 92.25 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 92.24 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 92.23 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 92.19 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 92.18 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 92.18 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 92.18 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 92.16 | |
| PF00735 | 281 | Septin: Septin; InterPro: IPR000038 Septins consti | 92.14 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 92.14 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 92.13 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 92.12 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 92.11 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 92.1 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 92.08 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 92.08 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 92.07 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 92.06 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 92.06 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 92.03 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 92.02 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 92.02 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 92.01 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 91.99 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 91.99 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 91.98 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 91.97 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 91.96 | |
| KOG0989|consensus | 346 | 91.96 | ||
| PRK13948 | 182 | shikimate kinase; Provisional | 91.95 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 91.94 | |
| cd01918 | 149 | HprK_C HprK/P, the bifunctional histidine-containi | 91.92 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 91.92 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 91.88 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 91.88 | |
| PRK08116 | 268 | hypothetical protein; Validated | 91.87 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 91.86 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 91.85 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 91.85 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 91.85 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 91.85 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 91.85 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 91.83 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 91.82 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 91.81 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 91.78 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 91.75 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 91.74 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 91.74 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 91.74 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 91.73 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 91.72 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 91.71 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 91.68 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 91.68 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 91.65 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 91.63 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 91.62 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 91.61 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 91.59 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 91.59 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 91.59 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 91.58 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 91.58 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 91.55 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 91.54 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 91.53 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 91.51 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 91.51 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 91.5 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 91.49 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 91.48 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 91.47 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 91.46 | |
| PRK09087 | 226 | hypothetical protein; Validated | 91.44 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 91.44 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 91.43 | |
| cd01870 | 175 | RhoA_like RhoA-like subfamily. The RhoA subfamily | 91.43 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 91.42 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 91.42 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 91.39 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 91.36 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 91.36 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 91.35 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 91.35 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 91.34 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 91.33 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 91.32 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 91.32 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 91.31 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 91.31 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 91.3 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 91.29 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 91.28 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 91.23 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 91.21 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 91.2 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 91.19 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 91.18 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 91.17 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 91.16 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 91.16 | |
| PF00071 | 162 | Ras: Ras family; InterPro: IPR001806 Small GTPases | 91.16 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 91.15 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 91.15 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 91.15 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 91.14 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 91.12 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 91.1 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 91.1 | |
| KOG3347|consensus | 176 | 91.09 | ||
| KOG0731|consensus | 774 | 91.07 | ||
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 91.07 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 91.05 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 91.05 | |
| PLN02674 | 244 | adenylate kinase | 91.04 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 91.04 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 91.02 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 90.99 | |
| PHA02774 | 613 | E1; Provisional | 90.99 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 90.98 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 90.95 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 90.94 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 90.93 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 90.93 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 90.92 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 90.91 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 90.9 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 90.89 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 90.89 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 90.89 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 90.88 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 90.88 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 90.86 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 90.86 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 90.86 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 90.85 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 90.85 | |
| KOG0482|consensus | 721 | 90.82 | ||
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 90.8 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 90.79 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 90.78 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 90.78 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 90.78 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 90.77 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 90.76 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 90.76 | |
| KOG2749|consensus | 415 | 90.75 | ||
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 90.74 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 90.74 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 90.73 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 90.73 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 90.72 |
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.3e-66 Score=530.98 Aligned_cols=202 Identities=62% Similarity=1.004 Sum_probs=164.8
Q ss_pred ccccccCCCCCceeccchhHHHHHHHHHHHcccCCCCC-----------------------------CCCHHHHHHHHHH
Q psy17620 367 YGYEYMGLNGRLVITPLTDRIYLTITQALSMRLGAAPA-----------------------------GMDFLAFGKILSG 417 (741)
Q Consensus 367 YgyEYlG~~~rLViTPLTdRc~~tl~~Al~~~~GGap~-----------------------------~~d~~~~~ri~~G 417 (741)
|||||+|+++|||+||||||||++|++|+++++||+|. ++|+++|+||++|
T Consensus 1 YgyEY~G~~~rlv~Tplt~r~~~~l~~al~~~~~~~~~GpagtGKtetik~La~~lG~~~~vfnc~~~~~~~~l~ril~G 80 (231)
T PF12774_consen 1 YGYEYLGNSPRLVITPLTDRCFLTLTQALSLNLGGALSGPAGTGKTETIKDLARALGRFVVVFNCSEQMDYQSLSRILKG 80 (231)
T ss_dssp -------S-------HHHHHHHHHHHHHHCTTTEEEEESSTTSSHHHHHHHHHHCTT--EEEEETTSSS-HHHHHHHHHH
T ss_pred CCccccCCCCCceechHHHHHHHHHHHHhccCCCCCCcCCCCCCchhHHHHHHHHhCCeEEEecccccccHHHHHHHHHH
Confidence 99999999999999999999999999999999999854 6999999999999
Q ss_pred hhhcCcceeecccccCChhhHHHHHHHHHHHHHHHhhcCceeEeecceEEecCCceEEEeccCCCCCCCCchHHHhhcce
Q psy17620 418 LSQCGAWGCFDEFNRIDVSVLSVISTQLLTIRTALLINATRFQFEGHDIIMNNKVGIFITMNPGYAGRTELPESVKALFR 497 (741)
Q Consensus 418 laq~GaW~cfDEfnrl~~~vLSvva~qi~~I~~al~~~~~~~~~~g~~i~l~~~~~iFiTmNpgy~gr~eLP~nLk~lFR 497 (741)
++++|||+||||||||+.+|||++++||++|++|++++.+++.++|++|+++|++++|+||||||+||++||+|||++||
T Consensus 81 ~~~~GaW~cfdefnrl~~~vLS~i~~~i~~i~~al~~~~~~~~~~g~~i~l~~~~~iFiT~np~y~gr~~LP~nLk~lFR 160 (231)
T PF12774_consen 81 LAQSGAWLCFDEFNRLSEEVLSVISQQIQSIQDALRAKQKSFTLEGQEIKLNPNCGIFITMNPGYAGRSELPENLKALFR 160 (231)
T ss_dssp HHHHT-EEEEETCCCSSHHHHHHHHHHHHHHHHHHHCTSSEEEETTCEEE--TT-EEEEEE-B-CCCC--S-HHHCTTEE
T ss_pred HhhcCchhhhhhhhhhhHHHHHHHHHHHHHHHHhhcccccccccCCCEEEEccceeEEEeeccccCCcccCCHhHHHHhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeeccCCCHHHHHHHHHhhcCccchHHHHHHHHHHHHHHHHHhhcCCccccchhhHHHHHHHhhHhHhhhc
Q psy17620 498 PVVCIVPDFELICQIMLFSEGFLEAKVLAKKMAVLYKLSKEQLSKQCHYDFGMRALKSVLVMAGELKRAAL 568 (741)
Q Consensus 498 pvam~~PD~~~I~ei~L~s~GF~~a~~La~Kl~~l~~l~~e~ls~q~hydfgLRalksVL~~a~~l~~~~~ 568 (741)
||+|++||+++|+|++|++.||.+|+.||+|++.+|++|++++|+|+|||||||++|+||..|+++||+.|
T Consensus 161 pvam~~PD~~~I~ei~L~s~GF~~a~~La~kl~~l~~l~~~~lS~q~hydfgLRalk~vl~~a~~~kr~~p 231 (231)
T PF12774_consen 161 PVAMMVPDLSLIAEILLLSQGFKDAKSLAKKLVSLFQLCKEQLSKQDHYDFGLRALKSVLRMAGSLKRGDP 231 (231)
T ss_dssp EEE--S--HHHHHHHHHHCCCTSSHHHHHHHHHHHHHHHHHCS-SSTT---SHHHHHHHHHHHHHHHT---
T ss_pred eeEEeCCCHHHHHHHHHHHcCchhHHHHHHHHHHHHHHHHHhhccCccccccHHHHHHHHHHHHHHhcccC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999875
|
|
| >COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF08393 DHC_N2: Dynein heavy chain, N-terminal region 2; InterPro: IPR013602 Dyneins are described as motor proteins of eukaryotic cells, as they can convert energy derived from the hydrolysis of ATP to force and movement along cytoskeletal polymers, such as microtubules | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1808|consensus | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >KOG1808|consensus | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >COG3911 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG1533|consensus | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >KOG3062|consensus | Back alignment and domain information |
|---|
| >KOG1534|consensus | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02842 nucleotide kinase | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >KOG0741|consensus | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >KOG0743|consensus | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >KOG0745|consensus | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >KOG0744|consensus | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >KOG0738|consensus | Back alignment and domain information |
|---|
| >KOG0727|consensus | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0991|consensus | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >KOG0054|consensus | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >KOG1970|consensus | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >KOG2228|consensus | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >KOG0055|consensus | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >cd01870 RhoA_like RhoA-like subfamily | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >KOG3347|consensus | Back alignment and domain information |
|---|
| >KOG0731|consensus | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >KOG0482|consensus | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >KOG2749|consensus | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 741 | ||||
| 3vkg_A | 3245 | X-Ray Structure Of An Mtbd Truncation Mutant Of Dyn | 2e-90 | ||
| 3vkh_A | 3367 | X-Ray Structure Of A Functional Full-Length Dynein | 3e-90 | ||
| 3qmz_A | 2486 | Crystal Structure Of The Cytoplasmic Dynein Heavy C | 7e-53 | ||
| 4ai6_A | 2695 | Dynein Motor Domain - Adp Complex Length = 2695 | 1e-52 |
| >pdb|3VKG|A Chain A, X-Ray Structure Of An Mtbd Truncation Mutant Of Dynein Motor Domain Length = 3245 | Back alignment and structure |
|
| >pdb|3VKH|A Chain A, X-Ray Structure Of A Functional Full-Length Dynein Motor Domain Length = 3367 | Back alignment and structure |
| >pdb|3QMZ|A Chain A, Crystal Structure Of The Cytoplasmic Dynein Heavy Chain Motor Domain Length = 2486 | Back alignment and structure |
| >pdb|4AI6|A Chain A, Dynein Motor Domain - Adp Complex Length = 2695 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 741 | |||
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 0.0 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 3e-26 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 1e-18 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 4e-06 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 1e-04 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 1e-177 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 7e-26 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 5e-22 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 9e-07 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-16 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 |
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
Score = 636 bits (1643), Expect = 0.0
Identities = 135/497 (27%), Positives = 213/497 (42%), Gaps = 94/497 (18%)
Query: 312 AKIMDAEEFQWESQLRYYWKKSYLDWKDSLVIIQCSGSFEYGYEHEYMGLNGSFEYGYEY 371
+ W ++Y K LD +S+ I Q +Y +EY
Sbjct: 574 CSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQS---------------GYLLQYKFEY 618
Query: 372 MGLNGRLVITPLTDRIYLTITQALSMRLGAAPAG-------------------------- 405
+G+ RL+ TPL + T+T +L + G G
Sbjct: 619 IGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNC 678
Query: 406 ---MDFLAFGKILSGLSQCGAWGCFDEFNRIDVSVLSVISTQLLTIRTALLINATRFQFE 462
D+ ++L G++Q GAWGCFDEFNR+D VLS +S + I+ L + +
Sbjct: 679 DDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLL 738
Query: 463 GHDIIMNNKVGIFITMNPGYAGRTELPESVKALFRPVVCIVPDFELICQIMLFSEGFLEA 522
+ ++ +FIT+NPGY GR+ELPE++K FR P I +++L GF ++
Sbjct: 739 EEETPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDS 798
Query: 523 KVLAKKMAVLYKLSKEQLSKQCHYDFGMRALKSVLVMAGELKRAALQLEESVVLMRALRD 582
K LA K+ +L + S HY FG+R LK VL L E ++ +L+
Sbjct: 799 KSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSPLISE--FGEGEKTVVESLKR 856
Query: 583 MNLPKFVSED----------------------------------------------VVQM 596
+ LP D +Q
Sbjct: 857 VILPSLGDTDELVFKDELSKIFDSAGTPLNSKAIVQCLKDAGQRSGFSMSEEFLKKCMQF 916
Query: 597 YETMLTRHSTMIVGPTGGGKSVVINALVKTSTVL-GYPARTYTLNPKAVSVIELYGVLNP 655
Y T+ + ++VG G GK+ ++ + G+ Y ++ K ++ LYG +
Sbjct: 917 YYMQKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHANVVYVIDTKVLTKESLYGSMLK 976
Query: 656 ETRDWYDGLLSNIFRAVNKPLDPGSK-ERKYILFDGDVDALWIENMNSVMDDNKILTLAN 714
T +W DGL ++I R VN + K R +++FD D+D ++E MNSV+DDNKILTL N
Sbjct: 977 ATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPN 1036
Query: 715 GERIRLLAHCQLLFEIH 731
GER+ + + ++LFE
Sbjct: 1037 GERLPIPPNFRILFETD 1053
|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 741 | |||
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 100.0 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 100.0 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 99.91 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.84 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 98.53 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 98.05 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 98.05 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 97.45 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 97.44 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.38 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 97.32 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 97.13 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 97.13 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.12 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 97.12 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 97.11 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 97.1 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 96.88 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 96.86 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 96.85 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.81 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 96.74 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.67 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 96.63 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 96.61 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 96.54 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 96.51 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 96.5 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.49 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 96.43 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 96.38 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 96.35 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 96.34 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 96.34 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 96.31 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.3 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 96.28 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 96.13 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 96.1 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 96.1 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 95.95 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 95.91 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 95.9 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 95.87 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 95.85 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 95.83 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 95.81 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 95.8 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 95.79 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 95.79 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 95.76 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 95.76 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 95.72 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 95.68 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 95.67 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 95.66 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.66 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 95.6 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 95.59 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 95.57 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 95.57 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 95.56 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 95.56 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 95.54 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 95.52 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 95.51 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 95.48 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 95.46 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 95.44 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 95.43 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 95.42 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.4 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 95.37 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 95.35 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 95.33 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 95.31 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 95.29 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 95.25 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 95.25 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 95.24 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 95.23 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 95.22 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 95.21 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 95.19 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.18 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 95.18 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 95.16 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 95.14 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 95.13 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 95.12 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.12 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 95.11 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 95.09 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 95.07 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 95.06 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 95.05 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 95.05 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 95.02 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 95.0 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 95.0 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 94.99 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 94.99 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 94.98 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 94.98 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 94.97 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 94.97 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 94.95 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 94.92 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 94.89 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 94.87 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 94.86 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 94.84 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 94.84 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 94.83 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 94.83 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 94.83 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 94.82 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 94.82 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 94.82 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 94.8 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 94.79 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 94.78 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 94.77 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 94.76 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 94.73 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 94.71 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 94.71 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 94.7 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 94.7 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 94.68 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 94.67 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 94.66 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 94.65 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 94.53 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 94.52 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 94.51 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 94.45 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 94.43 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 94.41 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 94.38 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 94.38 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 94.37 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 94.31 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.3 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 94.3 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 94.29 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 94.26 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 94.26 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 94.25 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 94.24 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 94.23 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 94.2 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 94.18 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 94.16 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 94.14 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 94.14 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 94.08 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 94.08 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 94.07 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 94.04 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 94.04 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 94.03 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 94.02 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 94.02 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 93.98 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 93.96 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 93.93 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 93.91 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 93.9 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 93.89 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 93.83 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 93.82 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 93.79 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 93.78 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 93.75 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 93.71 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 93.7 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 93.7 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 93.69 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 93.69 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 93.68 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 93.67 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 93.64 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 93.55 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 93.53 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 93.47 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 93.46 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 93.46 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 93.46 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 93.42 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 93.4 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 93.4 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 93.39 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 93.38 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 93.36 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 93.33 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 93.25 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 93.23 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 93.22 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 93.21 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 93.21 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 93.17 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 93.17 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 93.16 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 93.14 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 93.13 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 93.1 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 93.06 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 93.04 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 93.04 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 93.03 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 93.0 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 93.0 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 92.99 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 92.97 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 92.97 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 92.96 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 92.92 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 92.91 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.88 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 92.86 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 92.85 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 92.83 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 92.8 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 92.66 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 92.6 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 92.54 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 92.54 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 92.53 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 92.52 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 92.5 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 92.47 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 92.45 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 92.44 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 92.44 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 92.42 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 92.41 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 92.38 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 92.36 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 92.36 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 92.35 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 92.29 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 92.26 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 92.24 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 92.24 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 92.23 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 92.21 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 92.19 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 92.16 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 92.16 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 92.12 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 92.11 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 92.1 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 92.1 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 92.1 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 92.06 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 92.04 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 92.01 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 91.98 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 91.96 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 91.91 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 91.87 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 91.85 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 91.84 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 91.83 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 91.81 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 91.8 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 91.8 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 91.79 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 91.78 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 91.76 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 91.72 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 91.71 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 91.71 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 91.7 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 91.69 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 91.66 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 91.63 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 91.63 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 91.62 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 91.62 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 91.62 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 91.6 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 91.58 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 91.57 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 91.54 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 91.51 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 91.51 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 91.44 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 91.42 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 91.41 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 91.41 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 91.38 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 91.37 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 91.36 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 91.35 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 91.34 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 91.33 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 91.33 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 91.3 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 91.3 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 91.29 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 91.28 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 91.28 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 91.27 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 91.26 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 91.26 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 91.24 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 91.2 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 91.16 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 91.1 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 91.09 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 91.08 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 91.08 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 91.04 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 91.01 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 91.01 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 90.96 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 90.88 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 90.87 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 90.86 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 90.84 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 90.83 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 90.79 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 90.79 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 90.78 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 90.78 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 90.77 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 90.74 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 90.73 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 90.68 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 90.66 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 90.63 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 90.62 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 90.62 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 90.61 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 90.6 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 90.56 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 90.54 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 90.5 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 90.49 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 90.47 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 90.44 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 90.44 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 90.42 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 90.4 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 90.38 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 90.35 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 90.35 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 90.31 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 90.25 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 90.19 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 90.18 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 90.13 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 90.13 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 90.09 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 90.09 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 90.09 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 90.05 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 90.05 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 90.04 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 90.03 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 90.03 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 90.01 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 89.95 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 89.87 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 89.81 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 89.8 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 89.77 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 89.77 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 89.75 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 89.75 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 89.73 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 89.7 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 89.65 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 89.61 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 89.6 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 89.59 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 89.58 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 89.58 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 89.54 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 89.54 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 89.54 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 89.52 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 89.48 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 89.44 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 89.43 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 89.42 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 89.39 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 89.39 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 89.32 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 89.27 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 89.21 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 89.2 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 89.19 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 89.16 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 89.11 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 89.09 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 89.07 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 89.06 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 89.05 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 89.02 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 89.01 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 89.0 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 88.98 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 88.97 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 88.97 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 88.97 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 88.96 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 88.95 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 88.95 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 88.92 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 88.89 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 88.85 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 88.85 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 88.83 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 88.75 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 88.73 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 88.73 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 88.71 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 88.68 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 88.67 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 88.64 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 88.63 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 88.6 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 88.57 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 88.55 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 88.52 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 88.48 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 88.41 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 88.29 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 88.21 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 88.18 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 88.14 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 88.14 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 88.12 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 88.08 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 88.06 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 87.99 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 87.95 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 87.95 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 87.94 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 87.85 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 87.83 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 87.77 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 87.7 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 87.66 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 87.62 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 87.59 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 87.58 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 87.4 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 87.35 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 87.34 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 87.26 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 87.25 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 87.06 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 86.99 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 86.92 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 86.86 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 86.82 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 86.79 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 86.73 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 86.68 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 86.66 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 86.65 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 86.59 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 86.59 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 86.58 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 86.57 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 86.49 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 86.41 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 86.35 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 86.24 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 86.19 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 86.13 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 86.05 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 86.04 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 85.97 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 85.87 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 85.81 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 85.69 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 85.64 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 85.62 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 85.46 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 85.34 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 85.33 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 85.22 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 85.19 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 85.11 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 85.1 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 85.06 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 85.06 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 85.03 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 85.02 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 84.97 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 84.94 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 84.92 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 84.83 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 84.78 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 84.78 |
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=4e-144 Score=1399.15 Aligned_cols=550 Identities=40% Similarity=0.716 Sum_probs=508.8
Q ss_pred hhhccccccccceEE-----EEccchHHHHHHHHhcchhhhhccchhhhhhcccchhhhhhhhhhhccccccccchhhhH
Q psy17620 155 GELTKNDRKKFNTVL-----IVDVHARDIIDNFVRDGSAVRGELTKNDRKKFNTVLIVDVHAREIKDNFIGSNSLSRSLE 229 (741)
Q Consensus 155 ~Qlr~yw~~~~~~~~-----~idv~~r~vye~~~~~~~~~~~~~~~~e~~~f~~~~~v~~~w~~~~~~f~~~~~~~~~~~ 229 (741)
++--..|+.++..+. |++||.+|+|.+-+|.+++||++|||.|+++|+. ||+.|+.
T Consensus 222 ~~~v~~We~~L~~~~~il~~W~~vQ~~W~yLe~IF~~s~DI~~qLP~E~~rF~~---vd~~~~~---------------- 282 (3245)
T 3vkg_A 222 EEEANHWDDRLNKVRSLLDVWIDVQRRWVYLEGIFSGSGDINQLLPAESTRFKS---INSEFIA---------------- 282 (3245)
T ss_dssp GGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-----CTTTSHHHHHHHHH---HHHHHHH----------------
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcHHHHHHhHHHHHHHHH---HHHHHHH----------------
Confidence 334445655655442 8899999999999999999999999999999999 9999999
Q ss_pred HHHHHhhhcCccchhhcccccHHHHHHHHHHHHHHHHHHHHHHHHHHhhhCCcccccCcHHHHHHhcC-CCchhhhhhHH
Q psy17620 230 SVIMWETHKNPRVIEQCLVPNRLEHLEQLKDGLEACEKSLQDYLTDKRNAFPRFFFISDDELLSILGS-SSPTAIQEHIV 308 (741)
Q Consensus 230 ~~im~~~~~~~~v~~~~~~~~~~~~L~~~~~~L~~i~k~L~~yLe~kR~~FPRFyFLsn~dLL~ils~-~~~~~i~~hl~ 308 (741)
+|+++.++|+|+++|..|++++.|+++++.|+.|||+|++|||+||.+|||||||||+|||+|||+ +||..||+|++
T Consensus 283 --im~~~~~~~~v~~~~~~~~~~~~L~~~~~~Le~iqk~L~~yLE~KR~~FPRFyFlSd~eLLeILs~~~dp~~vq~hl~ 360 (3245)
T 3vkg_A 283 --ILKKVSGAPLILEVLAIERIQQTMERLSDLLGKVQKALGEYLERQRSAFARFYFVGDEDLLEIIGNSKDIIKIQKHFR 360 (3245)
T ss_dssp --HHHHHHHSCBHHHHTTSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSGGGGGSCHHHHHHHHHGGGCGGGTGGGGG
T ss_pred --HHHHHhcCCceEeecCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCchhhccCcHHHHHHHHcCCChHHHHHHHH
Confidence 999999999999999999999999999999999999999999999999999999999999999998 69999999999
Q ss_pred HHhhhc--------------------------------------------------------------------------
Q psy17620 309 KFAAKI-------------------------------------------------------------------------- 314 (741)
Q Consensus 309 k~f~~I-------------------------------------------------------------------------- 314 (741)
|||++|
T Consensus 361 K~F~~I~~l~f~~~~~~i~~m~S~eGE~v~~~~~v~~~~~~~ve~WL~~le~~m~~tl~~~~~~~~~~~~~~~~~~~~~~ 440 (3245)
T 3vkg_A 361 KMFAGLANLTLDDEKTTIIGMSSAEGETVTFKKPISIANGPKIHEWLTMVESEMKSTLATLLSESLQHFNQVDVNDHSKY 440 (3245)
T ss_dssp GTCSSCCEEEECTTSCEEEEEECTTSCEEEEEEEEESSSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCTTCHHHH
T ss_pred HHHhhhheEEecCCCCEEEEEEcCCCCEEEeCCccccCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccCcccH
Confidence 986210
Q ss_pred --------------------------------------------------------------------------------
Q psy17620 315 -------------------------------------------------------------------------------- 314 (741)
Q Consensus 315 -------------------------------------------------------------------------------- 314 (741)
T Consensus 441 ~~w~~~~p~Qv~l~~~qi~wT~~ve~al~~~~~~~~~~~~~l~~~~~~~~~~l~~l~~~v~~~l~~~~R~kl~~Lit~~V 520 (3245)
T 3vkg_A 441 SEWVDNYPTQLVLLTSQIVWSTQVDQALGGGTLQQSKIQEQLQSIEQTTQMILNNLADSVLQDLSAQKRKKFEHLITELV 520 (3245)
T ss_dssp HHHHHTSCHHHHHHHHHHHHHHHHHHHHTTSCSCHHHHHHHHHHHHHHHHHHHHHHHHHTTSCCCHHHHHHHHHHHHHHH
T ss_pred HHHHHHCcHHHHHHHHHheeHHHHHHHHHhccccccchHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHH
Confidence
Q ss_pred ---------------CCcChHHHHHHhhhhhcccccCccCceEEEEeccccccccccccccccccccccccccCCCCCce
Q psy17620 315 ---------------MDAEEFQWESQLRYYWKKSYLDWKDSLVIIQCSGSFEYGYEHEYMGLNGSFEYGYEYMGLNGRLV 379 (741)
Q Consensus 315 ---------------~~~~~f~W~~qLRyy~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~l~~~~~YgyEYlG~~~rLV 379 (741)
.+.++|+|++||||||+++..+..+.|.|++++++|. |||||+|+++|||
T Consensus 521 H~RDvv~~L~~~~~v~~~~dF~W~~qlRyy~~~~~~~~~~~~~v~~~~~~f~---------------YgyEYlG~~~rLV 585 (3245)
T 3vkg_A 521 HQRDVVRQLQKCKNLTGNKDFDWLYHMRYYYDATQENVLHKLVIHMANATFY---------------YGFEYLGIGERLV 585 (3245)
T ss_dssp HHHHHHHHHHTCCSCCSTTCHHHHTSEEEEECSSSSSSGGGEEEEETTEEEE---------------CCCCCCCSCCCCC
T ss_pred HHHHHHHHHHHhcCCCCcchhHHHhhhheeeccccCCcCceEEEEEcCceec---------------CccccCCCCCCCc
Confidence 1235799999999999876433334699999887766 9999999999999
Q ss_pred eccchhHHHHHHHHHHHcccCCCCC-----------------------------CCCHHHHHHHHHHhhhcCcceeeccc
Q psy17620 380 ITPLTDRIYLTITQALSMRLGAAPA-----------------------------GMDFLAFGKILSGLSQCGAWGCFDEF 430 (741)
Q Consensus 380 iTPLTdRc~~tl~~Al~~~~GGap~-----------------------------~~d~~~~~ri~~Glaq~GaW~cfDEf 430 (741)
+||||||||+||++||++++||+|+ ++||++|||||+|+|++|||+|||||
T Consensus 586 iTPLTdrcy~tl~~Al~~~~gg~~~GPaGtGKTet~k~La~~lgr~~~vfnC~~~~d~~~~g~i~~G~~~~GaW~cfDEf 665 (3245)
T 3vkg_A 586 QTPLTDRCYLTLTQALESRMGGNPFGPAGTGKTETVKALGSQLGRFVLVFCCDEGFDLQAMSRIFVGLCQCGAWGCFDEF 665 (3245)
T ss_dssp CCHHHHHHHHHHHHHHHTTCEEEEECSTTSSHHHHHHHHHHHTTCCEEEEECSSCCCHHHHHHHHHHHHHHTCEEEEETT
T ss_pred CChHHHHHHHHHHHHHHhcCCCCCCCCCCCCHHHHHHHHHHHhCCeEEEEeCCCCCCHHHHHHHHhhHhhcCcEEEehhh
Confidence 9999999999999999999999865 68999999999999999999999999
Q ss_pred ccCChhhHHHHHHHHHHHHHHHhhcCceeEee-cceEEecCCceEEEeccCCCCCCCCchHHHhhcceeeeccCCCHHHH
Q psy17620 431 NRIDVSVLSVISTQLLTIRTALLINATRFQFE-GHDIIMNNKVGIFITMNPGYAGRTELPESVKALFRPVVCIVPDFELI 509 (741)
Q Consensus 431 nrl~~~vLSvva~qi~~I~~al~~~~~~~~~~-g~~i~l~~~~~iFiTmNpgy~gr~eLP~nLk~lFRpvam~~PD~~~I 509 (741)
||++.+|||++++||++|+.|++++..++.|+ |++|.++|+|+|||||||||+||++||+|||++||||+|++||+++|
T Consensus 666 Nrl~~~vLSvv~~qi~~I~~a~~~~~~~~~~~~G~~i~l~~~~~vfiTmNpgY~gr~eLP~nLk~lFr~v~m~~Pd~~~i 745 (3245)
T 3vkg_A 666 NRLEERILSAVSQQIQTIQVALKENSKEVELLGGKNISLHQDMGIFVTMNPGYAGRSNLPDNLKKLFRSMAMIKPDREMI 745 (3245)
T ss_dssp TSSCHHHHHHHHHHHHHHHHHHHHTCSEECCC---CEECCTTCEEEECBCCCGGGCCCSCHHHHTTEEEEECCSCCHHHH
T ss_pred hcCCHHHHHHHHHHHHHHHHHHHcCCCeEEecCCCEEeecCCeEEEEEeCCCccCcccChHHHHhhcEEEEEeCCCHHHH
Confidence 99999999999999999999999999999999 99999999999999999999999999999999999999999999999
Q ss_pred HHHHHhhcCccchHHHHHHHHHHHHHHHHHhhcCCccccchhhHHHHHHHhhHhHhhh--------cc------------
Q psy17620 510 CQIMLFSEGFLEAKVLAKKMAVLYKLSKEQLSKQCHYDFGMRALKSVLVMAGELKRAA--------LQ------------ 569 (741)
Q Consensus 510 ~ei~L~s~GF~~a~~La~Kl~~l~~l~~e~ls~q~hydfgLRalksVL~~a~~l~~~~--------~~------------ 569 (741)
+||+|+|.||.+|+.||+|++++|++|+||||+|+||||||||+|+||++||++||+. |+
T Consensus 746 ~ei~L~s~Gf~~a~~La~k~~~~~~l~~e~LS~Q~HYDfGLRalKsVL~~AG~lkr~~~~~~~~~~~~~~~~~~~~~~~~ 825 (3245)
T 3vkg_A 746 AQVMLYSQGFKTAEVLAGKIVPLFKLCQEQLSAQSHYDFGLRALKSVLVSAGGIKRKCQPPQLPPITDAESKTKADQIYC 825 (3245)
T ss_dssp HHHHHHTTTCSCHHHHHHHHHHHHHHHHHSSCCCTTCCCSHHHHHHHHHHHHHHHHSCCCC------CHHHHHHHHHHHH
T ss_pred HHHHHHHcccchHHHHHHHHHHHHHHHHHHhCCCCCCCCChHHHHHHHHHHHHHHHhhhhhccccccccccccccccccc
Confidence 9999999999999999999999999999999999999999999999999999999987 54
Q ss_pred chHHHHHHHHHHhccCCCcchhh-----------------------------------------------HHHHHHHhhc
Q psy17620 570 LEESVVLMRALRDMNLPKFVSED-----------------------------------------------VVQMYETMLT 602 (741)
Q Consensus 570 ~~E~~~l~ral~~~~lPkl~~~D-----------------------------------------------v~qL~e~l~~ 602 (741)
.+|+.+|+|||+|+|+|||+.+| |+||||++.+
T Consensus 826 ~~E~~illralrd~nlpKl~~~D~plF~~li~DlFPgv~~~~~~~~~l~~ai~~~~~~~~L~~~~~~v~KviQLye~~~v 905 (3245)
T 3vkg_A 826 QYEIGVLLNSINDTMIPKLVADDIPLIQSLLLDVFPGSQLQPIQMDQLRKKIQEIAKQRHLVTKQEWVEKILQLHQILNI 905 (3245)
T ss_dssp HHHHHHHHHHHHHTTTTTSCGGGHHHHHHHHHHHSTTCCCCCCCCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTT
T ss_pred ccHHHHHHHHHHHhccCCCchhhHHHHHHHHHHhCCCCCCCCCchHHHHHHHHHHHHHcCCccCHHHHHHHHHHHHHHHh
Confidence 67999999999999999999998 8999999999
Q ss_pred cceEEEEecCCCChhHHHHHHHHHhccC-CCCeEEEEeCCCccccccccccccCCCCCcccChHHHHHHHhcCCCCCCCC
Q psy17620 603 RHSTMIVGPTGGGKSVVINALVKTSTVL-GYPARTYTLNPKAVSVIELYGVLNPETRDWYDGLLSNIFRAVNKPLDPGSK 681 (741)
Q Consensus 603 r~gv~lvGp~gsGKTt~~~~L~~a~~~~-~~~~~~~~inpka~t~~eLyG~~d~~t~eW~DGvls~i~R~~~~~~~~~~~ 681 (741)
|||||||||||||||++|++|++|++.+ |.++..++|||||+|++||||.+||+|+||+||+|++++|+++.+..++..
T Consensus 906 RhGvmlVGp~gsGKTt~~~~L~~al~~l~~~~~~~~~iNPKait~~eLyG~~d~~T~EW~DGvls~i~R~~~~~~~~~~~ 985 (3245)
T 3vkg_A 906 NHGVMMVGPSGGGKTTSWEVYLEAIEQVDNIKSEAHVMDPKAITKDQLFGSLDLTTREWTDGLFTATLRRIIDNVRGEST 985 (3245)
T ss_dssp CSEEEEECSSSSSHHHHHHHHHHHHTTTTTCEEEEEEECTTTSCHHHHHEEECTTTCCEEECHHHHHHHHHHTTSSSGGG
T ss_pred eeeEEEECCCCCCHHHHHHHHHHHHHHhhCCCceEEEECCCCCchhhhceeecCCCCeeeccHHHHHHHHHHhcccCCCC
Confidence 9999999999999999999999999988 567889999999999999999999999999999999999999765444456
Q ss_pred CCeEEEEcCCCChhhhhhccccccCCceeeccCCCeeecCCCceEEEEeCCCCCCCCCC
Q psy17620 682 ERKYILFDGDVDALWIENMNSVMDDNKILTLANGERIRLLAHCQLLFEIHPIQSDSHPR 740 (741)
Q Consensus 682 ~~~WIVfDG~vd~~wiE~LNsvLDdnk~L~L~nGeri~l~~~~rliFE~~~L~~aSPAt 740 (741)
.++||||||||||.|||||||||||||+|||||||||++||+||+||||+||++|||||
T Consensus 986 ~~~WIvfDGpVDa~WIEnlNsVLDDNK~LtL~nGErI~l~~~~~liFEv~dL~~ASPAT 1044 (3245)
T 3vkg_A 986 KRHWIIFDGDVDPEWVENLNSLLDDNKLLTLPNGERLALPNNVRVMFEVQDLKYATLAT 1044 (3245)
T ss_dssp EEEEEEEESCCCHHHHTTTHHHHSSSCEECCTTSCCEECCTTEEEEEEESCCTTCCHHH
T ss_pred CceEEEECCCCCHHHHHHHHHHhcCCCeeecCCCCeeecCCCCEEEEEeccccccChhh
Confidence 78999999999999999999999999999999999999999999999999999999998
|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 741 | |||
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 97.94 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 97.66 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.03 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 96.9 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 96.9 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.89 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.68 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.66 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.58 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.55 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.48 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 96.48 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.48 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 96.34 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 96.3 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.29 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 96.28 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.27 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 96.27 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.26 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.25 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 96.21 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.2 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 96.17 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.16 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.15 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 96.14 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 96.1 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.1 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 96.08 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 96.06 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 96.03 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 95.98 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 95.94 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 95.93 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.92 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.86 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 95.84 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.8 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 95.79 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 95.77 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.76 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.75 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 95.75 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 95.74 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 95.72 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 95.7 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 95.7 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 95.66 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 95.64 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.55 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 95.55 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 95.53 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 95.52 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 95.46 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 95.43 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 95.37 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 95.31 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 95.26 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 95.25 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 95.21 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 95.2 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 95.2 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 95.19 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 95.12 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 95.11 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 95.09 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 95.05 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 95.02 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 94.99 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 94.94 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 94.93 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 94.9 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 94.84 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 94.74 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 94.72 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 94.48 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 94.42 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 94.34 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 94.26 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 94.25 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 94.15 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 94.14 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 94.04 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 94.03 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 94.0 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 93.87 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 93.86 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 93.79 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 93.65 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 93.59 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 93.28 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 93.27 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 93.26 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 93.22 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 93.21 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 93.13 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 93.12 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 93.12 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 93.09 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 92.99 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 92.95 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 92.88 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 92.85 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 92.83 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 92.81 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 92.77 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 92.73 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 92.6 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 92.53 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 92.51 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 92.49 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 92.41 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 92.41 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 92.34 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 92.19 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 92.15 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.15 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 92.05 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 91.98 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 91.82 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 91.79 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 91.77 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 91.67 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 91.59 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 91.51 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 91.5 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 91.45 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 91.45 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 91.2 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 91.1 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 90.99 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 90.98 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 90.95 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 90.95 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 90.92 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 90.88 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 90.85 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 90.78 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 90.77 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 90.77 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 90.75 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 90.73 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 90.6 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 90.57 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 90.54 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 90.52 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 90.48 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 90.4 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 90.38 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 90.26 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 90.24 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 90.13 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 90.12 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 90.03 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 89.99 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 89.96 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 89.95 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 89.94 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 89.77 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 89.75 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 89.6 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 89.47 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 89.41 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 89.36 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 89.32 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 89.32 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 89.23 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 89.19 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 89.18 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 89.09 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 89.08 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 89.06 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 89.04 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 89.0 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 88.99 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 88.87 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 88.85 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 88.81 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 88.76 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 88.75 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 88.71 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 88.7 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 88.62 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 88.53 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 88.46 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 88.36 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 88.36 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 88.35 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 88.3 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 88.29 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 88.26 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 88.12 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 87.88 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 87.86 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 87.82 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 87.71 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 87.69 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 87.63 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 87.51 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 87.48 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 87.34 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 87.16 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 87.12 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 86.94 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 86.67 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 86.52 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 86.1 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 85.86 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 85.73 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 85.48 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 85.22 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 85.17 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 84.94 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 84.59 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 84.58 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 84.41 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 83.91 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 83.85 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 83.64 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 83.64 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 83.44 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 82.65 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 82.63 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 82.5 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 82.46 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 81.92 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 81.25 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 80.42 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 80.23 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 80.16 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 80.13 |
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: delta prime subunit of DNA polymerase III, N-domain species: Escherichia coli [TaxId: 562]
Probab=97.94 E-value=1.4e-06 Score=85.20 Aligned_cols=134 Identities=13% Similarity=0.044 Sum_probs=76.1
Q ss_pred HHHHHhhccceEEEEecCCCChhHHHHHHHHHhccCCCC-eEE--EEeCCCccccccccccccCCCCCcccChHHHHHHH
Q psy17620 595 QMYETMLTRHSTMIVGPTGGGKSVVINALVKTSTVLGYP-ART--YTLNPKAVSVIELYGVLNPETRDWYDGLLSNIFRA 671 (741)
Q Consensus 595 qL~e~l~~r~gv~lvGp~gsGKTt~~~~L~~a~~~~~~~-~~~--~~inpka~t~~eLyG~~d~~t~eW~DGvls~i~R~ 671 (741)
+.++.-...|+++++||+|+|||++++.+++.+...... ... ...+++.+....-.+.+.....++...+-...+|+
T Consensus 16 ~~~~~~~l~h~lLl~Gp~G~GKtt~a~~~a~~l~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~i~~~~ir~ 95 (207)
T d1a5ta2 16 ASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQPQGHKSCGHCRGCQLMQAGTHPDYYTLAPEKGKNTLGVDAVRE 95 (207)
T ss_dssp HHHHTTCCCSEEEEECCTTSCHHHHHHHHHHHHTCSSCBTTBCCSCSHHHHHHHHTCCTTEEEECCCTTCSSBCHHHHHH
T ss_pred HHHHcCCcCeEEEEECCCCCcHHHHHHHHHHhcccccccccccccccchhhhhhhccccccchhhhhhcccccccchhhH
Confidence 334444457899999999999999999999987422110 000 00000011111111222222223444443444444
Q ss_pred hcCC--CCCCCCCCeEEEEcCCCChhhhhhccccccCCceeeccCCCeeecCCCceEEEEeCCCCCCCCC
Q psy17620 672 VNKP--LDPGSKERKYILFDGDVDALWIENMNSVMDDNKILTLANGERIRLLAHCQLLFEIHPIQSDSHP 739 (741)
Q Consensus 672 ~~~~--~~~~~~~~~WIVfDG~vd~~wiE~LNsvLDdnk~L~L~nGeri~l~~~~rliFE~~~L~~aSPA 739 (741)
+.+. ........+++|+| ++|....+..|++|- .|- ..|+++++||-+++++..-|+
T Consensus 96 l~~~~~~~~~~~~~kviIid-e~d~l~~~a~n~Llk---~lE-------ep~~~~~fIl~t~~~~~ll~t 154 (207)
T d1a5ta2 96 VTEKLNEHARLGGAKVVWVT-DAALLTDAAANALLK---TLE-------EPPAETWFFLATREPERLLAT 154 (207)
T ss_dssp HHHHTTSCCTTSSCEEEEES-CGGGBCHHHHHHHHH---HHT-------SCCTTEEEEEEESCGGGSCHH
T ss_pred HhhhhhhccccCccceEEec-hhhhhhhhhhHHHHH---HHH-------hhcccceeeeeecChhhhhhh
Confidence 3211 11124567999999 888888888888762 111 136788999999998876653
|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|