Psyllid ID: psy17637
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 150 | ||||||
| 195127173 | 797 | GI12051 [Drosophila mojavensis] gi|19391 | 0.78 | 0.146 | 0.717 | 2e-42 | |
| 340723638 | 774 | PREDICTED: ATP-dependent RNA helicase DD | 0.713 | 0.138 | 0.775 | 4e-42 | |
| 350426308 | 774 | PREDICTED: ATP-dependent RNA helicase DD | 0.713 | 0.138 | 0.775 | 4e-42 | |
| 380022612 | 772 | PREDICTED: LOW QUALITY PROTEIN: ATP-depe | 0.713 | 0.138 | 0.775 | 4e-42 | |
| 66522071 | 772 | PREDICTED: ATP-dependent RNA helicase DD | 0.713 | 0.138 | 0.775 | 5e-42 | |
| 383857449 | 774 | PREDICTED: ATP-dependent RNA helicase DD | 0.713 | 0.138 | 0.785 | 7e-42 | |
| 270012072 | 702 | hypothetical protein TcasGA2_TC006173 [T | 0.713 | 0.152 | 0.728 | 1e-41 | |
| 195376889 | 797 | GJ13322 [Drosophila virilis] gi|19415438 | 0.78 | 0.146 | 0.709 | 1e-41 | |
| 312373386 | 615 | hypothetical protein AND_17503 [Anophele | 0.713 | 0.173 | 0.766 | 1e-41 | |
| 189239856 | 699 | PREDICTED: similar to CG6418 CG6418-PB [ | 0.713 | 0.153 | 0.728 | 2e-41 |
| >gi|195127173|ref|XP_002008043.1| GI12051 [Drosophila mojavensis] gi|193919652|gb|EDW18519.1| GI12051 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
Score = 176 bits (447), Expect = 2e-42, Method: Compositional matrix adjust.
Identities = 89/124 (71%), Positives = 103/124 (83%), Gaps = 7/124 (5%)
Query: 22 HLVRNL-EGANQEVPPALMNLAMQLNAEELANSLTVKEYDVLLLHGDMDQSERNSVITKF 80
HLV+ L EGA L+ + + +AE +AN+L VKEY+ LLLHGDMDQ++RN VIT+F
Sbjct: 513 HLVKFLSEGA------VLVFVTKKADAETVANNLLVKEYNCLLLHGDMDQADRNKVITQF 566
Query: 81 KRQECRILVATDVAARGLDIPHIRTVVNYDLARDIDTHTHRIGRTGRAGNKGVAYTLVTD 140
KR+EC ILVATDVAARGLDIPHIR VVNYD+ARDIDTHTHRIGRTGRAG KG AYTLVTD
Sbjct: 567 KRKECDILVATDVAARGLDIPHIRNVVNYDIARDIDTHTHRIGRTGRAGEKGNAYTLVTD 626
Query: 141 KDKD 144
KDK+
Sbjct: 627 KDKE 630
|
Source: Drosophila mojavensis Species: Drosophila mojavensis Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|340723638|ref|XP_003400196.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350426308|ref|XP_003494399.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|380022612|ref|XP_003695134.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DDX42-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|66522071|ref|XP_624210.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383857449|ref|XP_003704217.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|270012072|gb|EFA08520.1| hypothetical protein TcasGA2_TC006173 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|195376889|ref|XP_002047225.1| GJ13322 [Drosophila virilis] gi|194154383|gb|EDW69567.1| GJ13322 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|312373386|gb|EFR21141.1| hypothetical protein AND_17503 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|189239856|ref|XP_974261.2| PREDICTED: similar to CG6418 CG6418-PB [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 150 | ||||||
| FB|FBgn0036104 | 791 | CG6418 [Drosophila melanogaste | 0.78 | 0.147 | 0.685 | 1.2e-38 | |
| UNIPROTKB|F1P0H1 | 703 | DDX42 "ATP-dependent RNA helic | 0.733 | 0.156 | 0.678 | 1.1e-34 | |
| UNIPROTKB|Q5F485 | 944 | DDX42 "ATP-dependent RNA helic | 0.733 | 0.116 | 0.678 | 2.4e-34 | |
| UNIPROTKB|F1NJ40 | 946 | DDX42 "ATP-dependent RNA helic | 0.733 | 0.116 | 0.678 | 2.4e-34 | |
| UNIPROTKB|E2RFF1 | 933 | DDX42 "Uncharacterized protein | 0.733 | 0.117 | 0.669 | 5e-34 | |
| UNIPROTKB|Q86XP3 | 938 | DDX42 "ATP-dependent RNA helic | 0.733 | 0.117 | 0.669 | 5e-34 | |
| UNIPROTKB|F1RSJ7 | 941 | DDX42 "Uncharacterized protein | 0.733 | 0.116 | 0.669 | 5.1e-34 | |
| UNIPROTKB|Q5R7D1 | 942 | DDX42 "ATP-dependent RNA helic | 0.733 | 0.116 | 0.669 | 5.1e-34 | |
| UNIPROTKB|E1BJD2 | 946 | DDX42 "Uncharacterized protein | 0.733 | 0.116 | 0.669 | 5.1e-34 | |
| RGD|1304909 | 929 | Ddx42 "DEAD (Asp-Glu-Ala-Asp) | 0.733 | 0.118 | 0.669 | 8.1e-34 |
| FB|FBgn0036104 CG6418 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 421 (153.3 bits), Expect = 1.2e-38, P = 1.2e-38
Identities = 85/124 (68%), Positives = 103/124 (83%)
Query: 22 HLVRNL-EGANQEVPPALMNLAMQLNAEELANSLTVKEYDVLLLHGDMDQSERNSVITKF 80
HLV+ L EG+ L+ + +++AE ++N+L +KEY+ LLLHGDMDQ++RN VIT+F
Sbjct: 507 HLVKFLSEGS------VLIFVTKKVDAETVSNNLLIKEYNCLLLHGDMDQADRNKVITQF 560
Query: 81 KRQECRILVATDVAARGLDIPHIRTVVNYDLARDIDTHTHRIGRTGRAGNKGVAYTLVTD 140
KR+EC ILVATDVAARGLDIPHIR VVNYD ARDI+THTHRIGRTGRAG KG AYTLVTD
Sbjct: 561 KRKECDILVATDVAARGLDIPHIRNVVNYDTARDIETHTHRIGRTGRAGEKGNAYTLVTD 620
Query: 141 KDKD 144
KDK+
Sbjct: 621 KDKE 624
|
|
| UNIPROTKB|F1P0H1 DDX42 "ATP-dependent RNA helicase DDX42" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5F485 DDX42 "ATP-dependent RNA helicase DDX42" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NJ40 DDX42 "ATP-dependent RNA helicase DDX42" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RFF1 DDX42 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q86XP3 DDX42 "ATP-dependent RNA helicase DDX42" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RSJ7 DDX42 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R7D1 DDX42 "ATP-dependent RNA helicase DDX42" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BJD2 DDX42 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1304909 Ddx42 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 42" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 150 | |||
| PRK11776 | 460 | PRK11776, PRK11776, ATP-dependent RNA helicase Dbp | 8e-41 | |
| COG0513 | 513 | COG0513, SrmB, Superfamily II DNA and RNA helicase | 2e-37 | |
| cd00079 | 131 | cd00079, HELICc, Helicase superfamily c-terminal d | 4e-34 | |
| pfam00271 | 78 | pfam00271, Helicase_C, Helicase conserved C-termin | 1e-30 | |
| smart00490 | 82 | smart00490, HELICc, helicase superfamily c-termina | 6e-30 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 2e-29 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 1e-27 | |
| PTZ00424 | 401 | PTZ00424, PTZ00424, helicase 45; Provisional | 3e-24 | |
| PRK04837 | 423 | PRK04837, PRK04837, ATP-dependent RNA helicase Rhl | 8e-23 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 2e-21 | |
| PRK04537 | 572 | PRK04537, PRK04537, ATP-dependent RNA helicase Rhl | 9e-19 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 9e-18 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 2e-17 | |
| PLN00206 | 518 | PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel | 3e-16 | |
| COG0514 | 590 | COG0514, RecQ, Superfamily II DNA helicase [DNA re | 4e-13 | |
| COG1111 | 542 | COG1111, MPH1, ERCC4-like helicases [DNA replicati | 2e-12 | |
| TIGR01389 | 591 | TIGR01389, recQ, ATP-dependent DNA helicase RecQ | 2e-10 | |
| TIGR00614 | 470 | TIGR00614, recQ_fam, ATP-dependent DNA helicase, R | 3e-10 | |
| PRK11057 | 607 | PRK11057, PRK11057, ATP-dependent DNA helicase Rec | 1e-09 | |
| TIGR00643 | 630 | TIGR00643, recG, ATP-dependent DNA helicase RecG | 4e-09 | |
| PRK13766 | 773 | PRK13766, PRK13766, Hef nuclease; Provisional | 4e-09 | |
| COG1200 | 677 | COG1200, RecG, RecG-like helicase [DNA replication | 1e-08 | |
| TIGR00580 | 926 | TIGR00580, mfd, transcription-repair coupling fact | 8e-08 | |
| COG1202 | 830 | COG1202, COG1202, Superfamily II helicase, archaea | 3e-07 | |
| COG1061 | 442 | COG1061, SSL2, DNA or RNA helicases of superfamily | 4e-07 | |
| PRK10917 | 681 | PRK10917, PRK10917, ATP-dependent DNA helicase Rec | 4e-07 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 5e-07 | |
| COG1197 | 1139 | COG1197, Mfd, Transcription-repair coupling factor | 1e-06 | |
| PLN03137 | 1195 | PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 | 1e-06 | |
| COG1643 | 845 | COG1643, HrpA, HrpA-like helicases [DNA replicatio | 3e-05 | |
| PRK10689 | 1147 | PRK10689, PRK10689, transcription-repair coupling | 6e-05 | |
| COG0556 | 663 | COG0556, UvrB, Helicase subunit of the DNA excisio | 5e-04 | |
| cd09639 | 353 | cd09639, Cas3_I, CRISPR/Cas system-associated prot | 6e-04 | |
| COG1201 | 814 | COG1201, Lhr, Lhr-like helicases [General function | 7e-04 | |
| TIGR01587 | 358 | TIGR01587, cas3_core, CRISPR-associated helicase C | 7e-04 | |
| COG1203 | 733 | COG1203, COG1203, CRISPR-associated helicase Cas3 | 0.001 |
| >gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
Score = 141 bits (358), Expect = 8e-41
Identities = 49/94 (52%), Positives = 71/94 (75%)
Query: 49 ELANSLTVKEYDVLLLHGDMDQSERNSVITKFKRQECRILVATDVAARGLDIPHIRTVVN 108
E+A++L + + L LHGD++Q +R+ V+ +F + C +LVATDVAARGLDI + V+N
Sbjct: 257 EVADALNAQGFSALALHGDLEQRDRDQVLVRFANRSCSVLVATDVAARGLDIKALEAVIN 316
Query: 109 YDLARDIDTHTHRIGRTGRAGNKGVAYTLVTDKD 142
Y+LARD + H HRIGRTGRAG+KG+A +LV ++
Sbjct: 317 YELARDPEVHVHRIGRTGRAGSKGLALSLVAPEE 350
|
Length = 460 |
| >gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224121 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|233032 TIGR00580, mfd, transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|236794 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224118 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|182649 PRK10689, PRK10689, transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223630 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|187770 cd09639, Cas3_I, CRISPR/Cas system-associated protein Cas3 | Back alignment and domain information |
|---|
| >gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233483 TIGR01587, cas3_core, CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >gnl|CDD|224124 COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 150 | |||
| KOG0331|consensus | 519 | 99.97 | ||
| KOG0328|consensus | 400 | 99.97 | ||
| KOG0333|consensus | 673 | 99.96 | ||
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 99.96 | |
| PTZ00110 | 545 | helicase; Provisional | 99.96 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.96 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.96 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.96 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.96 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.96 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.95 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.95 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.95 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.95 | |
| KOG0330|consensus | 476 | 99.95 | ||
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.95 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.95 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.95 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 99.95 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.95 | |
| KOG0332|consensus | 477 | 99.94 | ||
| KOG0341|consensus | 610 | 99.93 | ||
| KOG0326|consensus | 459 | 99.93 | ||
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.93 | |
| KOG0340|consensus | 442 | 99.93 | ||
| KOG0335|consensus | 482 | 99.93 | ||
| KOG0336|consensus | 629 | 99.92 | ||
| cd00079 | 131 | HELICc Helicase superfamily c-terminal domain; ass | 99.92 | |
| KOG0342|consensus | 543 | 99.91 | ||
| KOG0344|consensus | 593 | 99.91 | ||
| KOG0345|consensus | 567 | 99.9 | ||
| KOG0351|consensus | 941 | 99.9 | ||
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 99.9 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.9 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 99.9 | |
| KOG0347|consensus | 731 | 99.9 | ||
| KOG0327|consensus | 397 | 99.89 | ||
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.89 | |
| KOG0338|consensus | 691 | 99.89 | ||
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.88 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.88 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.88 | |
| PF00271 | 78 | Helicase_C: Helicase conserved C-terminal domain; | 99.88 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 99.88 | |
| KOG0348|consensus | 708 | 99.88 | ||
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.87 | |
| KOG0343|consensus | 758 | 99.87 | ||
| KOG0339|consensus | 731 | 99.87 | ||
| KOG0350|consensus | 620 | 99.87 | ||
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.87 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.86 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 99.86 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.86 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.86 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.85 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.85 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.85 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.85 | |
| KOG0334|consensus | 997 | 99.85 | ||
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 99.85 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 99.85 | |
| KOG4284|consensus | 980 | 99.85 | ||
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 99.84 | |
| KOG0352|consensus | 641 | 99.83 | ||
| KOG0346|consensus | 569 | 99.83 | ||
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 99.83 | |
| KOG0354|consensus | 746 | 99.82 | ||
| smart00490 | 82 | HELICc helicase superfamily c-terminal domain. | 99.82 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.81 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.81 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 99.81 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.81 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.81 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 99.8 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.8 | |
| KOG0353|consensus | 695 | 99.79 | ||
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 99.76 | |
| KOG0337|consensus | 529 | 99.74 | ||
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 99.74 | |
| KOG0349|consensus | 725 | 99.73 | ||
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 99.73 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 99.73 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.7 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 99.7 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 99.69 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 99.69 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 99.68 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 99.67 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 99.66 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 99.64 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.64 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.63 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 99.59 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 99.59 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.59 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 99.57 | |
| KOG0947|consensus | 1248 | 99.56 | ||
| KOG0948|consensus | 1041 | 99.54 | ||
| KOG0384|consensus | 1373 | 99.5 | ||
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.5 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.5 | |
| KOG4150|consensus | 1034 | 99.49 | ||
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.49 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 99.41 | |
| KOG0387|consensus | 923 | 99.4 | ||
| KOG0390|consensus | 776 | 99.4 | ||
| KOG0329|consensus | 387 | 99.39 | ||
| KOG0385|consensus | 971 | 99.39 | ||
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 99.38 | |
| KOG0950|consensus | 1008 | 99.37 | ||
| KOG0951|consensus | 1674 | 99.37 | ||
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 99.37 | |
| KOG0922|consensus | 674 | 99.36 | ||
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 99.34 | |
| KOG0953|consensus | 700 | 99.33 | ||
| KOG0391|consensus | 1958 | 99.33 | ||
| KOG0952|consensus | 1230 | 99.27 | ||
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 99.25 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 99.23 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 99.21 | |
| KOG0392|consensus | 1549 | 99.2 | ||
| KOG0389|consensus | 941 | 99.2 | ||
| KOG0923|consensus | 902 | 99.19 | ||
| KOG0388|consensus | 1185 | 99.17 | ||
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 99.12 | |
| KOG0920|consensus | 924 | 99.1 | ||
| KOG0924|consensus | 1042 | 99.09 | ||
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 99.08 | |
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 99.05 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 99.03 | |
| KOG1000|consensus | 689 | 99.0 | ||
| PF13307 | 167 | Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 | 98.99 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 98.98 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 98.96 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 98.89 | |
| KOG1123|consensus | 776 | 98.88 | ||
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 98.85 | |
| KOG0949|consensus | 1330 | 98.8 | ||
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 98.73 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 98.68 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 98.67 | |
| KOG0926|consensus | 1172 | 98.67 | ||
| KOG1015|consensus | 1567 | 98.67 | ||
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 98.66 | |
| KOG0386|consensus | 1157 | 98.63 | ||
| KOG4439|consensus | 901 | 98.62 | ||
| COG4889 | 1518 | Predicted helicase [General function prediction on | 98.61 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 98.6 | |
| KOG1002|consensus | 791 | 98.56 | ||
| KOG0925|consensus | 699 | 98.52 | ||
| COG0653 | 822 | SecA Preprotein translocase subunit SecA (ATPase, | 98.5 | |
| PF06862 | 442 | DUF1253: Protein of unknown function (DUF1253); In | 98.43 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 98.41 | |
| smart00492 | 141 | HELICc3 helicase superfamily c-terminal domain. | 98.3 | |
| smart00491 | 142 | HELICc2 helicase superfamily c-terminal domain. | 98.22 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 98.21 | |
| PF13871 | 278 | Helicase_C_4: Helicase_C-like | 97.87 | |
| KOG1016|consensus | 1387 | 97.85 | ||
| TIGR00596 | 814 | rad1 DNA repair protein (rad1). This family is bas | 97.83 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 97.62 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 97.42 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 97.3 | |
| KOG1001|consensus | 674 | 97.3 | ||
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 97.27 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 97.21 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 97.2 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 97.15 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 97.14 | |
| KOG0951|consensus | 1674 | 97.12 | ||
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 97.08 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 96.99 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 96.97 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 96.94 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 96.63 | |
| KOG0921|consensus | 1282 | 96.5 | ||
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 96.4 | |
| KOG0298|consensus | 1394 | 96.31 | ||
| PRK14701 | 1638 | reverse gyrase; Provisional | 96.2 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 96.17 | |
| KOG2340|consensus | 698 | 96.0 | ||
| KOG0701|consensus | 1606 | 96.0 | ||
| KOG1133|consensus | 821 | 95.7 | ||
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 95.48 | |
| KOG0347|consensus | 731 | 95.42 | ||
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 95.06 | |
| KOG1513|consensus | 1300 | 94.98 | ||
| PF10593 | 239 | Z1: Z1 domain; InterPro: IPR018310 This entry repr | 94.85 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 94.73 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 94.48 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 94.33 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 93.53 | |
| KOG0339|consensus | 731 | 93.45 | ||
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 92.5 | |
| KOG0330|consensus | 476 | 92.39 | ||
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 92.08 | |
| PF04364 | 137 | DNA_pol3_chi: DNA polymerase III chi subunit, HolC | 92.06 | |
| cd01524 | 90 | RHOD_Pyr_redox Member of the Rhodanese Homology Do | 91.24 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 91.24 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 91.18 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 91.1 | |
| KOG0331|consensus | 519 | 90.96 | ||
| KOG0383|consensus | 696 | 90.89 | ||
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 90.8 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 90.69 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 90.67 | |
| KOG0338|consensus | 691 | 90.42 | ||
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 90.33 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 90.3 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 89.57 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 88.77 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 88.27 | |
| smart00450 | 100 | RHOD Rhodanese Homology Domain. An alpha beta fold | 88.23 | |
| KOG0335|consensus | 482 | 87.29 | ||
| cd01529 | 96 | 4RHOD_Repeats Member of the Rhodanese Homology Dom | 86.98 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 86.91 | |
| PTZ00110 | 545 | helicase; Provisional | 86.54 | |
| KOG0389|consensus | 941 | 86.43 | ||
| cd01449 | 118 | TST_Repeat_2 Thiosulfate sulfurtransferase (TST), | 86.41 | |
| cd01534 | 95 | 4RHOD_Repeat_3 Member of the Rhodanese Homology Do | 85.93 | |
| TIGR00696 | 177 | wecB_tagA_cpsF bacterial polymer biosynthesis prot | 85.92 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 85.72 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 85.57 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 84.51 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 84.34 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 84.27 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 84.19 | |
| PF03808 | 172 | Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp | 83.86 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 83.54 | |
| cd01521 | 110 | RHOD_PspE2 Member of the Rhodanese Homology Domain | 83.4 | |
| cd01526 | 122 | RHOD_ThiF Member of the Rhodanese Homology Domain | 83.06 | |
| PF12683 | 275 | DUF3798: Protein of unknown function (DUF3798); In | 83.02 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 82.84 | |
| KOG0350|consensus | 620 | 82.55 | ||
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 82.52 | |
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 82.37 | |
| cd01444 | 96 | GlpE_ST GlpE sulfurtransferase (ST) and homologs a | 82.27 | |
| cd01447 | 103 | Polysulfide_ST Polysulfide-sulfurtransferase - Rho | 82.15 | |
| cd01519 | 106 | RHOD_HSP67B2 Member of the Rhodanese Homology Doma | 81.99 | |
| cd01527 | 99 | RHOD_YgaP Member of the Rhodanese Homology Domain | 81.68 | |
| KOG0348|consensus | 708 | 81.15 | ||
| cd01532 | 92 | 4RHOD_Repeat_1 Member of the Rhodanese Homology Do | 81.11 | |
| cd06533 | 171 | Glyco_transf_WecG_TagA The glycosyltransferase Wec | 81.07 | |
| KOG1132|consensus | 945 | 81.06 | ||
| COG0610 | 962 | Type I site-specific restriction-modification syst | 80.03 |
| >KOG0331|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.1e-30 Score=197.47 Aligned_cols=138 Identities=36% Similarity=0.563 Sum_probs=118.3
Q ss_pred CeeEEEeecchhhHHHHHHHHHHhcc-CCCCCeeEEehhhhhHHHHHhhccccCceEEEecCCCCHHHHHHHHHHhhcCC
Q psy17637 6 GVAYTLVTDKDKEFAGHLVRNLEGAN-QEVPPALMNLAMQLNAEELANSLTVKEYDVLLLHGDMDQSERNSVITKFKRQE 84 (150)
Q Consensus 6 ~~~~~~~~~~~~~~~~~ll~~l~~~~-~~~~~~ivf~~~~~~~~~l~~~L~~~~~~~~~~~~~~~~~~r~~~~~~f~~g~ 84 (150)
++.++....+...+...|.+.|.... ....++||||+|++.|++|...|...++++..+||+.++.+|..+++.|++|+
T Consensus 312 ~i~qive~~~~~~K~~~l~~lL~~~~~~~~~KvIIFc~tkr~~~~l~~~l~~~~~~a~~iHGd~sQ~eR~~~L~~FreG~ 391 (519)
T KOG0331|consen 312 NIRQIVEVCDETAKLRKLGKLLEDISSDSEGKVIIFCETKRTCDELARNLRRKGWPAVAIHGDKSQSERDWVLKGFREGK 391 (519)
T ss_pred chhhhhhhcCHHHHHHHHHHHHHHHhccCCCcEEEEecchhhHHHHHHHHHhcCcceeeecccccHHHHHHHHHhcccCC
Confidence 34444444444444444444444331 46779999999999999999999998999999999999999999999999999
Q ss_pred ceEEEEcCCCcccCCccCCcEEEEecCCCChhHHHHhhccccCCCCccEEEEEEecCCC
Q psy17637 85 CRILVATDVAARGLDIPHIRTVVNYDLARDIDTHTHRIGRTGRAGNKGVAYTLVTDKDK 143 (150)
Q Consensus 85 ~~vlv~T~~~~~Gidi~~~~~vi~~~~~~~~~~~~q~~GR~~R~g~~~~~~~~~~~~~~ 143 (150)
..|||||+++++|+|+|++++|||||+|.+.++|+||+||+||.|+.|.++.|++..+.
T Consensus 392 ~~vLVATdVAaRGLDi~dV~lVInydfP~~vEdYVHRiGRTGRa~~~G~A~tfft~~~~ 450 (519)
T KOG0331|consen 392 SPVLVATDVAARGLDVPDVDLVINYDFPNNVEDYVHRIGRTGRAGKKGTAITFFTSDNA 450 (519)
T ss_pred cceEEEcccccccCCCccccEEEeCCCCCCHHHHHhhcCccccCCCCceEEEEEeHHHH
Confidence 99999999999999999999999999999999999999999999999999999987643
|
|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >KOG0332|consensus | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >KOG0326|consensus | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >KOG0351|consensus | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >smart00490 HELICc helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0353|consensus | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >KOG0337|consensus | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >KOG0349|consensus | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >KOG0947|consensus | Back alignment and domain information |
|---|
| >KOG0948|consensus | Back alignment and domain information |
|---|
| >KOG0384|consensus | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >KOG4150|consensus | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0387|consensus | Back alignment and domain information |
|---|
| >KOG0390|consensus | Back alignment and domain information |
|---|
| >KOG0329|consensus | Back alignment and domain information |
|---|
| >KOG0385|consensus | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0950|consensus | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0922|consensus | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0953|consensus | Back alignment and domain information |
|---|
| >KOG0391|consensus | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0392|consensus | Back alignment and domain information |
|---|
| >KOG0389|consensus | Back alignment and domain information |
|---|
| >KOG0923|consensus | Back alignment and domain information |
|---|
| >KOG0388|consensus | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0920|consensus | Back alignment and domain information |
|---|
| >KOG0924|consensus | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1000|consensus | Back alignment and domain information |
|---|
| >PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG1123|consensus | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >KOG0949|consensus | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0926|consensus | Back alignment and domain information |
|---|
| >KOG1015|consensus | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >KOG0386|consensus | Back alignment and domain information |
|---|
| >KOG4439|consensus | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >KOG0925|consensus | Back alignment and domain information |
|---|
| >COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >smart00492 HELICc3 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >smart00491 HELICc2 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >PF13871 Helicase_C_4: Helicase_C-like | Back alignment and domain information |
|---|
| >KOG1016|consensus | Back alignment and domain information |
|---|
| >TIGR00596 rad1 DNA repair protein (rad1) | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >KOG0921|consensus | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2340|consensus | Back alignment and domain information |
|---|
| >KOG0701|consensus | Back alignment and domain information |
|---|
| >KOG1133|consensus | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >KOG1513|consensus | Back alignment and domain information |
|---|
| >PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PF04364 DNA_pol3_chi: DNA polymerase III chi subunit, HolC; InterPro: IPR007459 The DNA polymerase III holoenzyme (2 | Back alignment and domain information |
|---|
| >cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >KOG0383|consensus | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >smart00450 RHOD Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0389|consensus | Back alignment and domain information |
|---|
| >cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >TIGR00696 wecB_tagA_cpsF bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PF12683 DUF3798: Protein of unknown function (DUF3798); InterPro: IPR024258 This entry represents functionally uncharacterised proteins that are found in bacteria | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 | Back alignment and domain information |
|---|
| >cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins | Back alignment and domain information |
|---|
| >KOG1132|consensus | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 150 | ||||
| 2p6n_A | 191 | Human Dead-box Rna Helicase Ddx41, Helicase Domain | 1e-20 | ||
| 2db3_A | 434 | Structural Basis For Rna Unwinding By The Dead-Box | 9e-20 | ||
| 2hyi_C | 413 | Structure Of The Human Exon Junction Complex With A | 1e-19 | ||
| 2hjv_A | 163 | Structure Of The Second Domain (Residues 207-368) O | 1e-19 | ||
| 2j0q_A | 410 | The Crystal Structure Of The Exon Junction Complex | 1e-19 | ||
| 2xb2_A | 411 | Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar | 1e-19 | ||
| 2j0u_B | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 1e-19 | ||
| 2hxy_A | 391 | Crystal Structure Of Human Apo-Eif4aiii Length = 39 | 2e-19 | ||
| 2j0u_A | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 2e-19 | ||
| 1hv8_A | 367 | Crystal Structure Of A Dead Box Protein From The Hy | 6e-19 | ||
| 3pew_A | 395 | S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 | 2e-18 | ||
| 3pey_A | 395 | S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length | 2e-18 | ||
| 3gfp_A | 189 | Structure Of The C-Terminal Domain Of The Dead-Box | 2e-18 | ||
| 3peu_A | 188 | S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To | 2e-18 | ||
| 2kbf_A | 187 | Solution Structure Of Carboxyl-Terminal Domain Of D | 3e-18 | ||
| 2yjt_D | 170 | Crystal Structure Of E. Coli Dead-Box Protein Srmb | 3e-18 | ||
| 2jgn_A | 185 | Ddx3 Helicase Domain Length = 185 | 8e-18 | ||
| 2i4i_A | 417 | Crystal Structure Of Human Dead-Box Rna Helicase Dd | 9e-18 | ||
| 3ews_A | 445 | Human Dead-Box Rna-Helicase Ddx19 In Complex With A | 2e-17 | ||
| 3g0h_A | 424 | Human Dead-box Rna Helicase Ddx19, In Complex With | 2e-17 | ||
| 3fht_A | 412 | Crystal Structure Of Human Dbp5 In Complex With Amp | 2e-17 | ||
| 3fmp_B | 479 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 2e-17 | ||
| 2z0m_A | 337 | Crystal Structure Of Hypothetical Atp-Dependent Rna | 3e-17 | ||
| 2wax_A | 193 | Structure Of The Human Ddx6 C-Terminal Domain In Co | 2e-16 | ||
| 1xtk_A | 390 | Structure Of Decd To Dead Mutation Of Human Uap56 L | 3e-16 | ||
| 1xtj_A | 386 | Structure Of Human Uap56 In Complex With Adp Length | 3e-16 | ||
| 1xti_A | 391 | Structure Of Wildtype Human Uap56 Length = 391 | 3e-16 | ||
| 1t5i_A | 172 | Crystal Structure Of The C-Terminal Domain Of Uap56 | 3e-16 | ||
| 1s2m_A | 400 | Crystal Structure Of The Dead Box Protein Dhh1p Len | 1e-15 | ||
| 3fho_B | 508 | Structure Of S. Pombe Dbp5 Length = 508 | 3e-15 | ||
| 2rb4_A | 175 | Crystal Structure Of The Helicase Domain Of Human D | 7e-15 | ||
| 4db4_A | 256 | Mss116p Dead-Box Helicase Domain 2 Bound To A Chima | 2e-14 | ||
| 4db2_C | 257 | Mss116p Dead-Box Helicase Domain 2 Bound To An Rna | 2e-14 | ||
| 4db2_A | 257 | Mss116p Dead-Box Helicase Domain 2 Bound To An Rna | 3e-14 | ||
| 3sqx_A | 512 | Structure Of Mss116p (Nte And C-Tail Double Deletio | 1e-13 | ||
| 3i5x_A | 563 | Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len | 2e-13 | ||
| 3sqw_A | 579 | Structure Of Mss116p (Nte Deletion) Bound To Ssrna | 2e-13 | ||
| 3eiq_A | 414 | Crystal Structure Of Pdcd4-eif4a Length = 414 | 4e-13 | ||
| 3i32_A | 300 | Dimeric Structure Of A Hera Helicase Fragment Inclu | 5e-13 | ||
| 2zu6_A | 388 | Crystal Structure Of The Eif4a-Pdcd4 Complex Length | 6e-13 | ||
| 3eaq_A | 212 | Novel Dimerization Motif In The Dead Box Rna Helica | 2e-12 | ||
| 1fuk_A | 165 | Crystal Structure Of The Carboxy Terminal Domain Of | 4e-11 | ||
| 2vso_A | 395 | Crystal Structure Of A Translation Initiation Compl | 6e-11 | ||
| 1fuu_A | 394 | Yeast Initiation Factor 4a Length = 394 | 9e-11 | ||
| 1oyw_A | 523 | Structure Of The Recq Catalytic Core Length = 523 | 3e-08 | ||
| 1oyy_A | 523 | Structure Of The Recq Catalytic Core Bound To Atp-G | 6e-08 | ||
| 1gm5_A | 780 | Structure Of Recg Bound To Three-Way Dna Junction L | 8e-07 | ||
| 1wp9_A | 494 | Crystal Structure Of Pyrococcus Furiosus Hef Helica | 2e-05 | ||
| 2eyq_A | 1151 | Crystal Structure Of Escherichia Coli Transcription | 5e-05 | ||
| 2v1x_A | 591 | Crystal Structure Of Human Recq-Like Dna Helicase L | 7e-05 | ||
| 4gl2_A | 699 | Structural Basis For Dsrna Duplex Backbone Recognit | 2e-04 |
| >pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 | Back alignment and structure |
|
| >pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 | Back alignment and structure |
| >pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 | Back alignment and structure |
| >pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 | Back alignment and structure |
| >pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 | Back alignment and structure |
| >pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 | Back alignment and structure |
| >pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 | Back alignment and structure |
| >pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 | Back alignment and structure |
| >pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 | Back alignment and structure |
| >pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 | Back alignment and structure |
| >pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 | Back alignment and structure |
| >pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 | Back alignment and structure |
| >pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 | Back alignment and structure |
| >pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 | Back alignment and structure |
| >pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 | Back alignment and structure |
| >pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 | Back alignment and structure |
| >pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 | Back alignment and structure |
| >pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 | Back alignment and structure |
| >pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 | Back alignment and structure |
| >pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 | Back alignment and structure |
| >pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 | Back alignment and structure |
| >pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 | Back alignment and structure |
| >pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 | Back alignment and structure |
| >pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 | Back alignment and structure |
| >pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 | Back alignment and structure |
| >pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 | Back alignment and structure |
| >pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 | Back alignment and structure |
| >pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 | Back alignment and structure |
| >pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 | Back alignment and structure |
| >pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 | Back alignment and structure |
| >pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 | Back alignment and structure |
| >pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 | Back alignment and structure |
| >pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 | Back alignment and structure |
| >pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 | Back alignment and structure |
| >pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 | Back alignment and structure |
| >pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 | Back alignment and structure |
| >pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 | Back alignment and structure |
| >pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 | Back alignment and structure |
| >pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 | Back alignment and structure |
| >pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 | Back alignment and structure |
| >pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 | Back alignment and structure |
| >pdb|1GM5|A Chain A, Structure Of Recg Bound To Three-Way Dna Junction Length = 780 | Back alignment and structure |
| >pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 | Back alignment and structure |
| >pdb|2EYQ|A Chain A, Crystal Structure Of Escherichia Coli Transcription-Repair Coupling Factor Length = 1151 | Back alignment and structure |
| >pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 | Back alignment and structure |
| >pdb|4GL2|A Chain A, Structural Basis For Dsrna Duplex Backbone Recognition By Mda5 Length = 699 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 150 | |||
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 1e-47 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 3e-11 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 4e-47 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 1e-13 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 9e-46 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 1e-44 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 8e-44 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 4e-12 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 3e-43 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 5e-43 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 1e-42 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 1e-42 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 1e-42 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 1e-42 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 1e-42 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 1e-42 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 6e-10 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 5e-42 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 1e-41 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 2e-41 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 2e-41 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 3e-41 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 5e-41 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 3e-40 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 3e-40 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 6e-38 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 2e-36 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 2e-35 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 3e-22 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 5e-18 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 4e-10 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 5e-10 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 6e-10 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 9e-10 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 1e-09 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 5e-09 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 1e-08 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 2e-08 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 6e-08 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 6e-08 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 7e-08 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 3e-06 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 4e-06 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 4e-06 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 1e-05 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 2e-05 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 3e-05 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 2e-04 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 7e-04 |
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 | Back alignment and structure |
|---|
Score = 158 bits (402), Expect = 1e-47
Identities = 45/102 (44%), Positives = 64/102 (62%), Gaps = 1/102 (0%)
Query: 46 NAEELANSLTVKEYDVLLLHGDMDQSERNSVITKFKRQECRILVATDVAARGLDIPHIRT 105
A+ LA+ L+ KE+ +HGD QS+R + FK ++L+AT VA+RGLDI +I+
Sbjct: 312 GADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKH 371
Query: 106 VVNYDLARDIDTHTHRIGRTGRAGNKGVAYTLVTDKDKDGEL 147
V+NYD+ ID + HRIGRTGR GN G A + +KD +
Sbjct: 372 VINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFD-PEKDRAI 412
|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Length = 780 | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Length = 1151 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 150 | |||
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 100.0 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 100.0 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 99.98 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 99.97 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 99.97 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 99.97 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 99.97 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.97 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 99.93 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.96 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.95 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.95 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.95 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.95 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.95 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.94 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.94 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.94 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.94 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.94 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.94 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.94 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.92 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.92 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.92 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.91 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.91 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.91 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 99.91 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.9 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.9 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 99.9 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 99.9 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.9 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 99.89 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.89 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.89 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 99.88 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.88 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.88 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.88 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.88 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.88 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.87 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.87 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.87 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.87 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.87 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.87 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.87 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.87 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 99.86 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.86 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.86 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 99.86 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.86 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.85 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.85 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.85 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 99.85 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 99.84 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.84 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 99.83 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.83 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.83 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.82 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.78 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.77 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.76 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 99.54 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 99.07 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 98.94 | |
| 3hgt_A | 328 | HDA1 complex subunit 3; RECA-like domain, SWI2/SNF | 98.6 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 98.57 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 98.07 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 97.07 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 96.4 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 95.77 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 95.63 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 94.22 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 94.18 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 93.85 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 93.6 | |
| 2l82_A | 162 | Designed protein OR32; structural genomics, northe | 93.51 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 92.98 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 92.85 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 92.69 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 92.26 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 91.93 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 91.61 | |
| 3dmn_A | 174 | Putative DNA helicase; APC89291.2, lactobacillus p | 91.37 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 91.19 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 90.75 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 90.13 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 89.94 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 89.92 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 89.67 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 89.45 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 89.18 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 89.17 | |
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 89.15 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 89.1 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 88.47 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 88.23 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 88.11 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 88.1 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 87.99 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 87.9 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 87.87 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 87.44 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 87.36 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 86.87 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 86.31 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 86.21 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 86.15 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 86.13 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 85.0 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 84.53 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 84.35 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 84.08 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 83.94 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 83.66 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 83.23 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 83.14 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 83.13 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 82.31 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 82.16 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 81.95 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 81.73 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 80.85 |
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
Probab=100.00 E-value=6e-32 Score=179.98 Aligned_cols=138 Identities=36% Similarity=0.523 Sum_probs=124.5
Q ss_pred CcCeeEEEeecchhhHHHHHHHHHHhccCCCCCeeEEehhhhhHHHHHhhccccCceEEEecCCCCHHHHHHHHHHhhcC
Q psy17637 4 NKGVAYTLVTDKDKEFAGHLVRNLEGANQEVPPALMNLAMQLNAEELANSLTVKEYDVLLLHGDMDQSERNSVITKFKRQ 83 (150)
Q Consensus 4 ~~~~~~~~~~~~~~~~~~~ll~~l~~~~~~~~~~ivf~~~~~~~~~l~~~L~~~~~~~~~~~~~~~~~~r~~~~~~f~~g 83 (150)
..++.+.+.......+...|...+... ...++||||++++.++.++..|...++.+..+||+|++.+|..+++.|++|
T Consensus 7 ~~~i~~~~~~~~~~~K~~~L~~ll~~~--~~~~~lVF~~~~~~~~~l~~~L~~~~~~~~~~hg~~~~~~r~~~~~~f~~g 84 (163)
T 2hjv_A 7 TRNIEHAVIQVREENKFSLLKDVLMTE--NPDSCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRFDVMNEFKRG 84 (163)
T ss_dssp CCCEEEEEEECCGGGHHHHHHHHHHHH--CCSSEEEECSSHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHHHTT
T ss_pred cccceEEEEECChHHHHHHHHHHHHhc--CCCcEEEEECCHHHHHHHHHHHHHcCCcEEEEeCCCCHHHHHHHHHHHHcC
Confidence 455677776666666666777766654 667999999999999999999999999999999999999999999999999
Q ss_pred CceEEEEcCCCcccCCccCCcEEEEecCCCChhHHHHhhccccCCCCccEEEEEEecCCC
Q psy17637 84 ECRILVATDVAARGLDIPHIRTVVNYDLARDIDTHTHRIGRTGRAGNKGVAYTLVTDKDK 143 (150)
Q Consensus 84 ~~~vlv~T~~~~~Gidi~~~~~vi~~~~~~~~~~~~q~~GR~~R~g~~~~~~~~~~~~~~ 143 (150)
+..|||+|+++++|+|+|++++||++++|+++..|.||+||+||.|+.|.+++|++..+.
T Consensus 85 ~~~vlv~T~~~~~Gld~~~~~~Vi~~~~p~~~~~~~qr~GR~~R~g~~g~~~~~~~~~~~ 144 (163)
T 2hjv_A 85 EYRYLVATDVAARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFVTAFEK 144 (163)
T ss_dssp SCSEEEECGGGTTTCCCSCCSEEEESSCCSSHHHHHHHTTTSSCTTCCEEEEEEECGGGH
T ss_pred CCeEEEECChhhcCCchhcCCEEEEeCCCCCHHHHHHhccccCcCCCCceEEEEecHHHH
Confidence 999999999999999999999999999999999999999999999999999999987654
|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, STR genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A | Back alignment and structure |
|---|
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 150 | ||||
| d1a1va2 | 299 | c.37.1.14 (A:326-624) HCV helicase domain {Human h | 3e-29 | |
| d1wp9a2 | 286 | c.37.1.19 (A:201-486) putative ATP-dependent RNA h | 4e-20 | |
| d1fuka_ | 162 | c.37.1.19 (A:) Initiation factor 4a {Baker's yeast | 4e-19 | |
| d1fuka_ | 162 | c.37.1.19 (A:) Initiation factor 4a {Baker's yeast | 3e-04 | |
| d1gkub2 | 248 | c.37.1.16 (B:251-498) Helicase-like "domain" of re | 4e-19 | |
| d2j0sa2 | 168 | c.37.1.19 (A:244-411) Probable ATP-dependent RNA h | 4e-15 | |
| d1hv8a2 | 155 | c.37.1.19 (A:211-365) Putative DEAD box RNA helica | 6e-15 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 3e-14 | |
| d2fwra1 | 200 | c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar | 1e-13 | |
| d1t5la2 | 181 | c.37.1.19 (A:415-595) Nucleotide excision repair e | 2e-13 | |
| d1oywa3 | 200 | c.37.1.19 (A:207-406) RecQ helicase domain {Escher | 2e-13 | |
| d1jr6a_ | 138 | c.37.1.14 (A:) HCV helicase domain {Human hepatiti | 4e-13 | |
| d2p6ra4 | 201 | c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob | 8e-11 | |
| d2rb4a1 | 168 | c.37.1.19 (A:307-474) ATP-dependent RNA helicase D | 4e-10 | |
| d1s2ma2 | 171 | c.37.1.19 (A:252-422) Putative ATP-dependent RNA h | 3e-09 | |
| d1s2ma2 | 171 | c.37.1.19 (A:252-422) Putative ATP-dependent RNA h | 0.002 | |
| d1yksa2 | 299 | c.37.1.14 (A:325-623) YFV helicase domain {Yellow | 1e-07 | |
| d1t5ia_ | 168 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 4e-05 | |
| d1t5ia_ | 168 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 0.001 |
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RNA helicase domain: HCV helicase domain species: Human hepatitis C virus (HCV), different isolates [TaxId: 11103]
Score = 106 bits (265), Expect = 3e-29
Identities = 20/116 (17%), Positives = 37/116 (31%), Gaps = 14/116 (12%)
Query: 47 AEELANSLTVKEYDVLLLHGDMDQSER----------NSVITKFKRQECRILVATDVAAR 96
+ELA L + + + +D S + + ++ +
Sbjct: 49 CDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVATDALMTGFTGDFDSVIDCNTCVT 108
Query: 97 G---LDIPHIRTVVNYDLARDIDTHTHRIGRTGRAGNKGVAYTLVTDKDKDGELRS 149
+ T+ L +D + T R GRTGR G G+ + + G S
Sbjct: 109 QTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGR-GKPGIYRFVAPGERPSGMFDS 163
|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 | Back information, alignment and structure |
|---|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 150 | |||
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 100.0 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 100.0 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 100.0 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 100.0 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 100.0 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 100.0 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 100.0 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 99.97 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 99.97 | |
| d1wp9a2 | 286 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.95 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.94 | |
| d2p6ra4 | 201 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.92 | |
| d1gm5a4 | 206 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.91 | |
| d2fwra1 | 200 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.9 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 99.9 | |
| d1a1va2 | 299 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.89 | |
| d1gkub2 | 248 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.86 | |
| d1z3ix1 | 346 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 99.8 | |
| d1z5za1 | 244 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 99.78 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.73 | |
| d1tf5a4 | 175 | Translocation ATPase SecA, nucleotide-binding doma | 99.69 | |
| d1yksa2 | 299 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.69 | |
| d1nkta4 | 219 | Translocation ATPase SecA, nucleotide-binding doma | 99.42 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 98.13 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 97.82 | |
| d2eyqa2 | 117 | Transcription-repair coupling factor, TRCF {Escher | 94.76 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 94.51 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 94.29 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 90.91 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 90.16 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 89.62 | |
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 89.28 | |
| d1yt8a4 | 130 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 88.88 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 87.36 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 86.78 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 86.41 | |
| d1qxna_ | 137 | Polysulfide-sulfur transferase (sulfide dehydrogen | 85.04 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 84.69 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 84.55 | |
| d1yt8a1 | 136 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 84.35 | |
| d2b2na1 | 308 | Transcription-repair coupling factor, TRCF {Escher | 81.09 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 80.92 |
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Putative ATP-dependent RNA helicase DHH1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00 E-value=2.1e-34 Score=191.71 Aligned_cols=137 Identities=30% Similarity=0.482 Sum_probs=125.5
Q ss_pred cCeeEEEeecchhhHHHHHHHHHHhccCCCCCeeEEehhhhhHHHHHhhccccCceEEEecCCCCHHHHHHHHHHhhcCC
Q psy17637 5 KGVAYTLVTDKDKEFAGHLVRNLEGANQEVPPALMNLAMQLNAEELANSLTVKEYDVLLLHGDMDQSERNSVITKFKRQE 84 (150)
Q Consensus 5 ~~~~~~~~~~~~~~~~~~ll~~l~~~~~~~~~~ivf~~~~~~~~~l~~~L~~~~~~~~~~~~~~~~~~r~~~~~~f~~g~ 84 (150)
+++.+++...++..+...|.+.+... +..++||||++++.++.++..|...++.+..+||++++++|.+++..|++|.
T Consensus 5 ~~i~q~yi~v~~~~K~~~L~~ll~~~--~~~k~iVF~~~~~~~~~l~~~L~~~g~~~~~~h~~~~~~~r~~~~~~f~~~~ 82 (171)
T d1s2ma2 5 KGITQYYAFVEERQKLHCLNTLFSKL--QINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGK 82 (171)
T ss_dssp TTEEEEEEECCGGGHHHHHHHHHHHS--CCSEEEEECSSHHHHHHHHHHHHHHTCCEEEECTTSCHHHHHHHHHHHHTTS
T ss_pred cceEEEEEEcCHHHHHHHHHHHHHhC--CCCceEEEEeeeehhhHhHHhhhcccccccccccccchhhhhhhhhhcccCc
Confidence 46666676666666777777777665 6789999999999999999999999999999999999999999999999999
Q ss_pred ceEEEEcCCCcccCCccCCcEEEEecCCCChhHHHHhhccccCCCCccEEEEEEecCCC
Q psy17637 85 CRILVATDVAARGLDIPHIRTVVNYDLARDIDTHTHRIGRTGRAGNKGVAYTLVTDKDK 143 (150)
Q Consensus 85 ~~vlv~T~~~~~Gidi~~~~~vi~~~~~~~~~~~~q~~GR~~R~g~~~~~~~~~~~~~~ 143 (150)
..+||||+++++|+|+|++++||+||+|+++..|+||+||+||.|+.|.++.|+++.+.
T Consensus 83 ~~ilv~Td~~~~Gid~~~v~~VI~~d~p~~~~~y~qr~GR~gR~g~~g~~i~~v~~~e~ 141 (171)
T d1s2ma2 83 VRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDR 141 (171)
T ss_dssp SSEEEESSCSSSSCCCTTEEEEEESSCCSSHHHHHHHHCBSSCTTCCEEEEEEECGGGH
T ss_pred cccccchhHhhhccccceeEEEEecCCcchHHHHHHHhhhcccCCCccEEEEEeCHHHH
Confidence 99999999999999999999999999999999999999999999999999999988654
|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2b2na1 c.37.1.19 (A:26-333) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|