Psyllid ID: psy17644


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330
MSKLEYIPAPGSPSYKGNNASADTDSDEDPLDAFMKGIDKEVKQEAKGVKTKKIEEVKGIRDDIDHEDDEESYYRYMEENPNAGLQDNDSDVDLEYDEDGNPIAPKKSKYIDPLPPIDHSTIVYEEVEKNFYQPHEDIARLTPQEAQELRAKSGITVSGADPPYPVSSFGHFGFDEVLMKALRKCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELEPGDGPMGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGRIIDMVKMGATKLNRVTFLVLDEADRMFDMG
cccccccccccccccccccccccccccccHHHHHHHHcHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHHHHHHHcccEEEcccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHHccccccccEEEEEEcccccccccc
ccccccccccccccHHcccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHccccccccccccHcHccccccccccccccccccccccccccccccccccccccccccHHHHHccHHHHHHHHHHccEEEEccccccccccHHHccccHHHHHHHHHcccccccHHHHcHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHcccEEEEEcccHHHHHHHcccccccEEEEEEHHHHHHHHccc
mskleyipapgspsykgnnasadtdsdedpldaFMKGIDKEVKQEAKgvktkkieevkgirddidheddeesYYRYMeenpnaglqdndsdvdleydedgnpiapkkskyidplppidhstiVYEEVEknfyqphediarlTPQEAQELRaksgitvsgadppypvssfghfgFDEVLMKALRKceytsptpiqaqavpaalsgrdiigvaktgsgktgafiWPMLVHimdqkelepgdgpmglilapTRELSQQIYNEAKRFGKGYNLSVVCcygggskwdqsKALELGAeivvgtpgrIIDMVKMGATKLNRVTFLVLDEADRMFDMG
mskleyipapgspsykgnnasadtdsDEDPLDAFMKGIDKEvkqeakgvktkkieevkgirddidhedDEESYYRYMEenpnaglqdnDSDVDLEYDEDGnpiapkkskyidplppIDHSTIVYEEVEKNFYQPHEDIARLTPQEAQELRAKSGITVSGADPPYPVSSFGHFGFDEVLMKALRKCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELEPGDGPMGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGRIIDMVKmgatklnrvtflvldeadrmfdmg
MSKLEYIPAPGSPSYKGNNASADTDSDEDPLDAFMKGIDKEVKQEAKGVKTKKIEEVKGIRddidheddeeSYYRYMEENPNAGLQDNDSDVDLEYDEDGNPIAPKKSKYIDPLPPIDHSTIVYEEVEKNFYQPHEDIARLTPQEAQELRAKSGITVSGADPPYPVSSFGHFGFDEVLMKALRKCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELEPGDGPMGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGRIIDMVKMGATKLNRVTFLVLDEADRMFDMG
*****************************************************************************************************************LPPIDHSTIVYEEVEKNFYQP*****************************YPVSSFGHFGFDEVLMKALRKCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELE**DGPMGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGRIIDMVKMGATKLNRVTFLVLDE********
*****YI***********************LDAFMK*******************************************************************************PIDHSTIVYEEVEKNFYQPHEDIARLTPQEAQELRAKSGITVSGADPPYPVSSFGHFGFDEVLMKALRKCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELEPGDGPMGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGRIIDMVKMGATKLNRVTFLVLDEADRMFDMG
MSKLEYIPAPGSPS*************EDPLDAFMKGIDKEVKQEAKGVKTKKIEEVKGIRDDIDHEDDEESYYRYMEENPNAGLQDNDSDVDLEYDEDGNPIAPKKSKYIDPLPPIDHSTIVYEEVEKNFYQPHEDIARLTPQEAQELRAKSGITVSGADPPYPVSSFGHFGFDEVLMKALRKCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELEPGDGPMGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGRIIDMVKMGATKLNRVTFLVLDEADRMFDMG
***************************EDPLDAFMKGIDKEVKQE*************************ESYYRY*EENPN*********V*LEYDEDGNPIAPKKSKYIDPLPPIDHSTIVYEEVEKNFYQPHEDIARLTPQEAQELRAKSGITVSGADPPYPVSSFGHFGFDEVLMKALRKCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELEPGDGPMGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGRIIDMVKMGATKLNRVTFLVLDEADRMFD**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKLEYIPAPGSPSYKGNNASADTDSDEDPLDAFMKGIDKEVKQEAKGVKTKKIEEVKGIRDDIDHEDDEESYYRYMEENPNAGLQDNDSDVDLEYDEDGNPIAPKKSKYIDPLPPIDHSTIVYEEVEKNFYQPHEDIARLTPQEAQELRAKSGITVSGADPPYPVSSFGHFGFDEVLMKALRKCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELEPGDGPMGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGRIIDMVKMGATKLNRVTFLVLDEADRMFDMG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query330 2.2.26 [Sep-21-2011]
Q7ZY47 947 ATP-dependent RNA helicas N/A N/A 0.990 0.345 0.604 1e-111
Q810A7 929 ATP-dependent RNA helicas yes N/A 0.987 0.350 0.636 1e-109
Q5F485 944 ATP-dependent RNA helicas yes N/A 0.987 0.345 0.639 1e-109
Q86XP3 938 ATP-dependent RNA helicas yes N/A 0.987 0.347 0.633 1e-109
Q5R7D1 942 ATP-dependent RNA helicas yes N/A 0.987 0.346 0.633 1e-108
Q10MH8 770 DEAD-box ATP-dependent RN yes N/A 0.896 0.384 0.503 3e-76
Q54IV3 986 Probable ATP-dependent RN yes N/A 0.933 0.312 0.480 3e-75
O22907 760 DEAD-box ATP-dependent RN yes N/A 0.933 0.405 0.478 7e-75
Q62780 1032 Probable ATP-dependent RN no N/A 0.924 0.295 0.424 3e-61
Q569Z5 1032 Probable ATP-dependent RN no N/A 0.924 0.295 0.424 4e-61
>sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 Back     alignment and function desciption
 Score =  400 bits (1029), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 199/329 (60%), Positives = 245/329 (74%), Gaps = 2/329 (0%)

Query: 4   LEYIPAPGSPSYKGNNASADTDSDEDPLDAFMKGIDKEVKQEAKGVKTKKIEEV--KGIR 61
           L YIPA  SP+ +   +  D+DS+EDPL+AFM  ++ +  ++ + ++ +  E+   +GIR
Sbjct: 85  LPYIPAENSPTRQQLRSKTDSDSEEDPLEAFMAEVEDQAAKDMRKLEERDKEKANARGIR 144

Query: 62  DDIDHEDDEESYYRYMEENPNAGLQDNDSDVDLEYDEDGNPIAPKKSKYIDPLPPIDHST 121
           DDI+ EDD+E+Y+RYM ENP AGL   + + +LEYD DGNPIAP   + IDPLPPIDH+ 
Sbjct: 145 DDIEEEDDQEAYFRYMAENPTAGLVPEEEEDNLEYDSDGNPIAPTTKRIIDPLPPIDHTE 204

Query: 122 IVYEEVEKNFYQPHEDIARLTPQEAQELRAKSGITVSGADPPYPVSSFGHFGFDEVLMKA 181
           I Y   EKNFY+ HE I   TPQ+  ELR K  + VSGA PP   SSF HFGFDE L+  
Sbjct: 205 IEYPPFEKNFYEEHEAITSQTPQQITELRHKLNLRVSGAAPPRLCSSFAHFGFDEQLLHQ 264

Query: 182 LRKCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELEPGDGP 241
           +RK EYT PTPIQ Q +P ALSGRD+IG+AKTGSGKT AFIWP+LVHIMDQKEL+P DGP
Sbjct: 265 IRKSEYTQPTPIQCQGIPVALSGRDMIGIAKTGSGKTAAFIWPILVHIMDQKELQPADGP 324

Query: 242 MGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGRI 301
           + +I+ PTREL QQI++E KRFGK YNL  V  YGGGS W+Q+KAL+ GAEIVV TPGR+
Sbjct: 325 IAVIVCPTRELCQQIHSECKRFGKAYNLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRL 384

Query: 302 IDMVKMGATKLNRVTFLVLDEADRMFDMG 330
           ID VK  AT L RVT+LV DEADRMFDMG
Sbjct: 385 IDHVKKKATNLQRVTYLVFDEADRMFDMG 413




ATP-dependent RNA helicase. Binds to RNA. May be involved in the survival of cells.
Xenopus laevis (taxid: 8355)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q810A7|DDX42_MOUSE ATP-dependent RNA helicase DDX42 OS=Mus musculus GN=Ddx42 PE=1 SV=3 Back     alignment and function description
>sp|Q5F485|DDX42_CHICK ATP-dependent RNA helicase DDX42 OS=Gallus gallus GN=DDX42 PE=2 SV=1 Back     alignment and function description
>sp|Q86XP3|DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens GN=DDX42 PE=1 SV=1 Back     alignment and function description
>sp|Q5R7D1|DDX42_PONAB ATP-dependent RNA helicase DDX42 OS=Pongo abelii GN=DDX42 PE=2 SV=1 Back     alignment and function description
>sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 Back     alignment and function description
>sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 Back     alignment and function description
>sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 Back     alignment and function description
>sp|Q62780|DDX46_RAT Probable ATP-dependent RNA helicase DDX46 OS=Rattus norvegicus GN=Ddx46 PE=1 SV=1 Back     alignment and function description
>sp|Q569Z5|DDX46_MOUSE Probable ATP-dependent RNA helicase DDX46 OS=Mus musculus GN=Ddx46 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query330
345487283 793 PREDICTED: ATP-dependent RNA helicase DD 0.996 0.414 0.727 1e-139
383857449 774 PREDICTED: ATP-dependent RNA helicase DD 0.990 0.422 0.724 1e-137
322799398 764 hypothetical protein SINV_08125 [Solenop 0.996 0.430 0.725 1e-137
350426308 774 PREDICTED: ATP-dependent RNA helicase DD 0.990 0.422 0.718 1e-136
66522071 772 PREDICTED: ATP-dependent RNA helicase DD 0.990 0.423 0.727 1e-136
340723638 774 PREDICTED: ATP-dependent RNA helicase DD 0.990 0.422 0.718 1e-136
380022612 772 PREDICTED: LOW QUALITY PROTEIN: ATP-depe 0.990 0.423 0.724 1e-136
307204462 770 ATP-dependent RNA helicase DDX42 [Harpeg 0.996 0.427 0.713 1e-136
307190551 769 ATP-dependent RNA helicase DDX42 [Campon 0.996 0.427 0.716 1e-136
157117281 799 DEAD box ATP-dependent RNA helicase [Aed 0.993 0.410 0.711 1e-132
>gi|345487283|ref|XP_001603249.2| PREDICTED: ATP-dependent RNA helicase DDX42-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  501 bits (1290), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 243/334 (72%), Positives = 276/334 (82%), Gaps = 5/334 (1%)

Query: 2   SKLEYIPAPGSPSYK----GNNASADTDSDEDPLDAFMKGIDKEV-KQEAKGVKTKKIEE 56
           S LEYIPAPGSPSY+     N    D+DS+EDPLDAFM GI+ E+ + +A  V+ +K E+
Sbjct: 85  STLEYIPAPGSPSYEEHINKNKKKEDSDSEEDPLDAFMAGIESEIERTKAPSVEDRKEEK 144

Query: 57  VKGIRDDIDHEDDEESYYRYMEENPNAGLQDNDSDVDLEYDEDGNPIAPKKSKYIDPLPP 116
            KGIR DID EDDEESYYRYMEENPNAGL  +DSD ++EYDEDGNPIAP K K IDPLPP
Sbjct: 145 TKGIRADIDGEDDEESYYRYMEENPNAGLHLDDSDQEIEYDEDGNPIAPLKKKEIDPLPP 204

Query: 117 IDHSTIVYEEVEKNFYQPHEDIARLTPQEAQELRAKSGITVSGADPPYPVSSFGHFGFDE 176
           IDHS I YE  EKNFY  HEDIA L  Q+  ELR   GI V+G  PP PV+SFGHFGFD+
Sbjct: 205 IDHSVIPYEPFEKNFYNVHEDIANLNKQQIDELRKTLGIKVTGPAPPNPVTSFGHFGFDD 264

Query: 177 VLMKALRKCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELE 236
            L+K++RK EYT PTPIQAQ++P ALSGRD+IG+AKTGSGKT AF+WPMLVHIMDQKEL+
Sbjct: 265 SLIKSIRKHEYTQPTPIQAQSIPVALSGRDLIGIAKTGSGKTAAFVWPMLVHIMDQKELD 324

Query: 237 PGDGPMGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVG 296
            GDGP+GLILAPTRELSQQIY+EAK+FGK YN+ V CCYGGGSKW+QSKALE GAEIVV 
Sbjct: 325 SGDGPIGLILAPTRELSQQIYHEAKKFGKVYNIRVCCCYGGGSKWEQSKALESGAEIVVA 384

Query: 297 TPGRIIDMVKMGATKLNRVTFLVLDEADRMFDMG 330
           TPGRIID+VKM AT L+RVTFLVLDEADRMFDMG
Sbjct: 385 TPGRIIDLVKMKATNLSRVTFLVLDEADRMFDMG 418




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383857449|ref|XP_003704217.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322799398|gb|EFZ20748.1| hypothetical protein SINV_08125 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350426308|ref|XP_003494399.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|66522071|ref|XP_624210.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340723638|ref|XP_003400196.1| PREDICTED: ATP-dependent RNA helicase DDX42-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380022612|ref|XP_003695134.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DDX42-like [Apis florea] Back     alignment and taxonomy information
>gi|307204462|gb|EFN83169.1| ATP-dependent RNA helicase DDX42 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307190551|gb|EFN74538.1| ATP-dependent RNA helicase DDX42 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|157117281|ref|XP_001653010.1| DEAD box ATP-dependent RNA helicase [Aedes aegypti] gi|108883352|gb|EAT47577.1| AAEL001317-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query330
FB|FBgn0036104 791 CG6418 [Drosophila melanogaste 0.978 0.408 0.681 5.4e-118
UNIPROTKB|F1P0H1 703 DDX42 "ATP-dependent RNA helic 0.987 0.463 0.621 3.1e-106
UNIPROTKB|Q5F485 944 DDX42 "ATP-dependent RNA helic 0.987 0.345 0.618 2.2e-105
UNIPROTKB|F1NJ40 946 DDX42 "ATP-dependent RNA helic 0.987 0.344 0.617 7.5e-105
UNIPROTKB|E2RFF1 933 DDX42 "Uncharacterized protein 0.987 0.349 0.615 1.6e-104
MGI|MGI:1919297 929 Ddx42 "DEAD (Asp-Glu-Ala-Asp) 0.987 0.350 0.615 1.6e-104
RGD|1304909 929 Ddx42 "DEAD (Asp-Glu-Ala-Asp) 0.987 0.350 0.615 2e-104
UNIPROTKB|E1BJD2 946 DDX42 "Uncharacterized protein 0.987 0.344 0.612 4.1e-104
UNIPROTKB|Q86XP3 938 DDX42 "ATP-dependent RNA helic 0.987 0.347 0.612 5.3e-104
UNIPROTKB|Q5R7D1 942 DDX42 "ATP-dependent RNA helic 0.987 0.346 0.612 6.7e-104
FB|FBgn0036104 CG6418 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1162 (414.1 bits), Expect = 5.4e-118, P = 5.4e-118
 Identities = 223/327 (68%), Positives = 258/327 (78%)

Query:     6 YIPAPGSPSYKGNNASA--DTDSDEDPLDAFMKGIDKEVKQEAKGVKTKKIEEVKGIRXX 63
             YIPAPGSP     +A    D+DSDEDPL+ FM GI+++V++E +    K     + +R  
Sbjct:   108 YIPAPGSPGAPPTSAKKQEDSDSDEDPLEQFMAGINQQVEKEKRQQAPKP--PTQAVRGD 165

Query:    64 XXXXXXXXSYYRYMEENPNAGLQDNDSDVDLEYDEDGNPIAPKKSKYIDPLPPIDHSTIV 123
                     SYYRYM+ENPNAGL+D  SD ++EYDEDGNPIAP K K IDPLPPI HS I 
Sbjct:   166 IDDEDDEESYYRYMKENPNAGLRDEGSDQEIEYDEDGNPIAPPKKKDIDPLPPIYHSEIE 225

Query:   124 YEEVEKNFYQPHEDIARLTPQEAQELRAKSGITVSGADPPYPVSSFGHFGFDEVLMKALR 183
             YE  EKNFY  H+DIA L  ++ +ELR   G+ V+G  PP PV+SFGHFGFDE L+KA+R
Sbjct:   226 YEPFEKNFYTQHDDIAALDDEQVRELRRTLGVKVTGPSPPKPVTSFGHFGFDEQLIKAVR 285

Query:   184 KCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELEPGDGPMG 243
             K EYT PTPIQAQAVP ALSGRDIIG+AKTGSGKT AFIWPML+H+MDQK+L+PGDGP+G
Sbjct:   286 KAEYTQPTPIQAQAVPTALSGRDIIGIAKTGSGKTAAFIWPMLMHVMDQKQLKPGDGPIG 345

Query:   244 LILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGRIID 303
             LILAPTRELS QIYNEAK+FGK YNL+VVCCYGGGSKW+QSKALE GAEI+V TPGR+ID
Sbjct:   346 LILAPTRELSLQIYNEAKKFGKVYNLNVVCCYGGGSKWEQSKALEQGAEIIVATPGRMID 405

Query:   304 MVKMGATKLNRVTFLVLDEADRMFDMG 330
             MVKM AT L RVTFLVLDEADRMF MG
Sbjct:   406 MVKMKATNLRRVTFLVLDEADRMFHMG 432




GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS
GO:0004386 "helicase activity" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|F1P0H1 DDX42 "ATP-dependent RNA helicase DDX42" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F485 DDX42 "ATP-dependent RNA helicase DDX42" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJ40 DDX42 "ATP-dependent RNA helicase DDX42" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RFF1 DDX42 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1919297 Ddx42 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 42" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1304909 Ddx42 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 42" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BJD2 DDX42 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q86XP3 DDX42 "ATP-dependent RNA helicase DDX42" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R7D1 DDX42 "ATP-dependent RNA helicase DDX42" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6CIV2DBP2_KLULA3, ., 6, ., 4, ., 1, 30.50730.61510.3664yesN/A
Q9P7C7PRP11_SCHPO3, ., 6, ., 4, ., 1, 30.50650.67870.2209yesN/A
Q5F485DDX42_CHICK3, ., 6, ., 4, ., 1, 30.63930.98780.3453yesN/A
Q86XP3DDX42_HUMAN3, ., 6, ., 4, ., 1, 30.63330.98780.3475yesN/A
A3LQ55PRP5_PICST3, ., 6, ., 4, ., 1, 30.50450.65750.248yesN/A
Q10MH8RH24_ORYSJ3, ., 6, ., 4, ., 1, 30.50310.89690.3844yesN/A
Q5R7D1DDX42_PONAB3, ., 6, ., 4, ., 1, 30.63330.98780.3460yesN/A
Q810A7DDX42_MOUSE3, ., 6, ., 4, ., 1, 30.63630.98780.3509yesN/A
Q5BDW4PRP5_EMENI3, ., 6, ., 4, ., 1, 30.50220.65750.1849yesN/A
Q2U2J6PRP5_ASPOR3, ., 6, ., 4, ., 1, 30.50670.65750.1829yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
cd00268203 cd00268, DEADc, DEAD-box helicases 9e-78
PTZ00110 545 PTZ00110, PTZ00110, helicase; Provisional 2e-77
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-66
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 3e-54
PLN00206 518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 2e-42
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-42
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 7e-42
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 3e-41
PRK04837 423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 9e-41
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 7e-38
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 3e-36
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 4e-36
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 2e-33
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-31
PTZ00424 401 PTZ00424, PTZ00424, helicase 45; Provisional 3e-26
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 7e-09
COG1205 851 COG1205, COG1205, Distinct helicase family with a 5e-08
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 4e-07
COG1061 442 COG1061, SSL2, DNA or RNA helicases of superfamily 5e-05
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 2e-04
TIGR03817 742 TIGR03817, DECH_helic, helicase/secretion neighbor 0.004
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
 Score =  236 bits (604), Expect = 9e-78
 Identities = 80/162 (49%), Positives = 105/162 (64%), Gaps = 3/162 (1%)

Query: 169 FGHFGFDEVLMKALRKCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVH 228
           F   G    L++ +    +  PTPIQA+A+P  LSGRD+IG A+TGSGKT AF+ P+L  
Sbjct: 1   FEELGLSPELLRGIYALGFEKPTPIQARAIPPLLSGRDVIGQAQTGSGKTAAFLIPILEK 60

Query: 229 IMDQKELEPGDGPMGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALE 288
           +    +    DGP  LILAPTREL+ QI   A++ GK  NL VV  YGG S   Q + L+
Sbjct: 61  LDPSPKK---DGPQALILAPTRELALQIAEVARKLGKHTNLKVVVIYGGTSIDKQIRKLK 117

Query: 289 LGAEIVVGTPGRIIDMVKMGATKLNRVTFLVLDEADRMFDMG 330
            G  IVV TPGR++D+++ G   L++V +LVLDEADRM DMG
Sbjct: 118 RGPHIVVATPGRLLDLLERGKLDLSKVKYLVLDEADRMLDMG 159


A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region. Length = 203

>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 330
KOG0339|consensus 731 100.0
KOG0334|consensus 997 100.0
PTZ00110 545 helicase; Provisional 100.0
KOG0331|consensus 519 100.0
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0336|consensus 629 100.0
KOG0338|consensus 691 100.0
KOG0333|consensus 673 100.0
KOG0341|consensus 610 100.0
KOG0330|consensus 476 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0335|consensus 482 100.0
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0348|consensus 708 100.0
KOG0345|consensus 567 100.0
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0343|consensus 758 100.0
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0342|consensus 543 100.0
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.98
KOG0347|consensus 731 99.98
KOG0340|consensus 442 99.97
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.97
KOG0346|consensus 569 99.97
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 99.97
KOG0337|consensus 529 99.97
PTZ00424 401 helicase 45; Provisional 99.96
KOG0328|consensus 400 99.96
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.96
KOG0326|consensus 459 99.96
KOG0350|consensus 620 99.95
KOG0329|consensus 387 99.94
KOG0344|consensus 593 99.94
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.94
KOG4284|consensus 980 99.93
PRK02362 737 ski2-like helicase; Provisional 99.93
KOG0327|consensus 397 99.93
PRK00254 720 ski2-like helicase; Provisional 99.92
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.92
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.91
PRK13767 876 ATP-dependent helicase; Provisional 99.91
PRK01172 674 ski2-like helicase; Provisional 99.9
KOG0332|consensus 477 99.9
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.89
PRK09401 1176 reverse gyrase; Reviewed 99.89
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.88
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.88
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.88
PRK14701 1638 reverse gyrase; Provisional 99.87
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.86
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.85
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.85
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.84
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.83
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.83
COG1205 851 Distinct helicase family with a unique C-terminal 99.83
PRK10689 1147 transcription-repair coupling factor; Provisional 99.81
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.8
KOG0349|consensus 725 99.79
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.79
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.78
COG1204 766 Superfamily II helicase [General function predicti 99.78
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.77
PHA02558 501 uvsW UvsW helicase; Provisional 99.76
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.76
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.75
smart00487201 DEXDc DEAD-like helicases superfamily. 99.75
KOG0952|consensus 1230 99.71
KOG2340|consensus 698 99.71
PRK13766 773 Hef nuclease; Provisional 99.7
COG1202 830 Superfamily II helicase, archaea-specific [General 99.67
PHA02653 675 RNA helicase NPH-II; Provisional 99.66
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.65
PRK05580 679 primosome assembly protein PriA; Validated 99.63
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.63
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.62
KOG0354|consensus 746 99.62
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.6
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.6
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.59
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.58
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.57
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 99.57
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.57
KOG0352|consensus 641 99.49
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.48
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.48
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.44
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.42
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.4
KOG0351|consensus 941 99.4
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.39
smart00488 289 DEXDc2 DEAD-like helicases superfamily. 99.37
smart00489 289 DEXDc3 DEAD-like helicases superfamily. 99.37
KOG0353|consensus 695 99.37
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 99.33
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.33
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.33
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.32
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.31
KOG0951|consensus 1674 99.28
PRK09694 878 helicase Cas3; Provisional 99.26
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.22
KOG0947|consensus 1248 99.17
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.16
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.15
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 99.15
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.13
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 99.1
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.05
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 99.03
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 99.01
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 98.97
PF00176 299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.97
KOG0948|consensus 1041 98.93
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.92
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 98.92
KOG0949|consensus 1330 98.92
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 98.9
COG4096 875 HsdR Type I site-specific restriction-modification 98.87
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 98.84
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.84
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 98.82
KOG1002|consensus 791 98.8
KOG0950|consensus 1008 98.78
KOG0385|consensus 971 98.78
COG1198 730 PriA Primosomal protein N' (replication factor Y) 98.74
PRK04914 956 ATP-dependent helicase HepA; Validated 98.71
KOG0951|consensus 1674 98.68
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.66
COG4889 1518 Predicted helicase [General function prediction on 98.65
PF06862 442 DUF1253: Protein of unknown function (DUF1253); In 98.59
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.58
KOG0387|consensus 923 98.49
KOG0391|consensus 1958 98.48
KOG1132|consensus 945 98.35
KOG0389|consensus 941 98.32
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.32
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 98.28
KOG1123|consensus 776 98.28
KOG4439|consensus 901 98.27
KOG0952|consensus 1230 98.24
KOG0390|consensus 776 98.2
PRK14873 665 primosome assembly protein PriA; Provisional 98.2
COG0610 962 Type I site-specific restriction-modification syst 98.15
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.11
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.09
KOG0392|consensus 1549 98.09
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 98.09
KOG1803|consensus 649 98.03
KOG0384|consensus 1373 97.99
PRK15483 986 type III restriction-modification system StyLTI en 97.99
TIGR00376 637 DNA helicase, putative. The gene product may repre 97.98
KOG0920|consensus 924 97.93
KOG1802|consensus 935 97.92
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 97.92
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.89
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 97.83
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.75
KOG0388|consensus 1185 97.71
KOG0386|consensus 1157 97.66
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 97.62
PF1324576 AAA_19: Part of AAA domain 97.61
KOG0926|consensus 1172 97.59
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 97.52
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.51
KOG1805|consensus 1100 97.5
KOG1000|consensus 689 97.5
PRK10536262 hypothetical protein; Provisional 97.5
KOG0922|consensus 674 97.43
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 97.39
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 97.39
PRK10875 615 recD exonuclease V subunit alpha; Provisional 97.34
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 97.34
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.32
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 97.29
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 97.29
PF13872 303 AAA_34: P-loop containing NTP hydrolase pore-1 97.26
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.25
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.23
KOG1131|consensus 755 97.2
KOG1133|consensus 821 97.16
KOG0925|consensus 699 96.97
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 96.97
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.94
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.8
PHA02533 534 17 large terminase protein; Provisional 96.72
KOG0923|consensus 902 96.7
PRK04296190 thymidine kinase; Provisional 96.65
COG3587 985 Restriction endonuclease [Defense mechanisms] 96.63
smart00382148 AAA ATPases associated with a variety of cellular 96.58
KOG0924|consensus 1042 96.57
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 96.52
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.49
COG2805 353 PilT Tfp pilus assembly protein, pilus retraction 96.47
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 96.46
PRK11054 684 helD DNA helicase IV; Provisional 96.41
KOG0953|consensus 700 96.37
PRK05298 652 excinuclease ABC subunit B; Provisional 96.34
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.3
KOG1001|consensus 674 96.25
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 96.18
KOG4150|consensus 1034 96.16
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 96.14
PF03354 477 Terminase_1: Phage Terminase ; InterPro: IPR005021 96.09
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.99
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 95.99
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 95.93
PRK13833323 conjugal transfer protein TrbB; Provisional 95.81
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 95.8
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 95.75
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 95.68
TIGR00064272 ftsY signal recognition particle-docking protein F 95.68
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.61
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.59
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 95.58
KOG0298|consensus 1394 95.51
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.51
cd00984 242 DnaB_C DnaB helicase C terminal domain. The hexame 95.5
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 95.48
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.34
KOG1015|consensus 1567 95.31
PRK08727233 hypothetical protein; Validated 95.27
PRK07952244 DNA replication protein DnaC; Validated 95.26
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 95.24
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.24
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 95.2
PRK14087 450 dnaA chromosomal replication initiation protein; P 95.11
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.11
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 95.01
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 94.91
PTZ00112 1164 origin recognition complex 1 protein; Provisional 94.9
PRK05973237 replicative DNA helicase; Provisional 94.89
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.86
PF05621 302 TniB: Bacterial TniB protein; InterPro: IPR008868 94.83
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.83
PF03796 259 DnaB_C: DnaB-like helicase C terminal domain; Inte 94.81
TIGR01547 396 phage_term_2 phage terminase, large subunit, PBSX 94.81
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 94.8
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 94.8
PHA03333 752 putative ATPase subunit of terminase; Provisional 94.7
PRK11823 446 DNA repair protein RadA; Provisional 94.63
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.44
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.39
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.38
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 94.36
COG3973 747 Superfamily I DNA and RNA helicases [General funct 94.35
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 94.33
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 94.3
PRK08506 472 replicative DNA helicase; Provisional 94.26
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 94.2
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.09
PRK00411 394 cdc6 cell division control protein 6; Reviewed 94.07
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 94.04
PRK05748 448 replicative DNA helicase; Provisional 93.99
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 93.97
PRK08181269 transposase; Validated 93.96
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 93.93
PRK07004 460 replicative DNA helicase; Provisional 93.9
PRK08006 471 replicative DNA helicase; Provisional 93.88
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 93.85
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.82
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 93.81
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 93.74
COG1484254 DnaC DNA replication protein [DNA replication, rec 93.67
PRK13851344 type IV secretion system protein VirB11; Provision 93.66
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 93.66
COG4626 546 Phage terminase-like protein, large subunit [Gener 93.64
PRK13764 602 ATPase; Provisional 93.62
TIGR02237209 recomb_radB DNA repair and recombination protein R 93.62
PRK00771 437 signal recognition particle protein Srp54; Provisi 93.53
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 93.53
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 93.53
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 93.51
PRK06904 472 replicative DNA helicase; Validated 93.47
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 93.44
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 93.44
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 93.43
PRK14974336 cell division protein FtsY; Provisional 93.43
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 93.42
PRK08903227 DnaA regulatory inactivator Hda; Validated 93.37
PRK10689 1147 transcription-repair coupling factor; Provisional 93.35
PRK06921266 hypothetical protein; Provisional 93.35
TIGR00665 434 DnaB replicative DNA helicase. This model describe 93.34
PRK06835329 DNA replication protein DnaC; Validated 93.34
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 93.28
KOG0989|consensus 346 93.28
PRK08116268 hypothetical protein; Validated 93.28
PRK05595 444 replicative DNA helicase; Provisional 93.18
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 93.17
PRK12402 337 replication factor C small subunit 2; Reviewed 93.16
PRK10416318 signal recognition particle-docking protein FtsY; 93.12
PRK13897 606 type IV secretion system component VirD4; Provisio 93.07
COG0552340 FtsY Signal recognition particle GTPase [Intracell 93.04
PRK00149 450 dnaA chromosomal replication initiation protein; R 92.99
PF03237 384 Terminase_6: Terminase-like family; InterPro: IPR0 92.99
PRK08840 464 replicative DNA helicase; Provisional 92.92
PRK08760 476 replicative DNA helicase; Provisional 92.75
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 92.68
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 92.66
PRK12377248 putative replication protein; Provisional 92.64
PF12846 304 AAA_10: AAA-like domain 92.61
KOG0344|consensus 593 92.6
TIGR00959 428 ffh signal recognition particle protein. This mode 92.5
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 92.49
KOG0331|consensus519 92.48
PF10412 386 TrwB_AAD_bind: Type IV secretion-system coupling p 92.47
PRK09165 497 replicative DNA helicase; Provisional 92.42
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 92.4
PRK05636 505 replicative DNA helicase; Provisional 92.37
PRK08769 319 DNA polymerase III subunit delta'; Validated 92.34
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 92.33
PRK08533230 flagellar accessory protein FlaH; Reviewed 92.29
PRK06526254 transposase; Provisional 92.22
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 92.18
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 92.05
COG3972 660 Superfamily I DNA and RNA helicases [General funct 91.99
PRK10867 433 signal recognition particle protein; Provisional 91.94
PRK04328 249 hypothetical protein; Provisional 91.92
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 91.91
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 91.86
PRK06321 472 replicative DNA helicase; Provisional 91.73
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 91.64
PTZ00110545 helicase; Provisional 91.64
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 91.63
KOG3089|consensus271 91.55
PHA02535 581 P terminase ATPase subunit; Provisional 91.52
KOG0333|consensus673 91.46
cd01127 410 TrwB Bacterial conjugation protein TrwB, ATP bindi 91.43
PRK13850 670 type IV secretion system protein VirD4; Provisiona 91.4
PRK09183259 transposase/IS protein; Provisional 91.33
COG1435 201 Tdk Thymidine kinase [Nucleotide transport and met 91.33
cd03115173 SRP The signal recognition particle (SRP) mediates 91.17
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 91.15
PRK09376 416 rho transcription termination factor Rho; Provisio 91.09
PRK10436 462 hypothetical protein; Provisional 91.03
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 90.99
PTZ00293211 thymidine kinase; Provisional 90.98
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 90.91
PRK09112 351 DNA polymerase III subunit delta'; Validated 90.86
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 90.83
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 90.79
PF04665 241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 90.77
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 90.75
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 90.74
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 90.69
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 90.65
PF13173128 AAA_14: AAA domain 90.5
PHA00729226 NTP-binding motif containing protein 90.42
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 90.41
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 90.4
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 90.35
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 90.23
TIGR00767 415 rho transcription termination factor Rho. Members 90.19
cd01128 249 rho_factor Transcription termination factor rho is 90.09
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 90.07
PRK13822 641 conjugal transfer coupling protein TraG; Provision 90.01
PHA03368 738 DNA packaging terminase subunit 1; Provisional 89.98
TIGR03743 634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 89.84
cd01393226 recA_like RecA is a bacterial enzyme which has rol 89.83
PRK13876 663 conjugal transfer coupling protein TraG; Provision 89.73
PRK13700 732 conjugal transfer protein TraD; Provisional 89.72
KOG2004|consensus 906 89.71
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 89.69
KOG1806|consensus 1320 89.58
TIGR00643630 recG ATP-dependent DNA helicase RecG. 89.54
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 89.53
cd03114148 ArgK-like The function of this protein family is u 89.52
TIGR02533 486 type_II_gspE general secretory pathway protein E. 89.48
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 89.47
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 89.42
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 89.4
TIGR03754 643 conj_TOL_TraD conjugative coupling factor TraD, TO 89.39
PRK13880 636 conjugal transfer coupling protein TraG; Provision 89.34
PRK07471 365 DNA polymerase III subunit delta'; Validated 89.34
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 89.3
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 89.28
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 89.25
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 89.23
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 89.22
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 89.16
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 89.14
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 89.11
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 89.06
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 88.98
cd01125 239 repA Hexameric Replicative Helicase RepA. RepA is 88.98
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 88.9
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 88.89
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 88.87
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 88.84
PRK08939306 primosomal protein DnaI; Reviewed 88.8
PRK13767 876 ATP-dependent helicase; Provisional 88.79
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 88.74
KOG0991|consensus 333 88.72
KOG0744|consensus 423 88.72
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 88.53
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 88.52
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 88.52
PRK06871 325 DNA polymerase III subunit delta'; Validated 88.5
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 88.45
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 88.4
COG2256 436 MGS1 ATPase related to the helicase subunit of the 88.34
PRK08699 325 DNA polymerase III subunit delta'; Validated 88.18
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 88.12
PRK05642234 DNA replication initiation factor; Validated 88.08
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 88.03
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 87.96
TIGR02767 623 TraG-Ti Ti-type conjugative transfer system protie 87.95
PHA03372 668 DNA packaging terminase subunit 1; Provisional 87.92
PRK05707 328 DNA polymerase III subunit delta'; Validated 87.89
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 87.79
PF14516 331 AAA_35: AAA-like domain 87.64
KOG1016|consensus 1387 87.63
PHA02544 316 44 clamp loader, small subunit; Provisional 87.63
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 87.53
PRK04301317 radA DNA repair and recombination protein RadA; Va 87.53
PHA02542 473 41 41 helicase; Provisional 87.49
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 87.49
cd01394218 radB RadB. The archaeal protein radB shares simila 87.44
KOG1533|consensus 290 87.34
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 87.33
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 87.3
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 87.22
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 87.2
PRK07773 886 replicative DNA helicase; Validated 87.14
PRK06749 428 replicative DNA helicase; Provisional 87.07
PF02456 369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 87.02
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 87.01
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 87.0
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 86.86
PF1355562 AAA_29: P-loop containing region of AAA domain 86.79
PF01443 234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 86.75
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 86.59
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 86.55
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 86.42
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 86.36
KOG0741|consensus 744 86.34
TIGR02759 566 TraD_Ftype type IV conjugative transfer system cou 86.1
PRK04195 482 replication factor C large subunit; Provisional 86.04
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 86.0
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 85.95
PTZ00424401 helicase 45; Provisional 85.89
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 85.78
TIGR03744 893 traC_PFL_4706 conjugative transfer ATPase, PFL_470 85.76
PRK00440 319 rfc replication factor C small subunit; Reviewed 85.66
COG5008 375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 85.62
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 85.48
KOG0741|consensus744 85.46
PRK06067234 flagellar accessory protein FlaH; Validated 85.41
PRK09694 878 helicase Cas3; Provisional 85.38
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 85.28
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 85.19
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 85.15
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 85.03
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 84.99
KOG0330|consensus476 84.97
COG4098441 comFA Superfamily II DNA/RNA helicase required for 84.87
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 84.74
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 84.62
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 84.49
COG0305 435 DnaB Replicative DNA helicase [DNA replication, re 84.44
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 84.38
PRK08084235 DNA replication initiation factor; Provisional 84.35
PRK04914 956 ATP-dependent helicase HepA; Validated 84.24
PRK09361225 radB DNA repair and recombination protein RadB; Pr 84.19
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 83.92
PRK09302 509 circadian clock protein KaiC; Reviewed 83.72
cd00983 325 recA RecA is a bacterial enzyme which has roles in 83.59
KOG0341|consensus610 83.5
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 83.48
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 83.32
TIGR02974 329 phageshock_pspF psp operon transcriptional activat 83.22
PRK06893229 DNA replication initiation factor; Validated 83.19
KOG0780|consensus 483 83.08
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 82.95
PHA00350 399 putative assembly protein 82.93
PRK09302 509 circadian clock protein KaiC; Reviewed 82.87
TIGR02746 797 TraC-F-type type-IV secretion system protein TraC. 82.68
COG0593 408 DnaA ATPase involved in DNA replication initiation 82.65
PF05729166 NACHT: NACHT domain 82.6
KOG2227|consensus 529 82.5
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 82.48
PF0230290 PTS_IIB: PTS system, Lactose/Cellobiose specific I 82.43
PRK09354 349 recA recombinase A; Provisional 82.35
PF09439181 SRPRB: Signal recognition particle receptor beta s 82.33
COG3451 796 VirB4 Type IV secretory pathway, VirB4 components 82.29
PRK07993 334 DNA polymerase III subunit delta'; Validated 82.18
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 82.07
PRK06090 319 DNA polymerase III subunit delta'; Validated 81.9
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 81.66
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 81.55
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 81.47
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 81.3
PHA00012 361 I assembly protein 81.28
PRK06964 342 DNA polymerase III subunit delta'; Validated 81.26
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 81.03
TIGR02236310 recomb_radA DNA repair and recombination protein R 80.89
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 80.79
PRK05298 652 excinuclease ABC subunit B; Provisional 80.52
>KOG0339|consensus Back     alignment and domain information
Probab=100.00  E-value=1.5e-61  Score=452.50  Aligned_cols=325  Identities=59%  Similarity=0.986  Sum_probs=292.4

Q ss_pred             CCCCCCCCCCccCCCCCCCCCCCCChHHHHHhhhhHHHHHhhhccccccccc--------ccCccCCCCCccchHHHHhh
Q psy17644          5 EYIPAPGSPSYKGNNASADTDSDEDPLDAFMKGIDKEVKQEAKGVKTKKIEE--------VKGIRDDIDHEDDEESYYRY   76 (330)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~d~~d~~~~~l~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~e~~~~~~~~~   76 (330)
                      +|-..+..|..........+.++.||+|+||+.+....+++++...+++.+.        ....+.+++++++.+.++.+
T Consensus        54 ey~eddd~p~~~s~~~a~~~~de~d~ldafMA~~~d~~~sd~~~~e~kk~eRkn~dd~~p~~~vr~dI~~e~aae~~~ky  133 (731)
T KOG0339|consen   54 EYEEDDDIPEGGSAAAAGGEVDEIDPLDAFMAKIEDQAQSDKKPLEQKKKERKNDDDDDPTATVRADIDEEDAAEALFKY  133 (731)
T ss_pred             ccccccccccccchhhccCCCCCCCCcchhhhhhhhhhhccCCccchHHHhhhccCCCccchhhhcchhhHHhHHHHHHH
Confidence            4444444443333334455677889999999999998877766542222111        22456788889999999999


Q ss_pred             hhcCCCCCCCCCCCccccccccCCCCCCCccccCCCCCCCCCCCccchhhhhhhcCCCChhhhccCHHHHHHHHHHcCcE
Q psy17644         77 MEENPNAGLQDNDSDVDLEYDEDGNPIAPKKSKYIDPLPPIDHSTIVYEEVEKNFYQPHEDIARLTPQEAQELRAKSGIT  156 (330)
Q Consensus        77 ~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~r~~~~i~  156 (330)
                      +.++...+...+.++...++++|++++.+ .++.++|+++++|+++.|.||+++||..|+.+..++..++..+|..++++
T Consensus       134 m~e~k~~~~~~e~~~~~leydsd~nPi~~-~kr~idpl~~idhs~i~y~p~~kdfy~e~esI~gl~~~d~~~~r~~Lnlr  212 (731)
T KOG0339|consen  134 MSENKRAGAAKECDDMCLEYDSDGNPIAP-DKRQIDPLPPIDHSEIDYEPFNKDFYEEHESIEGLTKMDVIDLRLTLNLR  212 (731)
T ss_pred             hhhcccchhhhhcccceeecCCCCCccCc-ccccCCCCCCcchhhccccccccccccChhhhhccccccchhhHhhhcce
Confidence            99988776666677777899999999987 66789999999999999999999999999999999999999999999999


Q ss_pred             eeCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCHHHHHhhhhhcCCCcEEEEcCCCChhHHHHHHHHHHHHHhcCCCC
Q psy17644        157 VSGADPPYPVSSFGHFGFDEVLMKALRKCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELE  236 (330)
Q Consensus       157 ~~g~~~p~p~~~f~~~~l~~~l~~~l~~~~~~~pt~iQ~~~i~~~~~g~d~i~~a~TGsGKT~a~llp~l~~i~~~~~~~  236 (330)
                      +.|..+|+|+++|.+++|+..|+.++++..|++|||+|++++|..++|||++.+|.||||||.||++|++.|++.++.+.
T Consensus       213 v~g~s~~rpvtsfeh~gfDkqLm~airk~Ey~kptpiq~qalptalsgrdvigIAktgSgktaAfi~pm~~himdq~eL~  292 (731)
T KOG0339|consen  213 VSGSSPPRPVTSFEHFGFDKQLMTAIRKSEYEKPTPIQCQALPTALSGRDVIGIAKTGSGKTAAFIWPMIVHIMDQPELK  292 (731)
T ss_pred             eccCCCCCCcchhhhcCchHHHHHHHhhhhcccCCcccccccccccccccchheeeccCcchhHHHHHHHHHhcchhhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCeEEEEcccHHHHHHHHHHHHHhccCCCceEEEEECCCchHHHHHHHhCCCeEEEEChHHHHHHHHcCCCCCCCcc
Q psy17644        237 PGDGPMGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGRIIDMVKMGATKLNRVT  316 (330)
Q Consensus       237 ~~~~~~vLil~Ptr~La~Qi~~~~~~l~~~~~~~~~~~~gg~~~~~~~~~l~~~~dIiV~TP~~L~~~l~~~~~~l~~i~  316 (330)
                      .+++|..|||||||+||.||+.++++|++.+|++++++|||.+.++|.+.|+.++.||||||+||++++..+..+++++.
T Consensus       293 ~g~gPi~vilvPTrela~Qi~~eaKkf~K~ygl~~v~~ygGgsk~eQ~k~Lk~g~EivVaTPgRlid~VkmKatn~~rvS  372 (731)
T KOG0339|consen  293 PGEGPIGVILVPTRELASQIFSEAKKFGKAYGLRVVAVYGGGSKWEQSKELKEGAEIVVATPGRLIDMVKMKATNLSRVS  372 (731)
T ss_pred             CCCCCeEEEEeccHHHHHHHHHHHHHhhhhccceEEEeecCCcHHHHHHhhhcCCeEEEechHHHHHHHHhhcccceeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeecccccCcCC
Q psy17644        317 FLVLDEADRMFDMG  330 (330)
Q Consensus       317 ~lVvDEad~lld~G  330 (330)
                      ||||||||+|++||
T Consensus       373 ~LV~DEadrmfdmG  386 (731)
T KOG0339|consen  373 YLVLDEADRMFDMG  386 (731)
T ss_pred             EEEEechhhhhccc
Confidence            99999999999998



>KOG0334|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>KOG3089|consensus Back     alignment and domain information
>PHA02535 P terminase ATPase subunit; Provisional Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK13876 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK13700 conjugal transfer protein TraD; Provisional Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1806|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family Back     alignment and domain information
>PRK13880 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>KOG1533|consensus Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>PRK06749 replicative DNA helicase; Provisional Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0780|consensus Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR02746 TraC-F-type type-IV secretion system protein TraC Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PF02302 PTS_IIB: PTS system, Lactose/Cellobiose specific IIB subunit; InterPro: IPR003501 The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 1e-53
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 4e-47
2db3_A 434 Structural Basis For Rna Unwinding By The Dead-Box 4e-35
2i4i_A 417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 4e-33
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 8e-33
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 6e-29
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 2e-28
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 9e-27
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 4e-26
1hv8_A 367 Crystal Structure Of A Dead Box Protein From The Hy 5e-24
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 1e-22
1s2m_A 400 Crystal Structure Of The Dead Box Protein Dhh1p Len 2e-22
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 3e-22
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 4e-22
2hyi_C 413 Structure Of The Human Exon Junction Complex With A 1e-21
2j0q_A 410 The Crystal Structure Of The Exon Junction Complex 1e-21
1xtk_A 390 Structure Of Decd To Dead Mutation Of Human Uap56 L 1e-21
2xb2_A 411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-21
2hxy_A 391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 1e-21
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 2e-21
2j0u_A 374 The Crystal Structure Of Eif4aiii-Barentsz Complex 3e-21
1xti_A 391 Structure Of Wildtype Human Uap56 Length = 391 3e-21
1xtj_A 386 Structure Of Human Uap56 In Complex With Adp Length 3e-21
2j0u_B 374 The Crystal Structure Of Eif4aiii-Barentsz Complex 4e-21
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 9e-21
3ly5_A262 Ddx18 Dead-Domain Length = 262 1e-20
2z0m_A 337 Crystal Structure Of Hypothetical Atp-Dependent Rna 3e-20
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 3e-20
3eiq_A 414 Crystal Structure Of Pdcd4-eif4a Length = 414 4e-20
2zu6_A 388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 5e-20
3i5x_A 563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 6e-20
3sqx_A 512 Structure Of Mss116p (Nte And C-Tail Double Deletio 8e-20
2vso_A 395 Crystal Structure Of A Translation Initiation Compl 1e-19
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 2e-19
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 3e-19
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 3e-19
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 5e-19
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 6e-19
1fuu_A 394 Yeast Initiation Factor 4a Length = 394 2e-18
3pey_A 395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 8e-18
3pew_A 395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 9e-18
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 1e-14
3fho_B 508 Structure Of S. Pombe Dbp5 Length = 508 8e-14
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 1e-13
3fmp_B 479 Crystal Structure Of The Nucleoporin Nup214 In Comp 1e-13
3g0h_A 424 Human Dead-box Rna Helicase Ddx19, In Complex With 1e-13
3ews_A 445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 1e-13
3fht_A 412 Crystal Structure Of Human Dbp5 In Complex With Amp 1e-13
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 1e-13
1wp9_A 494 Crystal Structure Of Pyrococcus Furiosus Hef Helica 9e-04
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure

Iteration: 1

Score = 206 bits (525), Expect = 1e-53, Method: Compositional matrix adjust. Identities = 103/205 (50%), Positives = 131/205 (63%) Query: 126 EVEKNFYQPHEDIARLTPQEAQELRAKSGITVSGADPPYPVSSFGHFGFDEVLMKALRKC 185 + EKNFYQ H D+AR T QE + R ITV G + P PV +F F +M + + Sbjct: 2 KFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQ 61 Query: 186 EYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELEPGDGPMGLI 245 +T PT IQAQ P ALSG D++GVA+TGSGKT +++ P +VHI Q LE GDGP+ L+ Sbjct: 62 NFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLV 121 Query: 246 LAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGRIIDMV 305 LAPTREL+QQ+ A + + L C YGG K Q + LE G EI + TPGR+ID + Sbjct: 122 LAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFL 181 Query: 306 KMGATKLNRVTFLVLDEADRMFDMG 330 + G T L R T+LVLDEADRM DMG Sbjct: 182 ECGKTNLRRTTYLVLDEADRMLDMG 206
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 1e-119
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-110
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 1e-102
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 1e-100
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 1e-100
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 3e-96
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 4e-64
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 5e-64
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 6e-63
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 1e-61
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 7e-61
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 6e-59
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 8e-59
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 9e-59
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-58
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-58
3bor_A237 Human initiation factor 4A-II; translation initiat 3e-58
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 5e-58
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 2e-57
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 6e-57
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 3e-56
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 6e-56
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 5e-55
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-54
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 5e-54
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-53
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 5e-52
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 5e-50
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 4e-49
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 6e-48
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 5e-47
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
3b6e_A216 Interferon-induced helicase C domain-containing P; 1e-12
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 7e-12
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 1e-10
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 8e-10
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 9e-10
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 9e-10
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 2e-09
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 8e-09
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 2e-08
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 7e-08
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 9e-07
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 1e-05
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 6e-05
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
 Score =  341 bits (877), Expect = e-119
 Identities = 93/192 (48%), Positives = 120/192 (62%)

Query: 139 ARLTPQEAQELRAKSGITVSGADPPYPVSSFGHFGFDEVLMKALRKCEYTSPTPIQAQAV 198
           +  T QE +  R    ITV G + P PV +F    F   +M  + +  +T PT IQAQ  
Sbjct: 1   SMRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGW 60

Query: 199 PAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELEPGDGPMGLILAPTRELSQQIYN 258
           P ALSG D++GVA+TGSGKT +++ P +VHI  Q  LE GDGP+ L+LAPTREL+QQ+  
Sbjct: 61  PVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQ 120

Query: 259 EAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGRIIDMVKMGATKLNRVTFL 318
            A  + +   L   C YGG  K  Q + LE G EI + TPGR+ID ++ G T L R T+L
Sbjct: 121 VAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYL 180

Query: 319 VLDEADRMFDMG 330
           VLDEADRM DMG
Sbjct: 181 VLDEADRMLDMG 192


>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query330
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 100.0
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 100.0
3bor_A237 Human initiation factor 4A-II; translation initiat 100.0
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.98
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.98
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.98
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.97
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.97
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.97
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.97
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.96
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.96
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.95
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.95
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.95
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.95
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.95
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.95
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.95
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.95
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 99.94
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.93
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 99.93
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.92
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.91
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.91
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.9
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.9
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.9
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.9
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.9
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.9
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.9
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.9
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.89
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.89
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.89
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.89
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.88
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.88
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.88
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.85
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.85
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.84
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.84
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.83
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.83
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.82
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.81
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.8
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.79
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.77
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.77
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.75
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.74
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.73
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.7
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.69
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.68
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.63
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.63
3h1t_A 590 Type I site-specific restriction-modification syst 99.63
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.62
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.59
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.58
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.56
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.54
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.49
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.45
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.35
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.34
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.31
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.3
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.87
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 98.26
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 98.24
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.13
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 98.09
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.03
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.92
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.53
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 97.37
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 97.3
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.04
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 96.49
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 96.38
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 96.19
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.12
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 96.08
2b8t_A 223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.72
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.71
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 95.65
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 95.55
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.46
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 95.17
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 95.04
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 94.86
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 94.79
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.76
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 94.69
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.44
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 94.44
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 94.37
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 94.11
2r6a_A 454 DNAB helicase, replicative helicase; replication, 94.09
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 93.44
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 93.35
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 93.28
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 93.26
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 93.18
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 93.16
2chg_A226 Replication factor C small subunit; DNA-binding pr 93.08
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 93.03
3hjh_A 483 Transcription-repair-coupling factor; MFD, mutatio 93.0
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 92.87
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 92.86
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 92.84
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 92.76
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 92.64
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 92.56
2z43_A324 DNA repair and recombination protein RADA; archaea 92.35
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 92.33
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 92.19
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 92.13
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 92.09
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 91.91
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 91.9
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 91.65
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 91.36
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 90.6
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 90.58
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 90.58
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 90.47
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 90.4
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 90.34
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 90.3
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 90.26
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 89.8
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 89.74
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 89.32
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 89.29
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 89.23
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 89.02
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 88.74
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 88.53
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 88.38
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 88.21
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 88.17
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 88.04
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 88.01
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 87.28
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 87.18
3co5_A143 Putative two-component system transcriptional RES 87.15
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 87.02
2qgz_A308 Helicase loader, putative primosome component; str 86.52
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 85.49
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 85.36
4a74_A231 DNA repair and recombination protein RADA; hydrola 85.23
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 85.21
3io5_A 333 Recombination and repair protein; storage dimer, i 85.06
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 85.03
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 84.86
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 84.81
2eyu_A 261 Twitching motility protein PILT; pilus retraction 84.59
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 84.5
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 84.14
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 84.09
1vma_A306 Cell division protein FTSY; TM0570, structural gen 83.2
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 83.18
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 83.15
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 82.85
3bos_A242 Putative DNA replication factor; P-loop containing 82.78
1yks_A 440 Genome polyprotein [contains: flavivirin protease 82.25
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 81.67
1xp8_A 366 RECA protein, recombinase A; recombination, radior 81.37
1u94_A 356 RECA protein, recombinase A; homologous recombinat 81.23
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 81.19
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 80.97
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 80.83
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 80.76
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 80.68
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 80.63
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 80.62
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 80.42
3u4q_B 1166 ATP-dependent helicase/deoxyribonuclease subunit; 80.3
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
Probab=100.00  E-value=4e-38  Score=282.20  Aligned_cols=190  Identities=49%  Similarity=0.768  Sum_probs=176.1

Q ss_pred             cCHHHHHHHHHHcCcEeeCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCHHHHHhhhhhcCCCcEEEEcCCCChhHHH
Q psy17644        141 LTPQEAQELRAKSGITVSGADPPYPVSSFGHFGFDEVLMKALRKCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGA  220 (330)
Q Consensus       141 ~~~~~~~~~r~~~~i~~~g~~~p~p~~~f~~~~l~~~l~~~l~~~~~~~pt~iQ~~~i~~~~~g~d~i~~a~TGsGKT~a  220 (330)
                      ++.+++..+|...++.+.|...|.|+.+|.+++|++.+++++.+.||..|+|+|.++|+.+++|+|++++++||||||++
T Consensus         3 ~~~~~~~~~~~~~~i~~~~~~~p~~~~~f~~~~l~~~l~~~l~~~g~~~~~~~Q~~~i~~~~~g~~~l~~apTGsGKT~~   82 (242)
T 3fe2_A            3 RTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLS   82 (242)
T ss_dssp             ---CHHHHHHHHHTEEEESSCCCCCCSSTTTTTCCHHHHHHHHTTTCCSCCHHHHHHHHHHHHTCCEEEEECTTSCHHHH
T ss_pred             CCHHHHHHHHhcCceEEeCCCCCCccCCHhhcCCCHHHHHHHHHCCCCCCCHHHHHHHHHHhCCCCEEEECCCcCHHHHH
Confidence            45667889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhcCCCCCCCCCeEEEEcccHHHHHHHHHHHHHhccCCCceEEEEECCCchHHHHHHHhCCCeEEEEChHH
Q psy17644        221 FIWPMLVHIMDQKELEPGDGPMGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGR  300 (330)
Q Consensus       221 ~llp~l~~i~~~~~~~~~~~~~vLil~Ptr~La~Qi~~~~~~l~~~~~~~~~~~~gg~~~~~~~~~l~~~~dIiV~TP~~  300 (330)
                      |++|++.++...+......++++|||+|||+||.|+++.+++++...++++.+++||.....+...+..+++|+|+||++
T Consensus        83 ~~l~~l~~l~~~~~~~~~~~~~~lil~Pt~~L~~Q~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~I~v~Tp~~  162 (242)
T 3fe2_A           83 YLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGR  162 (242)
T ss_dssp             HHHHHHHHHHTSCCCCTTCCCSEEEECSSHHHHHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHH
T ss_pred             HHHHHHHHHHhccccccCCCCEEEEEeCcHHHHHHHHHHHHHHHhhcCceEEEEECCCChHHHHHHhcCCCCEEEECHHH
Confidence            99999999987654444568999999999999999999999999888999999999999988888888889999999999


Q ss_pred             HHHHHHcCCCCCCCccEEEeecccccCcCC
Q psy17644        301 IIDMVKMGATKLNRVTFLVLDEADRMFDMG  330 (330)
Q Consensus       301 L~~~l~~~~~~l~~i~~lVvDEad~lld~G  330 (330)
                      |.+++.++...++++.+|||||||+|+++|
T Consensus       163 l~~~l~~~~~~~~~~~~lViDEah~l~~~~  192 (242)
T 3fe2_A          163 LIDFLECGKTNLRRTTYLVLDEADRMLDMG  192 (242)
T ss_dssp             HHHHHHHTSCCCTTCCEEEETTHHHHHHTT
T ss_pred             HHHHHHcCCCCcccccEEEEeCHHHHhhhC
Confidence            999999888889999999999999999876



>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 330
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 1e-41
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 2e-35
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 4e-34
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-32
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 2e-32
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 8e-30
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 4e-28
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 1e-26
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 2e-26
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 2e-24
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 1e-21
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 3e-20
d2bmfa2 305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-17
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 3e-12
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 0.001
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
 Score =  141 bits (357), Expect = 1e-41
 Identities = 60/164 (36%), Positives = 92/164 (56%), Gaps = 8/164 (4%)

Query: 168 SFGHFGFDEVLMKALRKCEYTSPTPIQAQAVPAALSGR-DIIGVAKTGSGKTGAFIWPML 226
           +F      + ++ A+R   +  PT IQ + +P  L+   +I+  A+TGSGKT +F  P++
Sbjct: 5   NFNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAIPLI 64

Query: 227 VHIMDQKELEPGDGPMGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKA 286
             + +       +G   +IL PTREL+ Q+ +E +      NL +   YGG + + Q KA
Sbjct: 65  ELVNEN------NGIEAIILTPTRELAIQVADEIESLKGNKNLKIAKIYGGKAIYPQIKA 118

Query: 287 LELGAEIVVGTPGRIIDMVKMGATKLNRVTFLVLDEADRMFDMG 330
           L+  A IVVGTPGRI+D +  G   L  V + +LDEAD M +MG
Sbjct: 119 LK-NANIVVGTPGRILDHINRGTLNLKNVKYFILDEADEMLNMG 161


>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query330
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.97
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.93
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.91
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.9
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.87
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.72
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.68
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.66
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.61
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.61
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.5
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.44
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.12
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.95
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.86
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.81
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.78
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.75
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 97.37
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 96.76
d2qy9a2211 GTPase domain of the signal recognition particle r 96.38
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 96.3
d1vmaa2213 GTPase domain of the signal recognition particle r 95.93
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 95.58
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.55
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 95.36
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 95.24
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 95.11
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.02
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 95.01
d1okkd2207 GTPase domain of the signal recognition particle r 94.93
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 94.82
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 94.46
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.3
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.3
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 93.96
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 93.93
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 93.64
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.62
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 93.4
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 92.99
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.37
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 92.13
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 92.12
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 91.8
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 91.7
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 91.07
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 91.06
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 90.12
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 89.37
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 89.19
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 87.86
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 87.72
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 87.51
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 87.35
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.3
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 86.63
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 86.45
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 85.67
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 85.18
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 84.19
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 83.66
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 83.54
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 83.44
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 83.36
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 83.36
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 83.18
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 82.71
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 82.56
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 81.67
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 81.31
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 80.83
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 80.67
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 80.64
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 80.55
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 80.29
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 80.13
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.1e-39  Score=286.95  Aligned_cols=165  Identities=33%  Similarity=0.573  Sum_probs=154.7

Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCHHHHHhhhhhcCCCcEEEEcCCCChhHHHHHHHHHHHHHhcCCCCCCCC
Q psy17644        161 DPPYPVSSFGHFGFDEVLMKALRKCEYTSPTPIQAQAVPAALSGRDIIGVAKTGSGKTGAFIWPMLVHIMDQKELEPGDG  240 (330)
Q Consensus       161 ~~p~p~~~f~~~~l~~~l~~~l~~~~~~~pt~iQ~~~i~~~~~g~d~i~~a~TGsGKT~a~llp~l~~i~~~~~~~~~~~  240 (330)
                      .-.....+|++++|++.|+++|.++||..|||+|+++||.+++|+|++++|+||||||+||++|+++++....     ..
T Consensus        11 ~~~~~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~-----~~   85 (222)
T d2j0sa1          11 EEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQV-----RE   85 (222)
T ss_dssp             TTCCCCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTS-----CS
T ss_pred             CCCCCCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhcccccccccccc-----cC
Confidence            3345566899999999999999999999999999999999999999999999999999999999999876542     57


Q ss_pred             CeEEEEcccHHHHHHHHHHHHHhccCCCceEEEEECCCchHHHHHHHhCCCeEEEEChHHHHHHHHcCCCCCCCccEEEe
Q psy17644        241 PMGLILAPTRELSQQIYNEAKRFGKGYNLSVVCCYGGGSKWDQSKALELGAEIVVGTPGRIIDMVKMGATKLNRVTFLVL  320 (330)
Q Consensus       241 ~~vLil~Ptr~La~Qi~~~~~~l~~~~~~~~~~~~gg~~~~~~~~~l~~~~dIiV~TP~~L~~~l~~~~~~l~~i~~lVv  320 (330)
                      +++||++|||+||.|+++.++++++..++++.+++||.....+...++.+++||||||++|.+++.++...++++++||+
T Consensus        86 ~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~~~~~~~l~~lVl  165 (222)
T d2j0sa1          86 TQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVL  165 (222)
T ss_dssp             CCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTTSSCCTTCCEEEE
T ss_pred             ceeEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcccccccccccceeeee
Confidence            89999999999999999999999999999999999999999998889999999999999999999999999999999999


Q ss_pred             ecccccCcCC
Q psy17644        321 DEADRMFDMG  330 (330)
Q Consensus       321 DEad~lld~G  330 (330)
                      ||||+|+++|
T Consensus       166 DEaD~ll~~~  175 (222)
T d2j0sa1         166 DEADEMLNKG  175 (222)
T ss_dssp             ETHHHHTSTT
T ss_pred             cchhHhhhcC
Confidence            9999999987



>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure