Psyllid ID: psy17723
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 145 | ||||||
| 340719315 | 2857 | PREDICTED: hypothetical protein LOC10064 | 0.586 | 0.029 | 0.505 | 4e-24 | |
| 380029720 | 3312 | PREDICTED: uncharacterized protein LOC10 | 0.586 | 0.025 | 0.505 | 6e-24 | |
| 328785896 | 2891 | PREDICTED: hypothetical protein LOC72568 | 0.586 | 0.029 | 0.505 | 7e-24 | |
| 350400841 | 2805 | PREDICTED: hypothetical protein LOC10074 | 0.586 | 0.030 | 0.505 | 7e-24 | |
| 383863051 | 3343 | PREDICTED: uncharacterized protein LOC10 | 0.586 | 0.025 | 0.505 | 1e-23 | |
| 328716148 | 1397 | PREDICTED: hypothetical protein LOC10016 | 0.524 | 0.054 | 0.565 | 3e-23 | |
| 328716144 | 1495 | PREDICTED: hypothetical protein LOC10016 | 0.524 | 0.050 | 0.565 | 3e-23 | |
| 328716146 | 1426 | PREDICTED: hypothetical protein LOC10016 | 0.524 | 0.053 | 0.565 | 4e-23 | |
| 332019339 | 1472 | PHD finger protein 10 [Acromyrmex echina | 0.496 | 0.048 | 0.583 | 6e-23 | |
| 307177781 | 3066 | Supporter of activation of yellow protei | 0.586 | 0.027 | 0.505 | 8e-23 |
| >gi|340719315|ref|XP_003398100.1| PREDICTED: hypothetical protein LOC100644567 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Score = 115 bits (289), Expect = 4e-24, Method: Composition-based stats.
Identities = 45/89 (50%), Positives = 64/89 (71%), Gaps = 4/89 (4%)
Query: 39 KCKAC----DRDTSAGEMIQCGKCVRYLHPACLDLPGEMLPHMKLYDWQCSDCKSCVACE 94
KCK C ++ + +IQCG C ++HP+C+DL +M+PH++ Y WQC+DCK+C C
Sbjct: 2696 KCKMCLKTLNKHSKNEVLIQCGTCNGHVHPSCIDLTLDMVPHIQSYAWQCTDCKTCAQCH 2755
Query: 95 KAQDDDKMLFCDLCDRGYHNYCIGLDKIP 123
D+DKMLFCD+CDRGYH YC+GL ++P
Sbjct: 2756 DPADEDKMLFCDMCDRGYHIYCVGLRRVP 2784
|
Source: Bombus terrestris Species: Bombus terrestris Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|380029720|ref|XP_003698514.1| PREDICTED: uncharacterized protein LOC100870597 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328785896|ref|XP_003250672.1| PREDICTED: hypothetical protein LOC725681 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350400841|ref|XP_003485981.1| PREDICTED: hypothetical protein LOC100740971 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383863051|ref|XP_003706996.1| PREDICTED: uncharacterized protein LOC100875915 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328716148|ref|XP_003245848.1| PREDICTED: hypothetical protein LOC100162709 isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328716144|ref|XP_001947369.2| PREDICTED: hypothetical protein LOC100162709 isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328716146|ref|XP_003245847.1| PREDICTED: hypothetical protein LOC100162709 isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|332019339|gb|EGI59845.1| PHD finger protein 10 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307177781|gb|EFN66778.1| Supporter of activation of yellow protein [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 145 | ||||||
| WB|WBGene00018013 | 447 | phf-10 [Caenorhabditis elegans | 0.613 | 0.199 | 0.428 | 1.3e-21 | |
| UNIPROTKB|E1C454 | 410 | LOC100857350 "Uncharacterized | 0.593 | 0.209 | 0.430 | 1.1e-20 | |
| ZFIN|ZDB-GENE-040426-1573 | 490 | phf10 "PHD finger protein 10" | 0.675 | 0.2 | 0.364 | 3.8e-20 | |
| UNIPROTKB|Q8WUB8 | 498 | PHF10 "PHD finger protein 10" | 0.593 | 0.172 | 0.418 | 8.5e-20 | |
| UNIPROTKB|Q2T9V9 | 410 | PHF10 "PHD finger protein 10" | 0.593 | 0.209 | 0.418 | 9e-20 | |
| UNIPROTKB|F1PR25 | 497 | PHF10 "Uncharacterized protein | 0.593 | 0.173 | 0.418 | 1.4e-19 | |
| MGI|MGI:1919307 | 497 | Phf10 "PHD finger protein 10" | 0.593 | 0.173 | 0.418 | 1.4e-19 | |
| RGD|1305266 | 497 | Phf10 "PHD finger protein 10" | 0.593 | 0.173 | 0.418 | 1.4e-19 | |
| ZFIN|ZDB-GENE-041014-190 | 391 | dpf3 "D4, zinc and double PHD | 0.613 | 0.227 | 0.415 | 2.7e-18 | |
| FB|FBgn0087008 | 2006 | e(y)3 "enhancer of yellow 3" [ | 0.489 | 0.035 | 0.464 | 1.2e-17 |
| WB|WBGene00018013 phf-10 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 257 (95.5 bits), Expect = 1.3e-21, P = 1.3e-21
Identities = 39/91 (42%), Positives = 58/91 (63%)
Query: 33 PVPESDKCKACDRDTSAGEMIQCGKCVRYLHPACLDLPGEMLPHMKLYDWQCSDCKSCVA 92
P+ S C +C++ + GEMI C C HP C+++P M +K Y+W C DC+ C
Sbjct: 328 PIDPSRPCDSCEK--TGGEMICCATCKIAYHPQCIEMPERMAALVKTYEWSCVDCRLCSI 385
Query: 93 CEKAQDDDKMLFCDLCDRGYHNYCIGLDKIP 123
C K + +D+++FCD CDRG+H YC+GL K+P
Sbjct: 386 CNKPEKEDEIVFCDRCDRGFHTYCVGLKKLP 416
|
|
| UNIPROTKB|E1C454 LOC100857350 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1573 phf10 "PHD finger protein 10" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WUB8 PHF10 "PHD finger protein 10" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2T9V9 PHF10 "PHD finger protein 10" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PR25 PHF10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919307 Phf10 "PHD finger protein 10" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1305266 Phf10 "PHD finger protein 10" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041014-190 dpf3 "D4, zinc and double PHD fingers, family 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0087008 e(y)3 "enhancer of yellow 3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 145 | |||
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 2e-06 | |
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 1e-04 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 2e-04 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 0.001 |
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
Score = 42.5 bits (100), Expect = 2e-06
Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 1/51 (1%)
Query: 40 CKACDRDTSAGEMIQCGKCVRYLHPACLDLPGEMLPHMKLYDWQCSDCKSC 90
C C + GE++ C C R+ H ACL P E + +W C +CK
Sbjct: 2 CAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPE-GEWYCPECKPK 51
|
PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51 |
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 145 | |||
| KOG1244|consensus | 336 | 99.87 | ||
| KOG1512|consensus | 381 | 99.82 | ||
| KOG4443|consensus | 694 | 99.5 | ||
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 99.12 | |
| KOG4299|consensus | 613 | 99.07 | ||
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 98.93 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 98.93 | |
| KOG1973|consensus | 274 | 98.92 | ||
| KOG4299|consensus | 613 | 98.88 | ||
| KOG0825|consensus | 1134 | 98.83 | ||
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 98.69 | |
| KOG0957|consensus | 707 | 98.68 | ||
| KOG0383|consensus | 696 | 98.62 | ||
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 98.61 | |
| KOG0954|consensus | 893 | 98.58 | ||
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 98.52 | |
| KOG4323|consensus | 464 | 98.51 | ||
| KOG1244|consensus | 336 | 98.48 | ||
| KOG0956|consensus | 900 | 98.46 | ||
| KOG0955|consensus | 1051 | 98.44 | ||
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 98.31 | |
| KOG1473|consensus | 1414 | 98.19 | ||
| KOG0825|consensus | 1134 | 98.13 | ||
| KOG4443|consensus | 694 | 98.09 | ||
| KOG1245|consensus | 1404 | 98.07 | ||
| KOG1973|consensus | 274 | 97.97 | ||
| KOG0957|consensus | 707 | 97.93 | ||
| KOG0955|consensus | 1051 | 97.83 | ||
| KOG0383|consensus | 696 | 97.82 | ||
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 97.8 | |
| KOG1512|consensus | 381 | 97.78 | ||
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 97.67 | |
| KOG0954|consensus | 893 | 97.6 | ||
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 97.25 | |
| KOG0956|consensus | 900 | 97.24 | ||
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 97.07 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 96.98 | |
| KOG4323|consensus | 464 | 96.86 | ||
| KOG1245|consensus | 1404 | 96.36 | ||
| PF13832 | 110 | zf-HC5HC2H_2: PHD-zinc-finger like domain | 95.87 | |
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 95.56 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 94.17 | |
| PF13901 | 202 | DUF4206: Domain of unknown function (DUF4206) | 93.97 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 93.74 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 93.66 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 93.27 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 93.11 | |
| KOG0804|consensus | 493 | 91.49 | ||
| PF07227 | 446 | DUF1423: Protein of unknown function (DUF1423); In | 91.47 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 91.1 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 90.93 | |
| PF07649 | 30 | C1_3: C1-like domain; InterPro: IPR011424 This sho | 90.7 | |
| PF13771 | 90 | zf-HC5HC2H: PHD-like zinc-binding domain | 90.66 | |
| KOG1829|consensus | 580 | 90.34 | ||
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 90.23 | |
| PF13832 | 110 | zf-HC5HC2H_2: PHD-zinc-finger like domain | 89.69 | |
| KOG4628|consensus | 348 | 89.11 | ||
| KOG2752|consensus | 345 | 88.77 | ||
| KOG1246|consensus | 904 | 87.12 | ||
| KOG1473|consensus | 1414 | 86.01 | ||
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 85.44 | |
| KOG1952|consensus | 950 | 85.41 | ||
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 84.68 | |
| KOG1701|consensus | 468 | 83.74 | ||
| PF00130 | 53 | C1_1: Phorbol esters/diacylglycerol binding domain | 80.35 | |
| KOG1734|consensus | 328 | 80.06 |
| >KOG1244|consensus | Back alignment and domain information |
|---|
Probab=99.87 E-value=8.2e-24 Score=165.09 Aligned_cols=106 Identities=37% Similarity=0.853 Sum_probs=95.9
Q ss_pred CccccccccccccC-------CCCCcEecCCCCCCccccCCCCCCCCCCcCCCCcccccccccCccccccccCCCceecC
Q psy17723 34 VPESDKCKACDRDT-------SAGEMIQCGKCVRYLHPACLDLPGEMLPHMKLYDWQCSDCKSCVACEKAQDDDKMLFCD 106 (145)
Q Consensus 34 ~~~~~~C~~C~~~~-------~~~~ll~C~~C~~~~H~~Cl~~~~~~~~~~~~~~W~C~~C~~C~vC~~~~~~~~ll~Cd 106 (145)
+.+...|..|.+.. .+++||.|..|+++-|++||+...+|+..++.+.|+|.+|++|.+||.+.+++.|||||
T Consensus 221 a~Pn~YCDFclgdsr~nkkt~~peelvscsdcgrsghpsclqft~nm~~avk~yrwqcieck~csicgtsenddqllfcd 300 (336)
T KOG1244|consen 221 AQPNPYCDFCLGDSRENKKTGMPEELVSCSDCGRSGHPSCLQFTANMIAAVKTYRWQCIECKYCSICGTSENDDQLLFCD 300 (336)
T ss_pred ccCCcccceeccccccccccCCchhhcchhhcCCCCCcchhhhhHHHHHHHHhheeeeeecceeccccCcCCCceeEeec
Confidence 45678999997654 34999999999999999999999888888899999999999999999999999999999
Q ss_pred Cccccccccccc--CCCCCCCCccccccccchhhh
Q psy17723 107 LCDRGYHNYCIG--LDKIPTVGLVFTLKKKKNKKK 139 (145)
Q Consensus 107 ~C~~~yH~~Cl~--l~~~p~~~W~C~~C~~~~~~~ 139 (145)
.||++||+|||. +.+.|+|.|-|..|..+-+++
T Consensus 301 dcdrgyhmyclsppm~eppegswsc~KOG~~~~e~ 335 (336)
T KOG1244|consen 301 DCDRGYHMYCLSPPMVEPPEGSWSCHLCLEELKEK 335 (336)
T ss_pred ccCCceeeEecCCCcCCCCCCchhHHHHHHHHhhc
Confidence 999999999997 888999999999999876654
|
|
| >KOG1512|consensus | Back alignment and domain information |
|---|
| >KOG4443|consensus | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4299|consensus | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG1973|consensus | Back alignment and domain information |
|---|
| >KOG4299|consensus | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG0957|consensus | Back alignment and domain information |
|---|
| >KOG0383|consensus | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
| >KOG0954|consensus | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4323|consensus | Back alignment and domain information |
|---|
| >KOG1244|consensus | Back alignment and domain information |
|---|
| >KOG0956|consensus | Back alignment and domain information |
|---|
| >KOG0955|consensus | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1473|consensus | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG4443|consensus | Back alignment and domain information |
|---|
| >KOG1245|consensus | Back alignment and domain information |
|---|
| >KOG1973|consensus | Back alignment and domain information |
|---|
| >KOG0957|consensus | Back alignment and domain information |
|---|
| >KOG0955|consensus | Back alignment and domain information |
|---|
| >KOG0383|consensus | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1512|consensus | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >KOG0954|consensus | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0956|consensus | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >KOG4323|consensus | Back alignment and domain information |
|---|
| >KOG1245|consensus | Back alignment and domain information |
|---|
| >PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PF13901 DUF4206: Domain of unknown function (DUF4206) | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines | Back alignment and domain information |
|---|
| >PF13771 zf-HC5HC2H: PHD-like zinc-binding domain | Back alignment and domain information |
|---|
| >KOG1829|consensus | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >KOG2752|consensus | Back alignment and domain information |
|---|
| >KOG1246|consensus | Back alignment and domain information |
|---|
| >KOG1473|consensus | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1952|consensus | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger | Back alignment and domain information |
|---|
| >KOG1734|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 145 | ||||
| 2kwj_A | 114 | Solution Structures Of The Double Phd Fingers Of Hu | 1e-15 | ||
| 2ln0_A | 110 | Structure Of Moz Length = 110 | 7e-12 | ||
| 3v43_A | 112 | Crystal Structure Of Moz Length = 112 | 7e-12 | ||
| 2ysm_A | 111 | Solution Structure Of The First And Second Phd Doma | 4e-11 |
| >pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 | Back alignment and structure |
|
| >pdb|2LN0|A Chain A, Structure Of Moz Length = 110 | Back alignment and structure |
| >pdb|3V43|A Chain A, Crystal Structure Of Moz Length = 112 | Back alignment and structure |
| >pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 145 | |||
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 5e-17 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 3e-05 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 4e-05 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 1e-16 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 1e-15 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 8e-13 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 3e-11 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 4e-09 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 1e-08 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 6e-08 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 7e-07 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 3e-06 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 6e-06 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 3e-05 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 4e-04 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 9e-05 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 2e-04 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 3e-04 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 4e-04 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 6e-04 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 6e-04 |
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
Score = 70.8 bits (173), Expect = 5e-17
Identities = 29/84 (34%), Positives = 41/84 (48%), Gaps = 3/84 (3%)
Query: 35 PESDKCKACDRDTSAGEMIQCGKCVRYLHPACLDLPGEMLPHMKLYDWQCSDCKSCVACE 94
C CD + C C ++ H CLD+ L WQC +CK C C+
Sbjct: 5 SSGANCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKR---AGWQCPECKVCQNCK 61
Query: 95 KAQDDDKMLFCDLCDRGYHNYCIG 118
++ +D KML CD CD+GYH +C+
Sbjct: 62 QSGEDSKMLVCDTCDKGYHTFCLQ 85
|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 145 | |||
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.95 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 99.94 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 99.94 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 99.71 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.68 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 99.65 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 99.63 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 99.58 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 99.53 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 99.49 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 99.47 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 99.46 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 99.45 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.44 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 99.43 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 99.41 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 99.4 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 99.4 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 99.39 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 99.38 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 99.38 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 99.38 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 99.37 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 99.36 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 99.36 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 99.31 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 99.28 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 99.26 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 99.26 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 99.25 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 99.25 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 99.24 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 99.21 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 99.2 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 99.19 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 99.19 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 99.19 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 99.19 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 99.16 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 99.16 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 99.13 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.1 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.09 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 99.08 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.07 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 99.07 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 99.07 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.06 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 99.05 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 99.04 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 99.02 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.0 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 98.99 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 98.97 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 98.94 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 98.93 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 98.93 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 98.92 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 98.92 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 98.92 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 98.88 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 98.88 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 98.87 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 98.86 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 98.86 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 98.85 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 98.84 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.84 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 98.84 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 98.81 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 98.8 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 98.76 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 98.74 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 98.69 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 98.67 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 98.61 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 98.49 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 98.49 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 98.47 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 98.46 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 98.44 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 98.44 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 98.41 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 98.39 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 98.37 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 98.27 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 98.22 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 98.2 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 98.17 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 98.17 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 98.14 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 98.14 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 98.14 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 98.07 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 98.07 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 98.04 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 98.03 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 97.99 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 97.95 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 97.87 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 97.8 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 97.79 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 97.54 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 97.42 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 97.01 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 96.84 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 96.78 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 96.58 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 96.26 | |
| 3rsn_A | 177 | SET1/ASH2 histone methyltransferase complex subun; | 96.21 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 95.61 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 95.58 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 95.28 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 95.28 | |
| 3rsn_A | 177 | SET1/ASH2 histone methyltransferase complex subun; | 95.22 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 94.91 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 94.47 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 94.32 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 94.13 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 93.85 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 93.75 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 93.55 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 93.39 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 93.06 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 92.9 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 92.89 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 92.79 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 92.35 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 92.01 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 91.83 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 91.54 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 91.23 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 91.1 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 90.96 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 90.88 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 90.81 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 90.8 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 90.63 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 90.6 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 90.51 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 90.13 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 90.13 | |
| 1weq_A | 85 | PHD finger protein 7; structural genomics, PHD dom | 89.97 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 89.77 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 89.77 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 89.51 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 89.13 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 88.91 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 88.86 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 88.55 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 88.14 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 87.96 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 87.8 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 87.64 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 87.15 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 86.83 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 85.76 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 85.36 | |
| 2lq6_A | 87 | Bromodomain-containing protein 1; PHD finger, meta | 84.13 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 83.93 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 83.18 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 83.13 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 83.0 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 81.69 | |
| 2lq6_A | 87 | Bromodomain-containing protein 1; PHD finger, meta | 81.13 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 81.0 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 80.83 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 80.73 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 80.48 |
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.95 E-value=4.9e-28 Score=167.86 Aligned_cols=99 Identities=32% Similarity=0.780 Sum_probs=89.8
Q ss_pred ccccccccccccCCCCCcEecCCCCCCccccCCCCCCCCCCcCCCCcccccccccCccccccccCCCceecCCccccccc
Q psy17723 35 PESDKCKACDRDTSAGEMIQCGKCVRYLHPACLDLPGEMLPHMKLYDWQCSDCKSCVACEKAQDDDKMLFCDLCDRGYHN 114 (145)
Q Consensus 35 ~~~~~C~~C~~~~~~~~ll~C~~C~~~~H~~Cl~~~~~~~~~~~~~~W~C~~C~~C~vC~~~~~~~~ll~Cd~C~~~yH~ 114 (145)
.++++|.+|++.|+.++||.|+.|+++||+.||+++... ++.+.|+|++|++|.+|++.+++..||+||.|+++||+
T Consensus 5 ~~~~~C~~C~~~g~~~~ll~C~~C~~~~H~~Cl~~~~~~---~~~~~W~C~~C~~C~~C~~~~~~~~ll~Cd~C~~~yH~ 81 (111)
T 2ysm_A 5 SSGANCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTP---LKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHT 81 (111)
T ss_dssp CCCSCBTTTCCCCCTTTSEECSSSCCEECTTTTTCCCCT---TTSTTCCCTTTCCCTTTCCCSCCTTEEECSSSCCEEEG
T ss_pred CCCCCCcCCCCCCCCcCCeECCCCCCCcChHHhCCcccc---ccccCccCCcCCcccccCccCCCCCeeECCCCCcHHhH
Confidence 478999999999987888999999999999999997643 34679999999999999998888899999999999999
Q ss_pred cccc--CCCCCCCCccccccccch
Q psy17723 115 YCIG--LDKIPTVGLVFTLKKKKN 136 (145)
Q Consensus 115 ~Cl~--l~~~p~~~W~C~~C~~~~ 136 (145)
+||+ |..+|++.|+|+.|...+
T Consensus 82 ~Cl~ppl~~~P~g~W~C~~C~~c~ 105 (111)
T 2ysm_A 82 FCLQPVMKSVPTNGWKCKNCRICI 105 (111)
T ss_dssp GGSSSCCSSCCSSCCCCHHHHCCS
T ss_pred HhcCCccccCCCCCcCCcCCcCcC
Confidence 9998 889999999999997654
|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1weq_A PHD finger protein 7; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 145 | ||||
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 3e-05 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 0.002 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 6e-05 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 0.003 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 8e-05 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 0.001 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 3e-04 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 0.001 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 3e-04 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 0.002 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 0.002 |
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Nuclear corepressor KAP-1 (TIF-1beta) species: Human (Homo sapiens) [TaxId: 9606]
Score = 38.1 bits (88), Expect = 3e-05
Identities = 13/64 (20%), Positives = 23/64 (35%), Gaps = 3/64 (4%)
Query: 38 DKCKACDRDTSAGEMIQCGKCVRYLHPACLDLPGEMLPHMKLYDWQCSDCKSCVACEKAQ 97
D C G+++ C +C H C + +P +W CS C ++
Sbjct: 5 DSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPG---EEWSCSLCHVLPDLKEED 61
Query: 98 DDDK 101
D +
Sbjct: 62 VDLQ 65
|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 145 | |||
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 99.46 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 99.35 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 99.34 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 99.24 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 99.23 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 99.21 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 99.16 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 99.12 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 99.12 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 98.9 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 98.9 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 98.87 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 98.84 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.76 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 98.74 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 98.66 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 98.39 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 98.37 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 98.33 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 98.31 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 98.17 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 98.15 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 96.58 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 96.42 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 95.66 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 95.36 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 94.84 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 94.13 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 91.97 | |
| d1weqa_ | 85 | PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculu | 91.44 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 91.33 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 91.32 | |
| d1zbdb_ | 124 | Effector domain of rabphilin-3a {Rat (Rattus norve | 88.27 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 88.04 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 88.02 | |
| d2ak3a2 | 37 | Microbial and mitochondrial ADK, insert "zinc fing | 86.94 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 86.63 | |
| d1s3ga2 | 35 | Microbial and mitochondrial ADK, insert "zinc fing | 85.37 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 84.68 | |
| d1e4va2 | 35 | Microbial and mitochondrial ADK, insert "zinc fing | 83.51 | |
| d6rxna_ | 45 | Rubredoxin {Desulfovibrio desulfuricans, strain 27 | 83.26 | |
| d1zina2 | 35 | Microbial and mitochondrial ADK, insert "zinc fing | 81.78 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 81.53 |
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Williams-Beuren syndrome transcription factor, WSTF species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.46 E-value=9.1e-15 Score=86.21 Aligned_cols=46 Identities=28% Similarity=0.769 Sum_probs=42.1
Q ss_pred cCccccccccCCCceecCCccccccccccc--CCCCCCCCcccccccc
Q psy17723 89 SCVACEKAQDDDKMLFCDLCDRGYHNYCIG--LDKIPTVGLVFTLKKK 134 (145)
Q Consensus 89 ~C~vC~~~~~~~~ll~Cd~C~~~yH~~Cl~--l~~~p~~~W~C~~C~~ 134 (145)
.|.+|+..++++.||+||.|+++||++|++ +..+|++.|+|+.|+.
T Consensus 2 ~C~vC~~~~~~~~~i~Cd~C~~~~H~~C~~p~~~~~p~~~W~C~~C~~ 49 (51)
T d1f62a_ 2 RCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQP 49 (51)
T ss_dssp CCTTTCCSSCCSCCEECTTTCCEECHHHHCTTCCSCCSSCCSCTTTSC
T ss_pred CCcCcCCCCCCCCEEEcCCCCCCCCCCCCCCCCCcCCCCCEECcCCcC
Confidence 588999888889999999999999999997 6788999999999975
|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weqa_ g.50.1.2 (A:) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|