Psyllid ID: psy17757


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQGVNLAGSDLSRLDLRNINFKVRKGLTLPACSVNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDLSGSDLHEANLRGANLKDAALELMLTPLHMSQTVR
cHHHHHcccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccc
cHHHHHcccccccccccccccccccEEEEEcccHHHHHHHHHHHcccEEccccccHHHHHHHHHHHcccccHHccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccc
MLAKMFaegseggyfmnpgdvdstgaylidrsptyfepILNYLrngqlvldpninpegvleearFFGIESLVPQLMEIIMSRersrdmmplsRRDVINALILTPITAELRFQgvnlagsdlsrldlrninfkvrkgltlpacsvnlkganlegsnmaGVNLRVATLknanlqncDLRAAVLAGadlencdlsgsdlHEANLRGANLKDAALELMLtplhmsqtvr
MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQGVNLagsdlsrldlRNINFKVRKGLTLPACSVNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDLSGSDLHEANLRGANLKDAALELMltplhmsqtvr
MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQGVNLAGSDLSRLDLRNINFKVRKGLTLPACSVNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDLSGSDLHEANLRGANLKDAALELMLTPLHMSQTVR
*************YFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESLVPQLMEIIMS*********LSRRDVINALILTPITAELRFQGVNLAGSDLSRLDLRNINFKVRKGLTLPACSVNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDLSGSDLHEANLRGANLKDAALELML**********
MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQGVNLAGSDLSRLDLRNINFKVRKGLTLPACSVNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDLSGSDLHEANLRGANLKDAALELMLTPLHMSQTVR
MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQGVNLAGSDLSRLDLRNINFKVRKGLTLPACSVNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDLSGSDLHEANLRGANLKDAALELMLTPLHMSQTVR
**************FMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQGVNLAGSDLSRLDLRNINFKVRKGLTLPACSVNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDLSGSDLHEANLRGANLKD*ALE*MLT*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQGVNLAGSDLSRLDLRNINFKVRKGLTLPACSVNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDLSGSDLHEANLRGANLKDAALELMLTPLHMSQTVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query225 2.2.26 [Sep-21-2011]
Q7L273389 BTB/POZ domain-containing yes N/A 0.977 0.565 0.478 5e-62
Q80UN1339 BTB/POZ domain-containing no N/A 0.977 0.648 0.552 2e-60
Q9SE95298 FH protein interacting pr yes N/A 0.915 0.691 0.334 2e-17
A5PKG7234 BTB/POZ domain-containing no N/A 0.32 0.307 0.527 7e-16
B5DEL1234 BTB/POZ domain-containing no N/A 0.32 0.307 0.527 1e-15
Q9NXV2234 BTB/POZ domain-containing no N/A 0.32 0.307 0.513 2e-15
Q8VC57234 BTB/POZ domain-containing no N/A 0.328 0.316 0.513 2e-15
Q14681263 BTB/POZ domain-containing no N/A 0.324 0.277 0.534 2e-14
Q8N5Z5321 BTB/POZ domain-containing no N/A 0.284 0.199 0.573 8e-14
Q8CEZ0266 BTB/POZ domain-containing no N/A 0.324 0.274 0.534 1e-09
>sp|Q7L273|KCTD9_HUMAN BTB/POZ domain-containing protein KCTD9 OS=Homo sapiens GN=KCTD9 PE=2 SV=1 Back     alignment and function desciption
 Score =  237 bits (604), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 134/280 (47%), Positives = 165/280 (58%), Gaps = 60/280 (21%)

Query: 1   MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVL 60
           MLA MF +    G        D  GA+LIDRSP YFEPILNYLR+GQL+++  IN  GVL
Sbjct: 115 MLAHMFKDKGVWG-----NKQDHRGAFLIDRSPEYFEPILNYLRHGQLIVNDGINLLGVL 169

Query: 61  EEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQGVNLAGSD 120
           EEARFFGI+SL+  L   I + +   D  P+SR++ +  L+ TP  +ELR QG+N +G+D
Sbjct: 170 EEARFFGIDSLIEHLEVAIKNSQPPEDHSPISRKEFVRFLLATPTKSELRCQGLNFSGAD 229

Query: 121 LSRLDLRNINFKV------------------------------------------RKGLT 138
           LSRLDLR INFK+                                           +G +
Sbjct: 230 LSRLDLRYINFKMANLSRCNLAHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGAS 289

Query: 139 LPACS-------------VNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGAD 185
           L  C+              NLKG ++EGS M G+NLRVATLKNA L+NC+LR A LAG D
Sbjct: 290 LKLCNFEDPSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTD 349

Query: 186 LENCDLSGSDLHEANLRGANLKDAALELMLTPLHMSQTVR 225
           LENCDLSG DL EANLRG+N+K A  E MLTPLHMSQ+VR
Sbjct: 350 LENCDLSGCDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR 389





Homo sapiens (taxid: 9606)
>sp|Q80UN1|KCTD9_MOUSE BTB/POZ domain-containing protein KCTD9 OS=Mus musculus GN=Kctd9 PE=2 SV=1 Back     alignment and function description
>sp|Q9SE95|FIP2_ARATH FH protein interacting protein FIP2 OS=Arabidopsis thaliana GN=FIP2 PE=1 SV=1 Back     alignment and function description
>sp|A5PKG7|KCTD5_BOVIN BTB/POZ domain-containing protein KCTD5 OS=Bos taurus GN=KCTD5 PE=2 SV=1 Back     alignment and function description
>sp|B5DEL1|KCTD5_RAT BTB/POZ domain-containing protein KCTD5 OS=Rattus norvegicus GN=Kctd5 PE=2 SV=1 Back     alignment and function description
>sp|Q9NXV2|KCTD5_HUMAN BTB/POZ domain-containing protein KCTD5 OS=Homo sapiens GN=KCTD5 PE=1 SV=1 Back     alignment and function description
>sp|Q8VC57|KCTD5_MOUSE BTB/POZ domain-containing protein KCTD5 OS=Mus musculus GN=Kctd5 PE=2 SV=1 Back     alignment and function description
>sp|Q14681|KCTD2_HUMAN BTB/POZ domain-containing protein KCTD2 OS=Homo sapiens GN=KCTD2 PE=1 SV=3 Back     alignment and function description
>sp|Q8N5Z5|KCD17_HUMAN BTB/POZ domain-containing protein KCTD17 OS=Homo sapiens GN=KCTD17 PE=1 SV=3 Back     alignment and function description
>sp|Q8CEZ0|KCTD2_MOUSE BTB/POZ domain-containing protein KCTD2 OS=Mus musculus GN=Kctd2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
242018011 466 BTB/POZ domain-containing protein KCTD9, 0.995 0.480 0.625 8e-88
270013763 398 hypothetical protein TcasGA2_TC012406 [T 0.995 0.562 0.603 4e-84
189240901 391 PREDICTED: similar to potassium channel 0.995 0.572 0.603 5e-84
389609809280 similar to CG14647 [Papilio xuthus] 0.995 0.8 0.587 4e-79
357621197294 putative BTB/POZ domain-containing prote 0.995 0.761 0.583 2e-78
307213919 386 BTB/POZ domain-containing protein KCTD9 1.0 0.582 0.540 3e-73
156538483 391 PREDICTED: BTB/POZ domain-containing pro 1.0 0.575 0.548 1e-72
170038204 351 BTB/POZ domain-containing protein KCTD9 0.977 0.626 0.55 3e-72
321478158 381 hypothetical protein DAPPUDRAFT_191018 [ 0.995 0.587 0.542 4e-72
157113261 368 hypothetical protein AaeL_AAEL006374 [Ae 0.977 0.597 0.546 1e-71
>gi|242018011|ref|XP_002429477.1| BTB/POZ domain-containing protein KCTD9, putative [Pediculus humanus corporis] gi|212514409|gb|EEB16739.1| BTB/POZ domain-containing protein KCTD9, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  328 bits (842), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 175/280 (62%), Positives = 194/280 (69%), Gaps = 56/280 (20%)

Query: 1   MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVL 60
           MLA+MFA+  E GY M P D+D  GAYLIDRSPTYFEPILNYLRNGQL+ D N+NP G+L
Sbjct: 188 MLARMFAQ-DEDGYLMTPSDLDVNGAYLIDRSPTYFEPILNYLRNGQLIFDTNVNPAGIL 246

Query: 61  EEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQGVNLAGSD 120
           +EARFF IESLV  L  +I +++RS+D+ PL+RRDVINALI T  TA+LRFQGVNLAGSD
Sbjct: 247 QEARFFRIESLVEHLENLISTQQRSQDIAPLTRRDVINALITTSSTADLRFQGVNLAGSD 306

Query: 121 LSRLDLRNINFKVR------------------------------------------KGLT 138
           LSRLDLRNINFK                                            +G  
Sbjct: 307 LSRLDLRNINFKYACLHGCRMVGANLSFCCLERADLSHAVMESAQLMGVQMLCANLEGAN 366

Query: 139 LPACS-------------VNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGAD 185
           L  C+             VNLKGANLE SNMAGVNLRVATLKNANLQNCDLRAAVLAGAD
Sbjct: 367 LRGCNFQDPTGVRTNMEGVNLKGANLECSNMAGVNLRVATLKNANLQNCDLRAAVLAGAD 426

Query: 186 LENCDLSGSDLHEANLRGANLKDAALELMLTPLHMSQTVR 225
           LE CDLSGSDL EANLRGANLKDAA ELMLTP+HMSQT+R
Sbjct: 427 LEKCDLSGSDLQEANLRGANLKDAAFELMLTPIHMSQTIR 466




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270013763|gb|EFA10211.1| hypothetical protein TcasGA2_TC012406 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189240901|ref|XP_966398.2| PREDICTED: similar to potassium channel tetramerisation domain containing 9 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|389609809|dbj|BAM18516.1| similar to CG14647 [Papilio xuthus] Back     alignment and taxonomy information
>gi|357621197|gb|EHJ73113.1| putative BTB/POZ domain-containing protein KCTD9 [Danaus plexippus] Back     alignment and taxonomy information
>gi|307213919|gb|EFN89166.1| BTB/POZ domain-containing protein KCTD9 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|156538483|ref|XP_001606722.1| PREDICTED: BTB/POZ domain-containing protein KCTD9-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|170038204|ref|XP_001846942.1| BTB/POZ domain-containing protein KCTD9 [Culex quinquefasciatus] gi|167881755|gb|EDS45138.1| BTB/POZ domain-containing protein KCTD9 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|321478158|gb|EFX89116.1| hypothetical protein DAPPUDRAFT_191018 [Daphnia pulex] Back     alignment and taxonomy information
>gi|157113261|ref|XP_001651968.1| hypothetical protein AaeL_AAEL006374 [Aedes aegypti] gi|108877835|gb|EAT42060.1| AAEL006374-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
MGI|MGI:2145579339 Kctd9 "potassium channel tetra 0.977 0.648 0.552 5.3e-56
RGD|1312010339 Kctd9 "potassium channel tetra 0.977 0.648 0.552 5.3e-56
ZFIN|ZDB-GENE-050320-147391 zgc:113115 "zgc:113115" [Danio 0.928 0.534 0.462 2.8e-41
ZFIN|ZDB-GENE-040718-238389 kctd9 "potassium channel tetra 0.92 0.532 0.462 9.6e-41
FB|FBgn0037244361 CG14647 [Drosophila melanogast 0.924 0.576 0.463 1.2e-40
DICTYBASE|DDB_G0291330488 kctd9 "potassium channel tetra 0.88 0.405 0.456 1.1e-39
UNIPROTKB|Q5ZJ71389 KCTD9 "Uncharacterized protein 0.92 0.532 0.449 2.3e-39
UNIPROTKB|F1MFU2392 KCTD9 "Uncharacterized protein 0.92 0.528 0.453 6.1e-39
UNIPROTKB|F1PTL8393 KCTD9 "Uncharacterized protein 0.92 0.526 0.453 6.1e-39
UNIPROTKB|Q7L273389 KCTD9 "BTB/POZ domain-containi 0.92 0.532 0.453 6.1e-39
MGI|MGI:2145579 Kctd9 "potassium channel tetramerisation domain containing 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 577 (208.2 bits), Expect = 5.3e-56, P = 5.3e-56
 Identities = 127/230 (55%), Positives = 154/230 (66%)

Query:     1 MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVL 60
             MLA MF    + G + N  D    GA+LIDRSP YFEPILNYLR+GQL+++  IN  GVL
Sbjct:   115 MLAHMF---KDKGVWGNKQD--HRGAFLIDRSPEYFEPILNYLRHGQLIVNDGINLLGVL 169

Query:    61 EEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQGVNLAG-- 118
             EEARFFGI+SL+  L   I + +   D  P+SR++ +  L+ TP  +ELR Q  NL G  
Sbjct:   170 EEARFFGIDSLIEHLEVAIKNSQPPEDHSPISRKEFVRFLLATPTKSELRCQCANLQGVK 229

Query:   119 ---SDLSRLDLRNINFKVRKGLTLPACSVNLKGANLEGSNMAGVNLRVATLKNANLQNCD 175
                S+     LR  NF+   GL       NLKG ++EGS M G+NLRVATLKNA L+NC+
Sbjct:   230 MLCSNAEGASLRLCNFEDPSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCN 289

Query:   176 LRAAVLAGADLENCDLSGSDLHEANLRGANLKDAALELMLTPLHMSQTVR 225
             LR A LAG DLENCDLSG DL EANLRG+N+K A  E MLTPLHMSQ+VR
Sbjct:   290 LRGATLAGTDLENCDLSGCDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR 339




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0051260 "protein homooligomerization" evidence=IEA
RGD|1312010 Kctd9 "potassium channel tetramerisation domain containing 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050320-147 zgc:113115 "zgc:113115" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-238 kctd9 "potassium channel tetramerisation domain containing 9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0037244 CG14647 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291330 kctd9 "potassium channel tetramerization domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJ71 KCTD9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MFU2 KCTD9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTL8 KCTD9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q7L273 KCTD9 "BTB/POZ domain-containing protein KCTD9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SE95FIP2_ARATHNo assigned EC number0.33460.91550.6912yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 7e-18
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 2e-16
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 4e-16
PRK15197291 PRK15197, PRK15197, secreted effector protein PipB 1e-13
pfam0221492 pfam02214, K_tetra, K+ channel tetramerisation dom 2e-13
COG1357238 COG1357, COG1357, Pentapeptide repeats containing 6e-13
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 3e-10
pfam1359977 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 3e-10
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 2e-09
COG1357 238 COG1357, COG1357, Pentapeptide repeats containing 3e-09
pfam1359977 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 1e-08
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 2e-08
PRK15196350 PRK15196, PRK15196, secreted effector protein PipB 5e-08
PRK15196350 PRK15196, PRK15196, secreted effector protein PipB 1e-07
pfam1359977 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 2e-07
pfam1359977 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 3e-07
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 4e-07
PRK15196350 PRK15196, PRK15196, secreted effector protein PipB 9e-07
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 1e-06
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 1e-06
PRK15196350 PRK15196, PRK15196, secreted effector protein PipB 1e-06
PRK15377 782 PRK15377, PRK15377, E3 ubiquitin-protein ligase So 1e-06
PRK15196 350 PRK15196, PRK15196, secreted effector protein PipB 2e-06
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 2e-05
PRK15196350 PRK15196, PRK15196, secreted effector protein PipB 6e-05
COG1357 238 COG1357, COG1357, Pentapeptide repeats containing 1e-04
PRK15197291 PRK15197, PRK15197, secreted effector protein PipB 1e-04
pfam0080540 pfam00805, Pentapeptide, Pentapeptide repeats (8 c 8e-04
PRK15196350 PRK15196, PRK15196, secreted effector protein PipB 0.004
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
 Score = 78.8 bits (194), Expect = 7e-18
 Identities = 49/131 (37%), Positives = 63/131 (48%), Gaps = 9/131 (6%)

Query: 91  LSRRDVINALILTPI-TAELRFQGVNLAGSDLSRLDLRNINFKVRKGLTLPACS------ 143
           LS  D+ NA +     +      G +L G++L   +L   N            +      
Sbjct: 61  LSGADLSNANLRGADLSKGADLSGADLEGANLRGANLSGANLSGANLSNATRANLSGADL 120

Query: 144 --VNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDLSGSDLHEANL 201
              NL  ANL G+N++G NL  A L NANL   DL  A L+GADL   +LSG+DL  ANL
Sbjct: 121 SGANLSNANLTGANLSGANLNGANLSNANLSGADLSGADLSGADLSGANLSGADLRGANL 180

Query: 202 RGANLKDAALE 212
            GANL  A L 
Sbjct: 181 SGANLSGADLR 191


Length = 238

>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185119 PRK15197, PRK15197, secreted effector protein PipB; Provisional Back     alignment and domain information
>gnl|CDD|202161 pfam02214, K_tetra, K+ channel tetramerisation domain Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
>gnl|CDD|205777 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies) Back     alignment and domain information
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205777 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies) Back     alignment and domain information
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
>gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional Back     alignment and domain information
>gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional Back     alignment and domain information
>gnl|CDD|205777 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies) Back     alignment and domain information
>gnl|CDD|205777 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies) Back     alignment and domain information
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
>gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional Back     alignment and domain information
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
>gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional Back     alignment and domain information
>gnl|CDD|185275 PRK15377, PRK15377, E3 ubiquitin-protein ligase SopA; Provisional Back     alignment and domain information
>gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional Back     alignment and domain information
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
>gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional Back     alignment and domain information
>gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185119 PRK15197, PRK15197, secreted effector protein PipB; Provisional Back     alignment and domain information
>gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) Back     alignment and domain information
>gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
KOG1665|consensus302 100.0
PRK15196350 secreted effector protein PipB2; Provisional 99.87
PRK15196350 secreted effector protein PipB2; Provisional 99.87
PRK09718 512 hypothetical protein; Validated 99.82
PRK15197291 secreted effector protein PipB; Provisional 99.8
PRK15197291 secreted effector protein PipB; Provisional 99.79
PRK09718 512 hypothetical protein; Validated 99.78
COG1357238 Pentapeptide repeats containing protein [Function 99.72
PRK15377 782 E3 ubiquitin-protein ligase SopA; Provisional 99.7
KOG1665|consensus302 99.7
PRK15377 782 E3 ubiquitin-protein ligase SopA; Provisional 99.66
KOG2715|consensus210 99.63
PF1359978 Pentapeptide_4: Pentapeptide repeats (9 copies); P 99.39
KOG2716|consensus230 99.18
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 99.13
KOG2714|consensus 465 98.91
KOG2723|consensus221 98.81
KOG4390|consensus 632 97.45
KOG3713|consensus 477 97.4
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 95.77
KOG3840|consensus438 91.23
PHA02790 480 Kelch-like protein; Provisional 85.61
PHA03098 534 kelch-like protein; Provisional 83.75
>KOG1665|consensus Back     alignment and domain information
Probab=100.00  E-value=1.3e-42  Score=265.29  Aligned_cols=219  Identities=52%  Similarity=0.722  Sum_probs=165.0

Q ss_pred             CHHHHhccCCCCCccCCCCccCCCCCEEEcCCCCChHHHHHHHHhCCcccCCCCChHhHHhhhhccCcccchHHHHH---
Q psy17757          1 MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESLVPQLME---   77 (225)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~fidrd~~~F~~iL~~lr~g~i~l~~~~~~~~vl~ea~F~~~~~l~~~l~~---   77 (225)
                      ||+.||++.      ++++++++.|.|||||+|.||++||||||.|+++..+.+..-++|+||+||++-.+...+++   
T Consensus        35 MLa~MF~~~------g~~~~~d~kGa~lIDRsp~yFepIlNyLr~Gq~~~~s~i~~lgvLeeArff~i~sL~~hle~~~~  108 (302)
T KOG1665|consen   35 MLAAMFSGR------GAMCQEDKKGAVLIDRSPKYFEPILNYLRDGQIPSLSDIDCLGVLEEARFFQILSLKDHLEDSRK  108 (302)
T ss_pred             HHHHHHccC------CCccccccCceEEEccCchhhHHHHHHHhcCceeecCCccHHHHHHHhhHHhhHhHHhHHhhhcc
Confidence            899999999      58999999999999999999999999999999999888889999999999998766665543   


Q ss_pred             ----------------HHHhhcccCCCCCcchhhhhhhhhcc-----CCCCCceeecccccCCcccccccccceeeecc-
Q psy17757         78 ----------------IIMSRERSRDMMPLSRRDVINALILT-----PITAELRFQGVNLAGSDLSRLDLRNINFKVRK-  135 (225)
Q Consensus        78 ----------------~~~~~~~~~~~~~~~~~~l~~~~l~~-----~~~~~~~f~~~~l~~~~f~~~~l~~~~f~~~~-  135 (225)
                                      .++-++..+.+++|+++|++..+|+.     +.+..|.|.+++|.-|.|+++++.++.|+.+. 
T Consensus       109 e~pe~~~pltR~diik~iqT~elRfqGvNlSGaDLskLDlr~inFkyA~ls~c~lshtNL~ca~lerADl~gsil~cA~L  188 (302)
T KOG1665|consen  109 EVPEVEAPLTRIDIIKCIQTEELRFQGVNLSGADLSKLDLRLINFKYANLSNCNLSHTNLQCAKLERADLEGSILHCAIL  188 (302)
T ss_pred             CCCcCCCCccHHHHHHHhhhhheeeecccccccchhhcccccccceehhhccccccccchhhhhhcccccccchhhhhhh
Confidence                            23233334444444444444443333     33333333333333333333333333333321 


Q ss_pred             -----------ccc-------------cccccceecCccccCCcccCccccccccCceeecccccccccccCcccCcccc
Q psy17757        136 -----------GLT-------------LPACSVNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDL  191 (225)
Q Consensus       136 -----------~~~-------------~~~~~a~~~~~~f~~~~l~~~~f~~a~l~~~~f~~~~l~~a~f~~~~l~~~~f  191 (225)
                                 ++.             .+..++++++|+|.++++.+++++.|+|+++++++|++.+|.+.++++++|+|
T Consensus       189 ~~v~~lcaN~eGA~L~gcNfedps~~kaNLeganLkG~~~egs~m~ginLrvA~Lknanle~~NLrgA~LaGadLencnl  268 (302)
T KOG1665|consen  189 REVEMLCANAEGASLKGCNFEDPSGLKANLEGANLKGADMEGSQMTGINLRVATLKNANLENCNLRGANLAGADLENCNL  268 (302)
T ss_pred             hhhhheecccccccccCcCCCCccchhccccccccccccccccccccceeEeccccccccccCccccccccCCccccCCC
Confidence                       111             22226777777777788888888888999999999999999999999999999


Q ss_pred             cCCCcCCccccCCcccccccccccccccccccCC
Q psy17757        192 SGSDLHEANLRGANLKDAALELMLTPLHMSQTVR  225 (225)
Q Consensus       192 ~~~~l~~a~~~~~~l~~~~~~~~~~~~~~~~~~~  225 (225)
                      +||++.+|++++++++++.++..++|+|+++.||
T Consensus       269 sG~dLQeAnLRg~Nlk~A~~e~mltplhMsqaiR  302 (302)
T KOG1665|consen  269 SGADLQEANLRGVNLKEAHMEAMLTPLHMSQAIR  302 (302)
T ss_pred             CCcchhHhhcccCchhhHHHHhhccchhhccccC
Confidence            9999999999999999999999999999999998



>PRK15196 secreted effector protein PipB2; Provisional Back     alignment and domain information
>PRK15196 secreted effector protein PipB2; Provisional Back     alignment and domain information
>PRK09718 hypothetical protein; Validated Back     alignment and domain information
>PRK15197 secreted effector protein PipB; Provisional Back     alignment and domain information
>PRK15197 secreted effector protein PipB; Provisional Back     alignment and domain information
>PRK09718 hypothetical protein; Validated Back     alignment and domain information
>COG1357 Pentapeptide repeats containing protein [Function unknown] Back     alignment and domain information
>PRK15377 E3 ubiquitin-protein ligase SopA; Provisional Back     alignment and domain information
>KOG1665|consensus Back     alignment and domain information
>PRK15377 E3 ubiquitin-protein ligase SopA; Provisional Back     alignment and domain information
>KOG2715|consensus Back     alignment and domain information
>PF13599 Pentapeptide_4: Pentapeptide repeats (9 copies); PDB: 2XTY_A 2XTW_C 2XTX_B 3PSS_B 3PSZ_B 3NB2_B 3NAW_B 3SQV_A 2W7Z_B 2XT2_A Back     alignment and domain information
>KOG2716|consensus Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG2714|consensus Back     alignment and domain information
>KOG2723|consensus Back     alignment and domain information
>KOG4390|consensus Back     alignment and domain information
>KOG3713|consensus Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG3840|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
3drx_A202 X-Ray Crystal Structure Of Human Kctd5 Protein Crys 1e-16
3drz_A107 X-Ray Crystal Structure Of The N-Terminal Btb Domai 2e-15
2j8k_A201 Structure Of The Fusion Of Np275 And Np276, Pentape 4e-10
2bm4_A186 The Structure Of Mfpa (Rv3361c, C2 Crystal Form). T 3e-06
2j8i_A118 Structure Of Np275, A Pentapeptide Repeat Protein F 3e-06
3du1_X257 The 2.0 Angstrom Resolution Crystal Structure Of He 7e-06
2o6w_A150 Crystal Structure Of A Pentapeptide Repeat Protein 1e-05
3naw_A 613 Crystal Structure Of E. Coli O157:h7 Effector Prote 2e-05
3sqv_A 616 Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin L 2e-05
3psz_A216 Crystal Structure Of Ahqnr, The Qnr Protein From Ae 5e-05
3pss_A216 Crystal Structure Of Ahqnr, The Qnr Protein From Ae 1e-04
3n90_A152 The 1.7 Angstrom Resolution Crystal Structure Of At 1e-04
>pdb|3DRX|A Chain A, X-Ray Crystal Structure Of Human Kctd5 Protein Crystallized In High- Salt Buffer Length = 202 Back     alignment and structure

Iteration: 1

Score = 82.8 bits (203), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 37/74 (50%), Positives = 51/74 (68%) Query: 20 DVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESLVPQLMEII 79 D D TGAYLIDR PTYF P+LNYLR+G+LV++ ++ EGVLEEA F+ I SL+ + + I Sbjct: 51 DKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKI 110 Query: 80 MSRERSRDMMPLSR 93 R+ +P+ Sbjct: 111 RERDSKTSQVPVKH 124
>pdb|3DRZ|A Chain A, X-Ray Crystal Structure Of The N-Terminal Btb Domain Of Human Kctd5 Protein Length = 107 Back     alignment and structure
>pdb|2J8K|A Chain A, Structure Of The Fusion Of Np275 And Np276, Pentapeptide Repeat Proteins From Nostoc Punctiforme Length = 201 Back     alignment and structure
>pdb|2BM4|A Chain A, The Structure Of Mfpa (Rv3361c, C2 Crystal Form). The Pentapeptide Repeat Protein From Mycobacterium Tuberculosis Folds As A Right-Handed Quadrilateral Beta- Helix. Length = 186 Back     alignment and structure
>pdb|2J8I|A Chain A, Structure Of Np275, A Pentapeptide Repeat Protein From Nostoc Punctiforme Length = 118 Back     alignment and structure
>pdb|3DU1|X Chain X, The 2.0 Angstrom Resolution Crystal Structure Of Hetl, A Pentapeptide Repeat Protein Involved In Heterocyst Differentiation Regulation From The Cyanobacterium Nostoc Sp. Strain Pcc 7120 Length = 257 Back     alignment and structure
>pdb|2O6W|A Chain A, Crystal Structure Of A Pentapeptide Repeat Protein (Rfr23) From The Cyanobacterium Cyanothece 51142 Length = 150 Back     alignment and structure
>pdb|3NAW|A Chain A, Crystal Structure Of E. Coli O157:h7 Effector Protein Nlel Length = 613 Back     alignment and structure
>pdb|3SQV|A Chain A, Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin Ligase, Nlel, With A Human E2, Ubch7 Length = 616 Back     alignment and structure
>pdb|3PSZ|A Chain A, Crystal Structure Of Ahqnr, The Qnr Protein From Aeromonas Hydrophila (P21212 Crystal Form) Length = 216 Back     alignment and structure
>pdb|3PSS|A Chain A, Crystal Structure Of Ahqnr, The Qnr Protein From Aeromonas Hydrophila (P21 Crystal Form) Length = 216 Back     alignment and structure
>pdb|3N90|A Chain A, The 1.7 Angstrom Resolution Crystal Structure Of At2g44920, A Pentapeptide Repeat Protein From Arabidopsis Thaliana Thylakoid Lumen Length = 152 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 3e-28
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 2e-26
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 5e-25
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 8e-25
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 7e-23
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 6e-22
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 4e-21
2bm5_A 186 MFPA, RV3361C, pentapeptide repeat family protein; 2e-15
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 4e-26
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 2e-24
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 4e-23
2xty_A 217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 1e-22
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 3e-22
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 3e-21
2xty_A 217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 1e-10
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 5e-26
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 7e-25
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 2e-23
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 9e-23
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 1e-22
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 1e-22
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 1e-21
2j8k_A 201 NP275-NP276; pentapeptide repeat protein, PRP, rig 9e-16
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 2e-04
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 5e-25
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 7e-24
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 1e-23
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 6e-22
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 7e-22
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 9e-22
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 2e-21
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 6e-21
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 7e-21
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 1e-19
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 5e-19
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 1e-18
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 1e-17
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 2e-15
3du1_X 257 ALL3740 protein, HETL; right-handed beta helix, re 1e-07
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 7e-25
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 2e-18
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 8e-12
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 3e-11
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 8e-04
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 1e-24
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 1e-23
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 2e-23
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 5e-21
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 3e-19
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 4e-24
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 2e-23
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 3e-21
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 3e-20
2xt2_A 200 ALBG, MCBG-like protein; cell cycle, right handed 5e-20
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 1e-19
2xt2_A 200 ALBG, MCBG-like protein; cell cycle, right handed 1e-14
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 2e-14
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 1e-23
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 6e-23
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 1e-19
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 2e-16
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 2e-15
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 3e-10
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 2e-05
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 2e-23
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 2e-23
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 8e-23
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 1e-21
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 2e-14
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 2e-23
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 9e-23
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 1e-22
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 7e-22
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 2e-21
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 8e-16
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 9e-15
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 6e-04
3pss_A 216 QNR; pentapeptide repeat, antibiotic resistance, D 9e-22
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 3e-21
3pss_A 216 QNR; pentapeptide repeat, antibiotic resistance, D 2e-17
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 6e-16
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 1e-14
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 3e-14
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 8e-14
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 2e-13
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 1e-12
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 2e-12
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 2e-04
3pss_A 216 QNR; pentapeptide repeat, antibiotic resistance, D 3e-04
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 3e-21
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 1e-16
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 2e-14
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 5e-14
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 3e-13
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 3e-17
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 6e-17
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 1e-16
3kvt_A115 Potassium channel protein SHAW; tetramerization do 1e-15
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
2r9r_B 514 Paddle chimera voltage gated potassium channel KV; 7e-04
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Length = 202 Back     alignment and structure
 Score =  105 bits (262), Expect = 3e-28
 Identities = 42/133 (31%), Positives = 64/133 (48%), Gaps = 8/133 (6%)

Query: 1   MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVL 60
            L ++     +        D D TGAYLIDR PTYF P+LNYLR+G+LV++ ++  EGVL
Sbjct: 37  FLYRLCQADPD-----LDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVL 91

Query: 61  EEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQGVNLAGSD 120
           EEA F+ I SL+  + + I  RER      +  + V   ++        +       G  
Sbjct: 92  EEAEFYNITSLIKLVKDKI--RERDSKTSQVPVKHVYR-VLQCQEEELTQMVSTMSDGWK 148

Query: 121 LSRLDLRNINFKV 133
             +L     ++  
Sbjct: 149 FEQLVSIGSSYNY 161


>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Length = 140 Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Length = 105 Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Length = 124 Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Length = 115 Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Length = 100 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Length = 514 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 99.93
2j8k_A201 NP275-NP276; pentapeptide repeat protein, PRP, rig 99.91
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 99.9
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 99.9
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 99.9
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 99.9
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 99.9
2bm5_A186 MFPA, RV3361C, pentapeptide repeat family protein; 99.9
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 99.89
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 99.89
3du1_X257 ALL3740 protein, HETL; right-handed beta helix, re 99.89
2xty_A217 QNRB1; cell cycle, pentapeptide repeat, PRP, antib 99.89
2xt2_A200 ALBG, MCBG-like protein; cell cycle, right handed 99.89
2o6w_A150 Repeat five residue (RFR) protein or pentapeptide 99.88
3pss_A216 QNR; pentapeptide repeat, antibiotic resistance, D 99.87
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 99.86
2f3l_A184 RFR-domain; beta helix, unknown function; 2.11A {C 99.84
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 99.84
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 99.83
3n90_A152 P15, thylakoid lumenal 15 kDa protein 1, chloropla 99.82
3nb2_A 613 Secreted effector protein; pentapeptide, HECT doma 99.8
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 99.67
2qyu_A 627 Secreted effector protein; ubiquitin E3 ligase, li 99.64
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 99.58
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 99.54
3kvt_A115 Potassium channel protein SHAW; tetramerization do 99.39
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 99.37
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 99.21
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 99.19
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 99.14
2r9r_B 514 Paddle chimera voltage gated potassium channel KV; 98.63
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 92.63
2vpk_A116 Myoneurin; transcription regulation, transcription 91.5
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 89.96
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 88.29
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 87.98
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 87.81
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 86.97
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 86.01
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 85.96
3b84_A119 Zinc finger and BTB domain-containing protein 48; 84.26
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 81.88
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 80.6
>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Back     alignment and structure
Probab=99.93  E-value=1.6e-26  Score=180.84  Aligned_cols=173  Identities=30%  Similarity=0.272  Sum_probs=97.0

Q ss_pred             CChHHHHHHHHhCCcccCCCCChHhHHhhhhccCcccchHHHHHHHHhhcccCCCCCcchhhhhhhhhccCCCCCceeec
Q psy17757         34 TYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQG  113 (225)
Q Consensus        34 ~~F~~iL~~lr~g~i~l~~~~~~~~vl~ea~F~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~f~~  113 (225)
                      -.-+.++..+..|...+....+....+.+++|.++..           ..+.+.+++|++++|.+++|.++.|.+++|.+
T Consensus        21 m~~~~ll~~~~~g~~~~~~~dl~~~~l~~~~l~~~~l-----------~~a~l~~a~l~~a~ls~a~l~~a~l~~a~l~~   89 (201)
T 2j8k_A           21 MDVEKLRQLYAAGERDFSIVDLRGAVLENINLSGAIL-----------HGAMLDEANLQQANLSRADLSGATLNGADLRG   89 (201)
T ss_dssp             CCHHHHHHHHHTTCCBCTTCBCTTCBCTTCBCTTCBC-----------TTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTT
T ss_pred             CCHHHHHHHHHcCccccccCcCCCCccCCCccCCCCc-----------CCCccCCCccCCCccCcCCCCCCCcCCcCcCC
Confidence            3345677777777766666555555555555544432           22234444444444444444444444444444


Q ss_pred             ccccCCcccccccccceeeeccccccccccceecCccccCCcccCccccccccCceeecccccccccccCcccCcccccC
Q psy17757        114 VNLAGSDLSRLDLRNINFKVRKGLTLPACSVNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDLSG  193 (225)
Q Consensus       114 ~~l~~~~f~~~~l~~~~f~~~~~~~~~~~~a~~~~~~f~~~~l~~~~f~~a~l~~~~f~~~~l~~a~f~~~~l~~~~f~~  193 (225)
                      |+|.+++|.+++|.++.|.++.+.++.+.+++|.+++|.+++|.+++|.+|+|.+++|.+|+|++|+|.+++|.+++|.+
T Consensus        90 a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~L~~a~l~~a~l~~a~l~~  169 (201)
T 2j8k_A           90 ANLSKADLSDAILDNAILEGAILDEAVLNQANLKAANLEQAILSHANIREADLSEANLEAADLSGADLAIADLHQANLHQ  169 (201)
T ss_dssp             CBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTT
T ss_pred             CEECCCCccCCccCCCEeCccCcCCCCcccCcCccccccCCEEeCCEeeecCcCcCCCCCCCCCCCCcCCCEeCCCCcCC
Confidence            44444444444444444444444444555555555555555555666666666666666666666666666666666666


Q ss_pred             CCcCCccccCCccccccccccccc
Q psy17757        194 SDLHEANLRGANLKDAALELMLTP  217 (225)
Q Consensus       194 ~~l~~a~~~~~~l~~~~~~~~~~~  217 (225)
                      ++|.+++|++++|++++|++++.+
T Consensus       170 a~l~~a~l~~a~l~~a~l~ga~l~  193 (201)
T 2j8k_A          170 AALERANLTGANLEDANLEGTILE  193 (201)
T ss_dssp             CBCTTCBCTTCBCTTCBCTTSTTT
T ss_pred             CCCCCCCCCCCCcCCCEECcCCCC
Confidence            666666666666666666665543



>2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Back     alignment and structure
>2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Back     alignment and structure
>3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Back     alignment and structure
>2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Back     alignment and structure
>2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Back     alignment and structure
>2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Back     alignment and structure
>3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Back     alignment and structure
>2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} SCOP: b.80.8.0 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Back     alignment and structure
>3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} SCOP: b.80.8.0 Back     alignment and structure
>3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Back     alignment and structure
>2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 225
d1nn7a_105 d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus 6e-17
d3kvta_103 d.42.1.2 (A:) akv3.1 voltage-gated potassium chann 3e-16
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 6e-15
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 6e-11
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 2e-08
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 7e-05
d2j8ka1 175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 0.001
d2j8ka1 175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 0.001
d1t1da_100 d.42.1.2 (A:) Shaker potassium channel {California 1e-13
d2f3la1132 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya 1e-12
d2f3la1132 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya 4e-12
d2f3la1132 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya 5e-07
d2f3la1132 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya 5e-05
d2f3la1132 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya 1e-04
d2bm5a1 181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 1e-08
d2bm5a1 181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 7e-08
d2bm5a1 181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 6e-07
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 5e-06
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 6e-06
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 2e-05
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 2e-05
d2bm5a1 181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 5e-05
d2bm5a1 181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 5e-05
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 7e-05
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 2e-04
d2bm5a1 181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 3e-04
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 4e-04
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 5e-04
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 6e-04
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 0.004
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 105 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: Tetramerization domain of potassium channels
domain: Potassium channel kv4.2
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 71.5 bits (175), Expect = 6e-17
 Identities = 18/61 (29%), Positives = 24/61 (39%)

Query: 12 GGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESL 71
          G    +      T  Y  DR P  F  ILN+ R G+L    +       EE  FFG+   
Sbjct: 27 GSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELAFFGLIPE 86

Query: 72 V 72
          +
Sbjct: 87 I 87


>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Length = 103 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Length = 100 Back     information, alignment and structure
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 Back     information, alignment and structure
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 Back     information, alignment and structure
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 Back     information, alignment and structure
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 Back     information, alignment and structure
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d2j8ka1175 NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} 99.88
d2j8ka1175 NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} 99.87
d2bm5a1181 Hypothetical protein Rv3361c (MT3469) {Mycobacteri 99.86
d2bm5a1181 Hypothetical protein Rv3361c (MT3469) {Mycobacteri 99.86
d2f3la1132 Lumenal RFR-domain protein {Cyanothece sp. atcc 51 99.82
d2f3la1132 Lumenal RFR-domain protein {Cyanothece sp. atcc 51 99.82
d3kvta_103 akv3.1 voltage-gated potassium channel {California 99.32
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 99.25
d1t1da_100 Shaker potassium channel {California sea hare (Apl 99.24
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 89.81
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Pentapeptide repeat-like
family: Pentapeptide repeats
domain: NP275-NP276
species: Nostoc punctiforme [TaxId: 272131]
Probab=99.88  E-value=1.4e-23  Score=158.94  Aligned_cols=71  Identities=49%  Similarity=0.593  Sum_probs=28.2

Q ss_pred             cceecCccccCCcccCccccccccCceeecccccccccccCcccCcccccCCCcCCccccCCccccccccc
Q psy17757        143 SVNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDLSGSDLHEANLRGANLKDAALEL  213 (225)
Q Consensus       143 ~a~~~~~~f~~~~l~~~~f~~a~l~~~~f~~~~l~~a~f~~~~l~~~~f~~~~l~~a~~~~~~l~~~~~~~  213 (225)
                      ++.+.+++|.++.|.+++|.+++|.+++|.+++|.++.+.+++|++++|.+++|.+++|.+++|++++|++
T Consensus        99 ~~~~~~~~~~~s~~~~~~f~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ga~l~~a~~~g  169 (175)
T d2j8ka1          99 QANLKAANLEQAILSHANIREADLSEANLEAADLSGADLAIADLHQANLHQAALERANLTGANLEDANLEG  169 (175)
T ss_dssp             TCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTT
T ss_pred             ecccccccccCCEeCCCEeccCCCCCCccccCCCccccccccccCcCCcCCCEeCCCCcCCCCcCCCEEec
Confidence            33333333333333333333333333333333444444444444444444444444444444444444433



>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Back     information, alignment and structure
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure