Psyllid ID: psy17757
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 225 | ||||||
| 242018011 | 466 | BTB/POZ domain-containing protein KCTD9, | 0.995 | 0.480 | 0.625 | 8e-88 | |
| 270013763 | 398 | hypothetical protein TcasGA2_TC012406 [T | 0.995 | 0.562 | 0.603 | 4e-84 | |
| 189240901 | 391 | PREDICTED: similar to potassium channel | 0.995 | 0.572 | 0.603 | 5e-84 | |
| 389609809 | 280 | similar to CG14647 [Papilio xuthus] | 0.995 | 0.8 | 0.587 | 4e-79 | |
| 357621197 | 294 | putative BTB/POZ domain-containing prote | 0.995 | 0.761 | 0.583 | 2e-78 | |
| 307213919 | 386 | BTB/POZ domain-containing protein KCTD9 | 1.0 | 0.582 | 0.540 | 3e-73 | |
| 156538483 | 391 | PREDICTED: BTB/POZ domain-containing pro | 1.0 | 0.575 | 0.548 | 1e-72 | |
| 170038204 | 351 | BTB/POZ domain-containing protein KCTD9 | 0.977 | 0.626 | 0.55 | 3e-72 | |
| 321478158 | 381 | hypothetical protein DAPPUDRAFT_191018 [ | 0.995 | 0.587 | 0.542 | 4e-72 | |
| 157113261 | 368 | hypothetical protein AaeL_AAEL006374 [Ae | 0.977 | 0.597 | 0.546 | 1e-71 |
| >gi|242018011|ref|XP_002429477.1| BTB/POZ domain-containing protein KCTD9, putative [Pediculus humanus corporis] gi|212514409|gb|EEB16739.1| BTB/POZ domain-containing protein KCTD9, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 328 bits (842), Expect = 8e-88, Method: Compositional matrix adjust.
Identities = 175/280 (62%), Positives = 194/280 (69%), Gaps = 56/280 (20%)
Query: 1 MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVL 60
MLA+MFA+ E GY M P D+D GAYLIDRSPTYFEPILNYLRNGQL+ D N+NP G+L
Sbjct: 188 MLARMFAQ-DEDGYLMTPSDLDVNGAYLIDRSPTYFEPILNYLRNGQLIFDTNVNPAGIL 246
Query: 61 EEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQGVNLAGSD 120
+EARFF IESLV L +I +++RS+D+ PL+RRDVINALI T TA+LRFQGVNLAGSD
Sbjct: 247 QEARFFRIESLVEHLENLISTQQRSQDIAPLTRRDVINALITTSSTADLRFQGVNLAGSD 306
Query: 121 LSRLDLRNINFKVR------------------------------------------KGLT 138
LSRLDLRNINFK +G
Sbjct: 307 LSRLDLRNINFKYACLHGCRMVGANLSFCCLERADLSHAVMESAQLMGVQMLCANLEGAN 366
Query: 139 LPACS-------------VNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGAD 185
L C+ VNLKGANLE SNMAGVNLRVATLKNANLQNCDLRAAVLAGAD
Sbjct: 367 LRGCNFQDPTGVRTNMEGVNLKGANLECSNMAGVNLRVATLKNANLQNCDLRAAVLAGAD 426
Query: 186 LENCDLSGSDLHEANLRGANLKDAALELMLTPLHMSQTVR 225
LE CDLSGSDL EANLRGANLKDAA ELMLTP+HMSQT+R
Sbjct: 427 LEKCDLSGSDLQEANLRGANLKDAAFELMLTPIHMSQTIR 466
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270013763|gb|EFA10211.1| hypothetical protein TcasGA2_TC012406 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189240901|ref|XP_966398.2| PREDICTED: similar to potassium channel tetramerisation domain containing 9 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|389609809|dbj|BAM18516.1| similar to CG14647 [Papilio xuthus] | Back alignment and taxonomy information |
|---|
| >gi|357621197|gb|EHJ73113.1| putative BTB/POZ domain-containing protein KCTD9 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|307213919|gb|EFN89166.1| BTB/POZ domain-containing protein KCTD9 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|156538483|ref|XP_001606722.1| PREDICTED: BTB/POZ domain-containing protein KCTD9-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|170038204|ref|XP_001846942.1| BTB/POZ domain-containing protein KCTD9 [Culex quinquefasciatus] gi|167881755|gb|EDS45138.1| BTB/POZ domain-containing protein KCTD9 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|321478158|gb|EFX89116.1| hypothetical protein DAPPUDRAFT_191018 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|157113261|ref|XP_001651968.1| hypothetical protein AaeL_AAEL006374 [Aedes aegypti] gi|108877835|gb|EAT42060.1| AAEL006374-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 225 | ||||||
| MGI|MGI:2145579 | 339 | Kctd9 "potassium channel tetra | 0.977 | 0.648 | 0.552 | 5.3e-56 | |
| RGD|1312010 | 339 | Kctd9 "potassium channel tetra | 0.977 | 0.648 | 0.552 | 5.3e-56 | |
| ZFIN|ZDB-GENE-050320-147 | 391 | zgc:113115 "zgc:113115" [Danio | 0.928 | 0.534 | 0.462 | 2.8e-41 | |
| ZFIN|ZDB-GENE-040718-238 | 389 | kctd9 "potassium channel tetra | 0.92 | 0.532 | 0.462 | 9.6e-41 | |
| FB|FBgn0037244 | 361 | CG14647 [Drosophila melanogast | 0.924 | 0.576 | 0.463 | 1.2e-40 | |
| DICTYBASE|DDB_G0291330 | 488 | kctd9 "potassium channel tetra | 0.88 | 0.405 | 0.456 | 1.1e-39 | |
| UNIPROTKB|Q5ZJ71 | 389 | KCTD9 "Uncharacterized protein | 0.92 | 0.532 | 0.449 | 2.3e-39 | |
| UNIPROTKB|F1MFU2 | 392 | KCTD9 "Uncharacterized protein | 0.92 | 0.528 | 0.453 | 6.1e-39 | |
| UNIPROTKB|F1PTL8 | 393 | KCTD9 "Uncharacterized protein | 0.92 | 0.526 | 0.453 | 6.1e-39 | |
| UNIPROTKB|Q7L273 | 389 | KCTD9 "BTB/POZ domain-containi | 0.92 | 0.532 | 0.453 | 6.1e-39 |
| MGI|MGI:2145579 Kctd9 "potassium channel tetramerisation domain containing 9" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Score = 577 (208.2 bits), Expect = 5.3e-56, P = 5.3e-56
Identities = 127/230 (55%), Positives = 154/230 (66%)
Query: 1 MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVL 60
MLA MF + G + N D GA+LIDRSP YFEPILNYLR+GQL+++ IN GVL
Sbjct: 115 MLAHMF---KDKGVWGNKQD--HRGAFLIDRSPEYFEPILNYLRHGQLIVNDGINLLGVL 169
Query: 61 EEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQGVNLAG-- 118
EEARFFGI+SL+ L I + + D P+SR++ + L+ TP +ELR Q NL G
Sbjct: 170 EEARFFGIDSLIEHLEVAIKNSQPPEDHSPISRKEFVRFLLATPTKSELRCQCANLQGVK 229
Query: 119 ---SDLSRLDLRNINFKVRKGLTLPACSVNLKGANLEGSNMAGVNLRVATLKNANLQNCD 175
S+ LR NF+ GL NLKG ++EGS M G+NLRVATLKNA L+NC+
Sbjct: 230 MLCSNAEGASLRLCNFEDPSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCN 289
Query: 176 LRAAVLAGADLENCDLSGSDLHEANLRGANLKDAALELMLTPLHMSQTVR 225
LR A LAG DLENCDLSG DL EANLRG+N+K A E MLTPLHMSQ+VR
Sbjct: 290 LRGATLAGTDLENCDLSGCDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR 339
|
|
| RGD|1312010 Kctd9 "potassium channel tetramerisation domain containing 9" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050320-147 zgc:113115 "zgc:113115" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040718-238 kctd9 "potassium channel tetramerisation domain containing 9" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037244 CG14647 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0291330 kctd9 "potassium channel tetramerization domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZJ71 KCTD9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MFU2 KCTD9 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PTL8 KCTD9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7L273 KCTD9 "BTB/POZ domain-containing protein KCTD9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 225 | |||
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 7e-18 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 2e-16 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 4e-16 | |
| PRK15197 | 291 | PRK15197, PRK15197, secreted effector protein PipB | 1e-13 | |
| pfam02214 | 92 | pfam02214, K_tetra, K+ channel tetramerisation dom | 2e-13 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 6e-13 | |
| pfam00805 | 40 | pfam00805, Pentapeptide, Pentapeptide repeats (8 c | 3e-10 | |
| pfam13599 | 77 | pfam13599, Pentapeptide_4, Pentapeptide repeats (9 | 3e-10 | |
| smart00225 | 97 | smart00225, BTB, Broad-Complex, Tramtrack and Bric | 2e-09 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 3e-09 | |
| pfam13599 | 77 | pfam13599, Pentapeptide_4, Pentapeptide repeats (9 | 1e-08 | |
| pfam00805 | 40 | pfam00805, Pentapeptide, Pentapeptide repeats (8 c | 2e-08 | |
| PRK15196 | 350 | PRK15196, PRK15196, secreted effector protein PipB | 5e-08 | |
| PRK15196 | 350 | PRK15196, PRK15196, secreted effector protein PipB | 1e-07 | |
| pfam13599 | 77 | pfam13599, Pentapeptide_4, Pentapeptide repeats (9 | 2e-07 | |
| pfam13599 | 77 | pfam13599, Pentapeptide_4, Pentapeptide repeats (9 | 3e-07 | |
| pfam00805 | 40 | pfam00805, Pentapeptide, Pentapeptide repeats (8 c | 4e-07 | |
| PRK15196 | 350 | PRK15196, PRK15196, secreted effector protein PipB | 9e-07 | |
| pfam00805 | 40 | pfam00805, Pentapeptide, Pentapeptide repeats (8 c | 1e-06 | |
| pfam00805 | 40 | pfam00805, Pentapeptide, Pentapeptide repeats (8 c | 1e-06 | |
| PRK15196 | 350 | PRK15196, PRK15196, secreted effector protein PipB | 1e-06 | |
| PRK15377 | 782 | PRK15377, PRK15377, E3 ubiquitin-protein ligase So | 1e-06 | |
| PRK15196 | 350 | PRK15196, PRK15196, secreted effector protein PipB | 2e-06 | |
| pfam00805 | 40 | pfam00805, Pentapeptide, Pentapeptide repeats (8 c | 2e-05 | |
| PRK15196 | 350 | PRK15196, PRK15196, secreted effector protein PipB | 6e-05 | |
| COG1357 | 238 | COG1357, COG1357, Pentapeptide repeats containing | 1e-04 | |
| PRK15197 | 291 | PRK15197, PRK15197, secreted effector protein PipB | 1e-04 | |
| pfam00805 | 40 | pfam00805, Pentapeptide, Pentapeptide repeats (8 c | 8e-04 | |
| PRK15196 | 350 | PRK15196, PRK15196, secreted effector protein PipB | 0.004 |
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
Score = 78.8 bits (194), Expect = 7e-18
Identities = 49/131 (37%), Positives = 63/131 (48%), Gaps = 9/131 (6%)
Query: 91 LSRRDVINALILTPI-TAELRFQGVNLAGSDLSRLDLRNINFKVRKGLTLPACS------ 143
LS D+ NA + + G +L G++L +L N +
Sbjct: 61 LSGADLSNANLRGADLSKGADLSGADLEGANLRGANLSGANLSGANLSNATRANLSGADL 120
Query: 144 --VNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDLSGSDLHEANL 201
NL ANL G+N++G NL A L NANL DL A L+GADL +LSG+DL ANL
Sbjct: 121 SGANLSNANLTGANLSGANLNGANLSNANLSGADLSGADLSGADLSGANLSGADLRGANL 180
Query: 202 RGANLKDAALE 212
GANL A L
Sbjct: 181 SGANLSGADLR 191
|
Length = 238 |
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|185119 PRK15197, PRK15197, secreted effector protein PipB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202161 pfam02214, K_tetra, K+ channel tetramerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205777 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|205777 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205777 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205777 pfam13599, Pentapeptide_4, Pentapeptide repeats (9 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185275 PRK15377, PRK15377, E3 ubiquitin-protein ligase SopA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224276 COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|185119 PRK15197, PRK15197, secreted effector protein PipB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|109845 pfam00805, Pentapeptide, Pentapeptide repeats (8 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|185118 PRK15196, PRK15196, secreted effector protein PipB2; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 225 | |||
| KOG1665|consensus | 302 | 100.0 | ||
| PRK15196 | 350 | secreted effector protein PipB2; Provisional | 99.87 | |
| PRK15196 | 350 | secreted effector protein PipB2; Provisional | 99.87 | |
| PRK09718 | 512 | hypothetical protein; Validated | 99.82 | |
| PRK15197 | 291 | secreted effector protein PipB; Provisional | 99.8 | |
| PRK15197 | 291 | secreted effector protein PipB; Provisional | 99.79 | |
| PRK09718 | 512 | hypothetical protein; Validated | 99.78 | |
| COG1357 | 238 | Pentapeptide repeats containing protein [Function | 99.72 | |
| PRK15377 | 782 | E3 ubiquitin-protein ligase SopA; Provisional | 99.7 | |
| KOG1665|consensus | 302 | 99.7 | ||
| PRK15377 | 782 | E3 ubiquitin-protein ligase SopA; Provisional | 99.66 | |
| KOG2715|consensus | 210 | 99.63 | ||
| PF13599 | 78 | Pentapeptide_4: Pentapeptide repeats (9 copies); P | 99.39 | |
| KOG2716|consensus | 230 | 99.18 | ||
| PF02214 | 94 | BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi | 99.13 | |
| KOG2714|consensus | 465 | 98.91 | ||
| KOG2723|consensus | 221 | 98.81 | ||
| KOG4390|consensus | 632 | 97.45 | ||
| KOG3713|consensus | 477 | 97.4 | ||
| smart00225 | 90 | BTB Broad-Complex, Tramtrack and Bric a brac. Doma | 95.77 | |
| KOG3840|consensus | 438 | 91.23 | ||
| PHA02790 | 480 | Kelch-like protein; Provisional | 85.61 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 83.75 |
| >KOG1665|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-42 Score=265.29 Aligned_cols=219 Identities=52% Similarity=0.722 Sum_probs=165.0
Q ss_pred CHHHHhccCCCCCccCCCCccCCCCCEEEcCCCCChHHHHHHHHhCCcccCCCCChHhHHhhhhccCcccchHHHHH---
Q psy17757 1 MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESLVPQLME--- 77 (225)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~fidrd~~~F~~iL~~lr~g~i~l~~~~~~~~vl~ea~F~~~~~l~~~l~~--- 77 (225)
||+.||++. ++++++++.|.|||||+|.||++||||||.|+++..+.+..-++|+||+||++-.+...+++
T Consensus 35 MLa~MF~~~------g~~~~~d~kGa~lIDRsp~yFepIlNyLr~Gq~~~~s~i~~lgvLeeArff~i~sL~~hle~~~~ 108 (302)
T KOG1665|consen 35 MLAAMFSGR------GAMCQEDKKGAVLIDRSPKYFEPILNYLRDGQIPSLSDIDCLGVLEEARFFQILSLKDHLEDSRK 108 (302)
T ss_pred HHHHHHccC------CCccccccCceEEEccCchhhHHHHHHHhcCceeecCCccHHHHHHHhhHHhhHhHHhHHhhhcc
Confidence 899999999 58999999999999999999999999999999999888889999999999998766665543
Q ss_pred ----------------HHHhhcccCCCCCcchhhhhhhhhcc-----CCCCCceeecccccCCcccccccccceeeecc-
Q psy17757 78 ----------------IIMSRERSRDMMPLSRRDVINALILT-----PITAELRFQGVNLAGSDLSRLDLRNINFKVRK- 135 (225)
Q Consensus 78 ----------------~~~~~~~~~~~~~~~~~~l~~~~l~~-----~~~~~~~f~~~~l~~~~f~~~~l~~~~f~~~~- 135 (225)
.++-++..+.+++|+++|++..+|+. +.+..|.|.+++|.-|.|+++++.++.|+.+.
T Consensus 109 e~pe~~~pltR~diik~iqT~elRfqGvNlSGaDLskLDlr~inFkyA~ls~c~lshtNL~ca~lerADl~gsil~cA~L 188 (302)
T KOG1665|consen 109 EVPEVEAPLTRIDIIKCIQTEELRFQGVNLSGADLSKLDLRLINFKYANLSNCNLSHTNLQCAKLERADLEGSILHCAIL 188 (302)
T ss_pred CCCcCCCCccHHHHHHHhhhhheeeecccccccchhhcccccccceehhhccccccccchhhhhhcccccccchhhhhhh
Confidence 23233334444444444444443333 33333333333333333333333333333321
Q ss_pred -----------ccc-------------cccccceecCccccCCcccCccccccccCceeecccccccccccCcccCcccc
Q psy17757 136 -----------GLT-------------LPACSVNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDL 191 (225)
Q Consensus 136 -----------~~~-------------~~~~~a~~~~~~f~~~~l~~~~f~~a~l~~~~f~~~~l~~a~f~~~~l~~~~f 191 (225)
++. .+..++++++|+|.++++.+++++.|+|+++++++|++.+|.+.++++++|+|
T Consensus 189 ~~v~~lcaN~eGA~L~gcNfedps~~kaNLeganLkG~~~egs~m~ginLrvA~Lknanle~~NLrgA~LaGadLencnl 268 (302)
T KOG1665|consen 189 REVEMLCANAEGASLKGCNFEDPSGLKANLEGANLKGADMEGSQMTGINLRVATLKNANLENCNLRGANLAGADLENCNL 268 (302)
T ss_pred hhhhheecccccccccCcCCCCccchhccccccccccccccccccccceeEeccccccccccCccccccccCCccccCCC
Confidence 111 22226777777777788888888888999999999999999999999999999
Q ss_pred cCCCcCCccccCCcccccccccccccccccccCC
Q psy17757 192 SGSDLHEANLRGANLKDAALELMLTPLHMSQTVR 225 (225)
Q Consensus 192 ~~~~l~~a~~~~~~l~~~~~~~~~~~~~~~~~~~ 225 (225)
+||++.+|++++++++++.++..++|+|+++.||
T Consensus 269 sG~dLQeAnLRg~Nlk~A~~e~mltplhMsqaiR 302 (302)
T KOG1665|consen 269 SGADLQEANLRGVNLKEAHMEAMLTPLHMSQAIR 302 (302)
T ss_pred CCcchhHhhcccCchhhHHHHhhccchhhccccC
Confidence 9999999999999999999999999999999998
|
|
| >PRK15196 secreted effector protein PipB2; Provisional | Back alignment and domain information |
|---|
| >PRK15196 secreted effector protein PipB2; Provisional | Back alignment and domain information |
|---|
| >PRK09718 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK15197 secreted effector protein PipB; Provisional | Back alignment and domain information |
|---|
| >PRK15197 secreted effector protein PipB; Provisional | Back alignment and domain information |
|---|
| >PRK09718 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1357 Pentapeptide repeats containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15377 E3 ubiquitin-protein ligase SopA; Provisional | Back alignment and domain information |
|---|
| >KOG1665|consensus | Back alignment and domain information |
|---|
| >PRK15377 E3 ubiquitin-protein ligase SopA; Provisional | Back alignment and domain information |
|---|
| >KOG2715|consensus | Back alignment and domain information |
|---|
| >PF13599 Pentapeptide_4: Pentapeptide repeats (9 copies); PDB: 2XTY_A 2XTW_C 2XTX_B 3PSS_B 3PSZ_B 3NB2_B 3NAW_B 3SQV_A 2W7Z_B 2XT2_A | Back alignment and domain information |
|---|
| >KOG2716|consensus | Back alignment and domain information |
|---|
| >PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG2714|consensus | Back alignment and domain information |
|---|
| >KOG2723|consensus | Back alignment and domain information |
|---|
| >KOG4390|consensus | Back alignment and domain information |
|---|
| >KOG3713|consensus | Back alignment and domain information |
|---|
| >smart00225 BTB Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
| >KOG3840|consensus | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 225 | ||||
| 3drx_A | 202 | X-Ray Crystal Structure Of Human Kctd5 Protein Crys | 1e-16 | ||
| 3drz_A | 107 | X-Ray Crystal Structure Of The N-Terminal Btb Domai | 2e-15 | ||
| 2j8k_A | 201 | Structure Of The Fusion Of Np275 And Np276, Pentape | 4e-10 | ||
| 2bm4_A | 186 | The Structure Of Mfpa (Rv3361c, C2 Crystal Form). T | 3e-06 | ||
| 2j8i_A | 118 | Structure Of Np275, A Pentapeptide Repeat Protein F | 3e-06 | ||
| 3du1_X | 257 | The 2.0 Angstrom Resolution Crystal Structure Of He | 7e-06 | ||
| 2o6w_A | 150 | Crystal Structure Of A Pentapeptide Repeat Protein | 1e-05 | ||
| 3naw_A | 613 | Crystal Structure Of E. Coli O157:h7 Effector Prote | 2e-05 | ||
| 3sqv_A | 616 | Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin L | 2e-05 | ||
| 3psz_A | 216 | Crystal Structure Of Ahqnr, The Qnr Protein From Ae | 5e-05 | ||
| 3pss_A | 216 | Crystal Structure Of Ahqnr, The Qnr Protein From Ae | 1e-04 | ||
| 3n90_A | 152 | The 1.7 Angstrom Resolution Crystal Structure Of At | 1e-04 |
| >pdb|3DRX|A Chain A, X-Ray Crystal Structure Of Human Kctd5 Protein Crystallized In High- Salt Buffer Length = 202 | Back alignment and structure |
|
| >pdb|3DRZ|A Chain A, X-Ray Crystal Structure Of The N-Terminal Btb Domain Of Human Kctd5 Protein Length = 107 | Back alignment and structure |
| >pdb|2J8K|A Chain A, Structure Of The Fusion Of Np275 And Np276, Pentapeptide Repeat Proteins From Nostoc Punctiforme Length = 201 | Back alignment and structure |
| >pdb|2BM4|A Chain A, The Structure Of Mfpa (Rv3361c, C2 Crystal Form). The Pentapeptide Repeat Protein From Mycobacterium Tuberculosis Folds As A Right-Handed Quadrilateral Beta- Helix. Length = 186 | Back alignment and structure |
| >pdb|2J8I|A Chain A, Structure Of Np275, A Pentapeptide Repeat Protein From Nostoc Punctiforme Length = 118 | Back alignment and structure |
| >pdb|3DU1|X Chain X, The 2.0 Angstrom Resolution Crystal Structure Of Hetl, A Pentapeptide Repeat Protein Involved In Heterocyst Differentiation Regulation From The Cyanobacterium Nostoc Sp. Strain Pcc 7120 Length = 257 | Back alignment and structure |
| >pdb|2O6W|A Chain A, Crystal Structure Of A Pentapeptide Repeat Protein (Rfr23) From The Cyanobacterium Cyanothece 51142 Length = 150 | Back alignment and structure |
| >pdb|3NAW|A Chain A, Crystal Structure Of E. Coli O157:h7 Effector Protein Nlel Length = 613 | Back alignment and structure |
| >pdb|3SQV|A Chain A, Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin Ligase, Nlel, With A Human E2, Ubch7 Length = 616 | Back alignment and structure |
| >pdb|3PSZ|A Chain A, Crystal Structure Of Ahqnr, The Qnr Protein From Aeromonas Hydrophila (P21212 Crystal Form) Length = 216 | Back alignment and structure |
| >pdb|3PSS|A Chain A, Crystal Structure Of Ahqnr, The Qnr Protein From Aeromonas Hydrophila (P21 Crystal Form) Length = 216 | Back alignment and structure |
| >pdb|3N90|A Chain A, The 1.7 Angstrom Resolution Crystal Structure Of At2g44920, A Pentapeptide Repeat Protein From Arabidopsis Thaliana Thylakoid Lumen Length = 152 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 225 | |||
| 3drx_A | 202 | BTB/POZ domain-containing protein KCTD5; golgi, gr | 3e-28 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 2e-26 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 5e-25 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 8e-25 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 7e-23 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 6e-22 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 4e-21 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 2e-15 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 4e-26 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 2e-24 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 4e-23 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 1e-22 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 3e-22 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 3e-21 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 1e-10 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 5e-26 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 7e-25 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 2e-23 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 9e-23 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 1e-22 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 1e-22 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 1e-21 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 9e-16 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 2e-04 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 5e-25 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 7e-24 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 1e-23 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 6e-22 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 7e-22 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 9e-22 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 2e-21 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 6e-21 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 7e-21 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 1e-19 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 5e-19 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 1e-18 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 1e-17 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 2e-15 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 1e-07 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 7e-25 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 2e-18 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 8e-12 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 3e-11 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 8e-04 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 1e-24 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 1e-23 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 2e-23 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 5e-21 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 3e-19 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 4e-24 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 2e-23 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 3e-21 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 3e-20 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 5e-20 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 1e-19 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 1e-14 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 2e-14 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 1e-23 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 6e-23 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 1e-19 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 2e-16 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 2e-15 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 3e-10 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 2e-05 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 2e-23 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 2e-23 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 8e-23 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 1e-21 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 2e-14 | |
| 3drz_A | 107 | BTB/POZ domain-containing protein KCTD5; potassium | 2e-23 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 9e-23 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 1e-22 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 7e-22 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 2e-21 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 8e-16 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 9e-15 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 6e-04 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 9e-22 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 3e-21 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 2e-17 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 6e-16 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 1e-14 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 3e-14 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 8e-14 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 2e-13 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 1e-12 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 2e-12 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 2e-04 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 3e-04 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 3e-21 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 1e-16 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 2e-14 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 5e-14 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 3e-13 | |
| 2nz0_B | 140 | Potassium voltage-gated channel subfamily D membe; | 3e-17 | |
| 1nn7_A | 105 | Potassium channel KV4.2; teteramerization domain, | 6e-17 | |
| 1s1g_A | 124 | Potassium voltage-gated channel subfamily D membe; | 1e-16 | |
| 3kvt_A | 115 | Potassium channel protein SHAW; tetramerization do | 1e-15 | |
| 1t1d_A | 100 | Protein (potassium channel KV1.1); potassium chann | 2e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-06 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 7e-04 |
| >3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Length = 202 | Back alignment and structure |
|---|
Score = 105 bits (262), Expect = 3e-28
Identities = 42/133 (31%), Positives = 64/133 (48%), Gaps = 8/133 (6%)
Query: 1 MLAKMFAEGSEGGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVL 60
L ++ + D D TGAYLIDR PTYF P+LNYLR+G+LV++ ++ EGVL
Sbjct: 37 FLYRLCQADPD-----LDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVL 91
Query: 61 EEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQGVNLAGSD 120
EEA F+ I SL+ + + I RER + + V ++ + G
Sbjct: 92 EEAEFYNITSLIKLVKDKI--RERDSKTSQVPVKHVYR-VLQCQEEELTQMVSTMSDGWK 148
Query: 121 LSRLDLRNINFKV 133
+L ++
Sbjct: 149 FEQLVSIGSSYNY 161
|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A Length = 186 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A Length = 217 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A Length = 201 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} Length = 257 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A Length = 627 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} Length = 150 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A Length = 200 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A Length = 613 | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A Length = 184 | Back alignment and structure |
|---|
| >3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} Length = 152 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A Length = 216 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Length = 214 | Back alignment and structure |
|---|
| >2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Length = 140 | Back alignment and structure |
|---|
| >1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Length = 105 | Back alignment and structure |
|---|
| >1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Length = 124 | Back alignment and structure |
|---|
| >3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Length = 115 | Back alignment and structure |
|---|
| >1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Length = 100 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Length = 514 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 225 | |||
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 99.93 | |
| 2j8k_A | 201 | NP275-NP276; pentapeptide repeat protein, PRP, rig | 99.91 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 99.9 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 99.9 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 99.9 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 99.9 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 99.9 | |
| 2bm5_A | 186 | MFPA, RV3361C, pentapeptide repeat family protein; | 99.9 | |
| 2w7z_A | 214 | EFSQNR, pentapeptide repeat family protein; glutar | 99.89 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 99.89 | |
| 3du1_X | 257 | ALL3740 protein, HETL; right-handed beta helix, re | 99.89 | |
| 2xty_A | 217 | QNRB1; cell cycle, pentapeptide repeat, PRP, antib | 99.89 | |
| 2xt2_A | 200 | ALBG, MCBG-like protein; cell cycle, right handed | 99.89 | |
| 2o6w_A | 150 | Repeat five residue (RFR) protein or pentapeptide | 99.88 | |
| 3pss_A | 216 | QNR; pentapeptide repeat, antibiotic resistance, D | 99.87 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 99.86 | |
| 2f3l_A | 184 | RFR-domain; beta helix, unknown function; 2.11A {C | 99.84 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 99.84 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 99.83 | |
| 3n90_A | 152 | P15, thylakoid lumenal 15 kDa protein 1, chloropla | 99.82 | |
| 3nb2_A | 613 | Secreted effector protein; pentapeptide, HECT doma | 99.8 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 99.67 | |
| 2qyu_A | 627 | Secreted effector protein; ubiquitin E3 ligase, li | 99.64 | |
| 3drz_A | 107 | BTB/POZ domain-containing protein KCTD5; potassium | 99.58 | |
| 3drx_A | 202 | BTB/POZ domain-containing protein KCTD5; golgi, gr | 99.54 | |
| 3kvt_A | 115 | Potassium channel protein SHAW; tetramerization do | 99.39 | |
| 1t1d_A | 100 | Protein (potassium channel KV1.1); potassium chann | 99.37 | |
| 1nn7_A | 105 | Potassium channel KV4.2; teteramerization domain, | 99.21 | |
| 1s1g_A | 124 | Potassium voltage-gated channel subfamily D membe; | 99.19 | |
| 2nz0_B | 140 | Potassium voltage-gated channel subfamily D membe; | 99.14 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 98.63 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 92.63 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 91.5 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 89.96 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 88.29 | |
| 3ga1_A | 129 | Nucleus accumbens-associated protein 1; BTB/POZ do | 87.98 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 87.81 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 86.97 | |
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 86.01 | |
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 85.96 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 84.26 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 81.88 | |
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 80.6 |
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A | Back alignment and structure |
|---|
Probab=99.93 E-value=1.6e-26 Score=180.84 Aligned_cols=173 Identities=30% Similarity=0.272 Sum_probs=97.0
Q ss_pred CChHHHHHHHHhCCcccCCCCChHhHHhhhhccCcccchHHHHHHHHhhcccCCCCCcchhhhhhhhhccCCCCCceeec
Q psy17757 34 TYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESLVPQLMEIIMSRERSRDMMPLSRRDVINALILTPITAELRFQG 113 (225)
Q Consensus 34 ~~F~~iL~~lr~g~i~l~~~~~~~~vl~ea~F~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~f~~ 113 (225)
-.-+.++..+..|...+....+....+.+++|.++.. ..+.+.+++|++++|.+++|.++.|.+++|.+
T Consensus 21 m~~~~ll~~~~~g~~~~~~~dl~~~~l~~~~l~~~~l-----------~~a~l~~a~l~~a~ls~a~l~~a~l~~a~l~~ 89 (201)
T 2j8k_A 21 MDVEKLRQLYAAGERDFSIVDLRGAVLENINLSGAIL-----------HGAMLDEANLQQANLSRADLSGATLNGADLRG 89 (201)
T ss_dssp CCHHHHHHHHHTTCCBCTTCBCTTCBCTTCBCTTCBC-----------TTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTT
T ss_pred CCHHHHHHHHHcCccccccCcCCCCccCCCccCCCCc-----------CCCccCCCccCCCccCcCCCCCCCcCCcCcCC
Confidence 3345677777777766666555555555555544432 22234444444444444444444444444444
Q ss_pred ccccCCcccccccccceeeeccccccccccceecCccccCCcccCccccccccCceeecccccccccccCcccCcccccC
Q psy17757 114 VNLAGSDLSRLDLRNINFKVRKGLTLPACSVNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDLSG 193 (225)
Q Consensus 114 ~~l~~~~f~~~~l~~~~f~~~~~~~~~~~~a~~~~~~f~~~~l~~~~f~~a~l~~~~f~~~~l~~a~f~~~~l~~~~f~~ 193 (225)
|+|.+++|.+++|.++.|.++.+.++.+.+++|.+++|.+++|.+++|.+|+|.+++|.+|+|++|+|.+++|.+++|.+
T Consensus 90 a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~l~~a~L~~a~l~~a~l~~a~l~~ 169 (201)
T 2j8k_A 90 ANLSKADLSDAILDNAILEGAILDEAVLNQANLKAANLEQAILSHANIREADLSEANLEAADLSGADLAIADLHQANLHQ 169 (201)
T ss_dssp CBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTT
T ss_pred CEECCCCccCCccCCCEeCccCcCCCCcccCcCccccccCCEEeCCEeeecCcCcCCCCCCCCCCCCcCCCEeCCCCcCC
Confidence 44444444444444444444444444555555555555555555666666666666666666666666666666666666
Q ss_pred CCcCCccccCCccccccccccccc
Q psy17757 194 SDLHEANLRGANLKDAALELMLTP 217 (225)
Q Consensus 194 ~~l~~a~~~~~~l~~~~~~~~~~~ 217 (225)
++|.+++|++++|++++|++++.+
T Consensus 170 a~l~~a~l~~a~l~~a~l~ga~l~ 193 (201)
T 2j8k_A 170 AALERANLTGANLEDANLEGTILE 193 (201)
T ss_dssp CBCTTCBCTTCBCTTCBCTTSTTT
T ss_pred CCCCCCCCCCCCcCCCEECcCCCC
Confidence 666666666666666666665543
|
| >2j8k_A NP275-NP276; pentapeptide repeat protein, PRP, right handed quadrilateral beta helix, RHQBH, toxin; HET: MES; 1.5A {Nostoc punctiforme} SCOP: b.80.8.1 PDB: 2j8i_A | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A | Back alignment and structure |
|---|
| >2bm5_A MFPA, RV3361C, pentapeptide repeat family protein; pentapeptide repeat protein, fluroquinolone resistance, DNA gyrase, DNA mimicry; 2.0A {Mycobacterium tuberculosis} SCOP: b.80.8.1 PDB: 2bm4_A 2bm6_A 2bm7_A | Back alignment and structure |
|---|
| >2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >3du1_X ALL3740 protein, HETL; right-handed beta helix, repeated five residue fold, pentape repeat protein, structural protein; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >2xty_A QNRB1; cell cycle, pentapeptide repeat, PRP, antibiotic resistance, handed quadrilateral beta-helix; 1.80A {Klebsiella pneumoniae} PDB: 2xtw_A 2xtx_A | Back alignment and structure |
|---|
| >2xt2_A ALBG, MCBG-like protein; cell cycle, right handed quadrilateral beta helix; 2.00A {Xanthomonas albilineans} PDB: 2xt4_A | Back alignment and structure |
|---|
| >2o6w_A Repeat five residue (RFR) protein or pentapeptide repeat protein; beta helix, unknown function; 2.40A {Cyanothece} | Back alignment and structure |
|---|
| >3pss_A QNR; pentapeptide repeat, antibiotic resistance, DNA topoisomeras cell cycle; HET: MLY; 2.00A {Aeromonas hydrophila} PDB: 3psz_A | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A | Back alignment and structure |
|---|
| >2f3l_A RFR-domain; beta helix, unknown function; 2.11A {Cyanothece SP} SCOP: b.80.8.1 PDB: 2g0y_A | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} SCOP: b.80.8.0 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A | Back alignment and structure |
|---|
| >3n90_A P15, thylakoid lumenal 15 kDa protein 1, chloroplastic; right-handed quadrilateral beta helix; 1.70A {Arabidopsis thaliana} SCOP: b.80.8.0 | Back alignment and structure |
|---|
| >3nb2_A Secreted effector protein; pentapeptide, HECT domain, HECT E ubiquitin ligase, ligase; HET: MES; 2.10A {Escherichia coli} PDB: 3naw_A* 3sqv_A | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A | Back alignment and structure |
|---|
| >2qyu_A Secreted effector protein; ubiquitin E3 ligase, ligase; HET: B3P; 2.10A {Salmonella typhimurium} PDB: 3sy2_A 2qza_A | Back alignment and structure |
|---|
| >3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A | Back alignment and structure |
|---|
| >3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A | Back alignment and structure |
|---|
| >1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 225 | ||||
| d1nn7a_ | 105 | d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus | 6e-17 | |
| d3kvta_ | 103 | d.42.1.2 (A:) akv3.1 voltage-gated potassium chann | 3e-16 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 6e-15 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 6e-11 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 2e-08 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 7e-05 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 0.001 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 0.001 | |
| d1t1da_ | 100 | d.42.1.2 (A:) Shaker potassium channel {California | 1e-13 | |
| d2f3la1 | 132 | b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya | 1e-12 | |
| d2f3la1 | 132 | b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya | 4e-12 | |
| d2f3la1 | 132 | b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya | 5e-07 | |
| d2f3la1 | 132 | b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya | 5e-05 | |
| d2f3la1 | 132 | b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cya | 1e-04 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 1e-08 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 7e-08 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 6e-07 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 5e-06 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 6e-06 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 2e-05 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 2e-05 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 5e-05 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 5e-05 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 7e-05 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 2e-04 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 3e-04 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 4e-04 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 5e-04 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 6e-04 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 0.004 |
| >d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 105 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: POZ domain superfamily: POZ domain family: Tetramerization domain of potassium channels domain: Potassium channel kv4.2 species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 71.5 bits (175), Expect = 6e-17
Identities = 18/61 (29%), Positives = 24/61 (39%)
Query: 12 GGYFMNPGDVDSTGAYLIDRSPTYFEPILNYLRNGQLVLDPNINPEGVLEEARFFGIESL 71
G + T Y DR P F ILN+ R G+L + EE FFG+
Sbjct: 27 GSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELAFFGLIPE 86
Query: 72 V 72
+
Sbjct: 87 I 87
|
| >d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Length = 103 | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Length = 100 | Back information, alignment and structure |
|---|
| >d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 | Back information, alignment and structure |
|---|
| >d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 | Back information, alignment and structure |
|---|
| >d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 | Back information, alignment and structure |
|---|
| >d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 | Back information, alignment and structure |
|---|
| >d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} Length = 132 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 225 | |||
| d2j8ka1 | 175 | NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} | 99.88 | |
| d2j8ka1 | 175 | NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} | 99.87 | |
| d2bm5a1 | 181 | Hypothetical protein Rv3361c (MT3469) {Mycobacteri | 99.86 | |
| d2bm5a1 | 181 | Hypothetical protein Rv3361c (MT3469) {Mycobacteri | 99.86 | |
| d2f3la1 | 132 | Lumenal RFR-domain protein {Cyanothece sp. atcc 51 | 99.82 | |
| d2f3la1 | 132 | Lumenal RFR-domain protein {Cyanothece sp. atcc 51 | 99.82 | |
| d3kvta_ | 103 | akv3.1 voltage-gated potassium channel {California | 99.32 | |
| d1nn7a_ | 105 | Potassium channel kv4.2 {Rat (Rattus norvegicus) [ | 99.25 | |
| d1t1da_ | 100 | Shaker potassium channel {California sea hare (Apl | 99.24 | |
| d1r29a_ | 122 | B-cell lymphoma 6 (Bcl6) protein BTB domain {Human | 89.81 |
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded right-handed beta-helix superfamily: Pentapeptide repeat-like family: Pentapeptide repeats domain: NP275-NP276 species: Nostoc punctiforme [TaxId: 272131]
Probab=99.88 E-value=1.4e-23 Score=158.94 Aligned_cols=71 Identities=49% Similarity=0.593 Sum_probs=28.2
Q ss_pred cceecCccccCCcccCccccccccCceeecccccccccccCcccCcccccCCCcCCccccCCccccccccc
Q psy17757 143 SVNLKGANLEGSNMAGVNLRVATLKNANLQNCDLRAAVLAGADLENCDLSGSDLHEANLRGANLKDAALEL 213 (225)
Q Consensus 143 ~a~~~~~~f~~~~l~~~~f~~a~l~~~~f~~~~l~~a~f~~~~l~~~~f~~~~l~~a~~~~~~l~~~~~~~ 213 (225)
++.+.+++|.++.|.+++|.+++|.+++|.+++|.++.+.+++|++++|.+++|.+++|.+++|++++|++
T Consensus 99 ~~~~~~~~~~~s~~~~~~f~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ga~l~~a~~~g 169 (175)
T d2j8ka1 99 QANLKAANLEQAILSHANIREADLSEANLEAADLSGADLAIADLHQANLHQAALERANLTGANLEDANLEG 169 (175)
T ss_dssp TCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTTCBCTT
T ss_pred ecccccccccCCEeCCCEeccCCCCCCccccCCCccccccccccCcCCcCCCEeCCCCcCCCCcCCCEEec
Confidence 33333333333333333333333333333333444444444444444444444444444444444444433
|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} | Back information, alignment and structure |
|---|
| >d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} | Back information, alignment and structure |
|---|
| >d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|