Psyllid ID: psy1778


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60------
MRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNKIT
cccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHccccccc
cccccccccccccEEccHHHHHHHHHHcccccccEEcccccccccHccHHHHHHHHHHHccccccc
mrmfpcplvtcgksflrSEHLQEHMLqhnenkpkftcpyqdclmSYVAKSSLYAHLKhvhstnkit
mrmfpcplvTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHlkhvhstnkit
MRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNKIT
****PCPLVTCGKSFLRSEHL**********KPKFTCPYQDCLMSYVAKSSLYAHLKHV*******
MRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYA************
MRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKH********
*RMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHV*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNKIT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query66 2.2.26 [Sep-21-2011]
Q8C8V1 858 Zinc finger protein ZXDC yes N/A 0.833 0.064 0.5 4e-09
Q2QGD7 858 Zinc finger protein ZXDC yes N/A 0.924 0.071 0.476 4e-09
A2CE44 873 Zinc finger X-linked prot no N/A 0.833 0.063 0.5 5e-09
P98168 799 Zinc finger X-linked prot no N/A 0.833 0.068 0.5 1e-08
P98169 803 Zinc finger X-linked prot no N/A 0.833 0.068 0.5 2e-08
Q8JJC0444 Zinc finger protein ZIC 1 no N/A 0.893 0.132 0.409 4e-06
P46684447 Zinc finger protein ZIC 1 no N/A 0.893 0.131 0.409 5e-06
Q15915447 Zinc finger protein ZIC 1 no N/A 0.893 0.131 0.409 5e-06
O95409 532 Zinc finger protein ZIC 2 no N/A 0.924 0.114 0.396 5e-06
O73689443 Zinc finger protein ZIC 1 N/A N/A 0.924 0.137 0.396 5e-06
>sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 Back     alignment and function desciption
 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 2   RMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLK 57
           R F CP+  CGKSF R+EHL+ H + H   KP F CP + C   + A+SSLY H K
Sbjct: 387 RRFTCPVEGCGKSFTRAEHLKGHSITHLGTKP-FECPVEGCCARFSARSSLYIHSK 441




Cooperates with CIITA to promote transcription of MHC class I and MHC class II genes.
Mus musculus (taxid: 10090)
>sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 Back     alignment and function description
>sp|A2CE44|ZXDAB_MOUSE Zinc finger X-linked protein ZXDA/ZXDB OS=Mus musculus GN=Zxda PE=2 SV=1 Back     alignment and function description
>sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 Back     alignment and function description
>sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 Back     alignment and function description
>sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 Back     alignment and function description
>sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 Back     alignment and function description
>sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 Back     alignment and function description
>sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 Back     alignment and function description
>sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
358411693 813 PREDICTED: zinc finger protein ZXDC-like 0.833 0.067 0.517 4e-09
297488860 813 PREDICTED: zinc finger protein ZXDC [Bos 0.833 0.067 0.517 5e-09
440894004 606 Zinc finger protein ZXDC, partial [Bos g 0.833 0.090 0.517 2e-08
301617720 868 PREDICTED: zinc finger protein ZXDC-like 0.833 0.063 0.5 5e-08
346644784 842 zinc finger protein ZXDC [Sus scrofa] 0.833 0.065 0.5 9e-08
119599767 487 ZXD family zinc finger C [Homo sapiens] 0.878 0.119 0.5 1e-07
194227951 455 PREDICTED: zinc finger X-linked protein 0.833 0.120 0.5 1e-07
363738707 633 PREDICTED: zinc finger protein ZXDC, par 0.833 0.086 0.5 1e-07
348551971 492 PREDICTED: zinc finger X-linked protein 0.833 0.111 0.5 1e-07
39644629 522 ZXDC protein [Homo sapiens] gi|39644897| 0.878 0.111 0.5 1e-07
>gi|358411693|ref|XP_003582092.1| PREDICTED: zinc finger protein ZXDC-like [Bos taurus] Back     alignment and taxonomy information
 Score = 65.5 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 36/56 (64%), Gaps = 1/56 (1%)

Query: 2   RMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLK 57
           R FPCP+  CGKSF R+EHL+ H + H   KP F CP + C   + A+SSLY H K
Sbjct: 350 RRFPCPVEGCGKSFTRAEHLKGHSVTHLGTKP-FACPVEGCCARFSARSSLYIHAK 404




Source: Bos taurus

Species: Bos taurus

Genus: Bos

Family: Bovidae

Order:

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|297488860|ref|XP_002697199.1| PREDICTED: zinc finger protein ZXDC [Bos taurus] gi|296474643|tpg|DAA16758.1| TPA: ZXD family zinc finger C-like [Bos taurus] Back     alignment and taxonomy information
>gi|440894004|gb|ELR46580.1| Zinc finger protein ZXDC, partial [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|301617720|ref|XP_002938278.1| PREDICTED: zinc finger protein ZXDC-like [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|346644784|ref|NP_001231151.1| zinc finger protein ZXDC [Sus scrofa] Back     alignment and taxonomy information
>gi|119599767|gb|EAW79361.1| ZXD family zinc finger C [Homo sapiens] Back     alignment and taxonomy information
>gi|194227951|ref|XP_001914790.1| PREDICTED: zinc finger X-linked protein ZXDB, partial [Equus caballus] Back     alignment and taxonomy information
>gi|363738707|ref|XP_414374.3| PREDICTED: zinc finger protein ZXDC, partial [Gallus gallus] Back     alignment and taxonomy information
>gi|348551971|ref|XP_003461802.1| PREDICTED: zinc finger X-linked protein ZXDB-like, partial [Cavia porcellus] Back     alignment and taxonomy information
>gi|39644629|gb|AAH12729.2| ZXDC protein [Homo sapiens] gi|39644897|gb|AAH02940.2| ZXDC protein [Homo sapiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
UNIPROTKB|F1MWD7 749 ZXDC "Uncharacterized protein" 0.833 0.073 0.517 1.7e-10
UNIPROTKB|G3MYH0 760 ZXDC "Uncharacterized protein" 0.833 0.072 0.517 1.7e-10
UNIPROTKB|H0YAA9 418 ZXDC "Zinc finger protein ZXDC 0.863 0.136 0.508 2.8e-10
UNIPROTKB|F1NW59 652 ZXDC "Uncharacterized protein" 0.954 0.096 0.446 4.7e-10
RGD|1563355 583 Zxdb "zinc finger, X-linked, d 0.833 0.094 0.5 8.3e-10
RGD|1585677 583 LOC683516 "similar to Zinc fin 0.833 0.094 0.5 8.3e-10
RGD|1585685 583 LOC683508 "similar to Zinc fin 0.833 0.094 0.5 8.3e-10
UNIPROTKB|Q2QGD7 858 ZXDC "Zinc finger protein ZXDC 0.863 0.066 0.508 8.8e-10
UNIPROTKB|E2R2S7 779 ZXDB "Uncharacterized protein" 0.924 0.078 0.460 1.3e-09
UNIPROTKB|G3X6Q6 805 LOC510362 "Uncharacterized pro 0.924 0.075 0.460 1.3e-09
UNIPROTKB|F1MWD7 ZXDC "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 159 (61.0 bits), Expect = 1.7e-10, P = 1.7e-10
 Identities = 29/56 (51%), Positives = 36/56 (64%)

Query:     2 RMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLK 57
             R FPCP+  CGKSF R+EHL+ H + H   KP F CP + C   + A+SSLY H K
Sbjct:   307 RRFPCPVEGCGKSFTRAEHLKGHSVTHLGTKP-FACPVEGCCARFSARSSLYIHAK 361


GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|G3MYH0 ZXDC "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H0YAA9 ZXDC "Zinc finger protein ZXDC" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NW59 ZXDC "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1563355 Zxdb "zinc finger, X-linked, duplicated B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1585677 LOC683516 "similar to Zinc finger X-linked protein ZXDB" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1585685 LOC683508 "similar to Zinc finger X-linked protein ZXDB" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2QGD7 ZXDC "Zinc finger protein ZXDC" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2S7 ZXDB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3X6Q6 LOC510362 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 66
KOG2462|consensus279 99.78
KOG2462|consensus279 99.6
KOG3623|consensus1007 99.42
KOG3623|consensus1007 99.35
PHA0276855 hypothetical protein; Provisional 99.24
KOG1074|consensus 958 99.19
KOG3576|consensus267 99.16
PHA00733128 hypothetical protein 99.09
KOG1074|consensus958 99.08
KOG3576|consensus267 98.94
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.89
PHA0061644 hypothetical protein 98.87
PHA0061644 hypothetical protein 98.7
KOG3608|consensus 467 98.67
PHA0073279 hypothetical protein 98.56
KOG3993|consensus 500 98.4
KOG3608|consensus 467 98.33
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.31
PHA0276855 hypothetical protein; Provisional 98.19
COG5189423 SFP1 Putative transcriptional repressor regulating 98.19
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.08
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.06
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.95
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.91
PLN03086567 PRLI-interacting factor K; Provisional 97.9
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.88
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.86
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.86
PHA00733128 hypothetical protein 97.78
smart0035526 ZnF_C2H2 zinc finger. 97.7
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.66
PLN03086567 PRLI-interacting factor K; Provisional 97.51
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.04
PRK04860160 hypothetical protein; Provisional 97.01
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.76
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.45
PHA0073279 hypothetical protein 96.4
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.98
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.91
COG5048 467 FOG: Zn-finger [General function prediction only] 95.12
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.88
KOG3993|consensus 500 94.67
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 94.27
KOG2893|consensus 341 94.21
COG5048 467 FOG: Zn-finger [General function prediction only] 92.45
COG404965 Uncharacterized protein containing archaeal-type C 92.15
COG5189423 SFP1 Putative transcriptional repressor regulating 91.38
KOG1146|consensus 1406 90.41
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 84.26
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 82.24
PF1526954 zf-C2H2_7: Zinc-finger 81.59
KOG4167|consensus907 80.72
>KOG2462|consensus Back     alignment and domain information
Probab=99.78  E-value=1.2e-19  Score=88.88  Aligned_cols=59  Identities=36%  Similarity=0.672  Sum_probs=55.3

Q ss_pred             cccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHHhhCCCCCC
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNKIT   66 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~~~~~~   66 (66)
                      |.+|.  .||+.|+..+-|+-|+++|+|++| |.|..  |++.|...++|..|++||.+.|+|+
T Consensus       187 ~c~C~--iCGKaFSRPWLLQGHiRTHTGEKP-F~C~h--C~kAFADRSNLRAHmQTHS~~K~~q  245 (279)
T KOG2462|consen  187 PCECG--ICGKAFSRPWLLQGHIRTHTGEKP-FSCPH--CGKAFADRSNLRAHMQTHSDVKKHQ  245 (279)
T ss_pred             Ccccc--cccccccchHHhhcccccccCCCC-ccCCc--ccchhcchHHHHHHHHhhcCCcccc
Confidence            56677  999999999999999999999999 99988  9999999999999999999999885



>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF15269 zf-C2H2_7: Zinc-finger Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-07
2i13_A 190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-04
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure

Iteration: 1

Score = 50.4 bits (119), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 2/61 (3%) Query: 4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTN 63 FPCP CGK F RSE+L+ H H KP F C ++ C + S H+ HVH+++ Sbjct: 91 FPCPFPGCGKIFARSENLKIHKRTHTGEKP-FKCEFEGCDRRFANSSDRKKHM-HVHTSD 148 Query: 64 K 64 K Sbjct: 149 K 149
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-04
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 5e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 7e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-04
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 2e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-04
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
 Score = 47.9 bits (115), Expect = 1e-09
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 3/62 (4%)

Query: 4  FPCPLVTCGKSFLRSEHLQEHM-LQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHST 62
           PC    CG+ F   ++L  H   QH   K  F+CP   C  S+  K  L  H   +HS 
Sbjct: 8  MPCDFPGCGRIFSNRQYLNHHKKYQHIHQKS-FSCPEPACGKSFNFKKHLKEH-MKLHSD 65

Query: 63 NK 64
           +
Sbjct: 66 TR 67


>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query66
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.91
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.84
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.81
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.8
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.78
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.78
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.76
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.76
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.76
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.76
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.76
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.75
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.73
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.73
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.73
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.71
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.7
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.7
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.69
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.69
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.69
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.68
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.68
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.68
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.67
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.67
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.67
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.67
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.67
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.67
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.67
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.66
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.66
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.66
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.66
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.65
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.65
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.64
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.64
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.63
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.62
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.61
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.6
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.6
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.59
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.59
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 99.58
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.58
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.58
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.57
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.57
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.56
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.56
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.54
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.54
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.53
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.53
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.47
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.46
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.46
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.39
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.38
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.37
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.35
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.35
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.35
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.35
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.35
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.34
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.34
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.34
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.34
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.34
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.34
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.34
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.34
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.33
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.33
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.33
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.32
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.32
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.32
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.32
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.31
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.31
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.31
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.31
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.3
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.3
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.3
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.29
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.29
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.29
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.29
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.29
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.28
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.27
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.27
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.26
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.26
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.26
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.26
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.25
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.25
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.25
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.25
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.24
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.24
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.23
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.23
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.23
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.23
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.22
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.22
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.22
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.22
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.22
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.21
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.21
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 99.21
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 99.2
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.2
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.2
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.2
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 99.19
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.18
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.18
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.17
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 99.17
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.15
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.15
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.14
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.13
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.12
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.12
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 99.1
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.09
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.07
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 99.06
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.06
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.05
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 99.05
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.05
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.04
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.02
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.01
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 99.0
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.0
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.99
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.99
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.99
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.97
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.96
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.96
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.96
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.95
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.95
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.94
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.94
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.94
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.93
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 98.93
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.93
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.92
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.92
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.92
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.91
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.91
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.9
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.9
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.89
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.89
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.88
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.88
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.88
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 98.87
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 98.87
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.84
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.84
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.84
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.83
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.32
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 98.82
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.8
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.79
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.28
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.78
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.78
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.77
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.77
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.77
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.76
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.76
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.76
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.76
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.75
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.75
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.74
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.74
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.73
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.71
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 98.15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.69
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.67
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.65
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.64
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.6
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.6
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.0
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.57
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.53
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.53
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.52
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.51
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.51
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.45
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.43
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.43
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.37
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.36
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.69
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.11
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.68
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.24
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.17
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.73
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.59
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.2
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.79
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 91.71
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 90.73
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 90.72
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 90.21
4i1l_A93 Scurfin, forkhead box protein P3; FOXP3, dimerizat 89.53
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 86.96
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 86.25
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 86.17
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.41
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
Probab=99.91  E-value=1.1e-24  Score=86.84  Aligned_cols=58  Identities=29%  Similarity=0.531  Sum_probs=54.9

Q ss_pred             CCcccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHHhhCCC
Q psy1778           1 MRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTN   63 (66)
Q Consensus         1 ~~~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~~~   63 (66)
                      ||||.|.  .|++.|.....|..|+++|++++| |.|..  |++.|...+.|..|+++|+++.
T Consensus         2 EKpy~C~--~C~k~F~~~~~L~~H~~~Ht~ekp-~~C~~--C~k~F~~~~~L~~H~~~Htgep   59 (60)
T 4gzn_C            2 ERPFFCN--FCGKTYRDASGLSRHRRAHLGYRP-RSCPE--CGKCFRDQSEVNRHLKVHQNKP   59 (60)
T ss_dssp             CCCEECT--TTCCEESSHHHHHHHHHHHHTCCC-EECTT--TCCEESSHHHHHHHGGGGSCC-
T ss_pred             CCCccCC--CCCCEeCCHHHHHHHHHHhCCCcC-eECCC--CCCCcCCHHHHHHHhCccCCCC
Confidence            7999999  999999999999999999999999 99987  9999999999999999988764



>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>4i1l_A Scurfin, forkhead box protein P3; FOXP3, dimerization, complex ensemble, stability, regulatory activity, acetyation, DNA-binding, metal-binding; 2.10A {Mus musculus} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 66
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-05
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 4e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 7e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 8e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.001
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 692, ZNF692
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 35.5 bits (82), Expect = 2e-05
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 4  FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPY 39
          F CP   CGKSF   +HL+EHM  H++ +  + C +
Sbjct: 2  FSCPEPACGKSFNFKKHLKEHMKLHSDTRD-YICEF 36


>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query66
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.84
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.56
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.53
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.51
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.5
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.5
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.49
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.49
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.48
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.47
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.46
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.45
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.43
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.43
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.41
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.4
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.4
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.38
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.38
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.37
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.37
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.37
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.37
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.36
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.36
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.36
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.34
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.32
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.31
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.3
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.28
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.25
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.22
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.17
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.16
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.13
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.07
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.94
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.75
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.75
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.74
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.73
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.69
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.62
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.61
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.58
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.55
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.53
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.53
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.52
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 98.5
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.47
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.39
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.36
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.35
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 98.32
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.31
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 98.3
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.27
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.25
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.24
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.14
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.13
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 98.05
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.99
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.99
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.94
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.92
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.91
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.9
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.89
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.87
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.84
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.76
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.74
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.74
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.68
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.64
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.51
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.45
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.41
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.41
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.35
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.28
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.27
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.25
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.22
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.16
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.13
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.1
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.07
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.94
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 96.93
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.49
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.4
d1y0jb136 U-shaped transcription factor, different fingers { 95.36
d2glia132 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.97
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.8
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 94.12
d1x3ca161 Zinc finger protein 292, ZNF292 {Human (Homo sapie 93.96
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.74
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 93.53
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 91.19
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 88.8
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 87.34
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 85.92
d1wira_121 Protein arginine N-methyltransferase 3 {Mouse (Mus 81.54
d1fu9a_36 U-shaped transcription factor, different fingers { 81.0
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.84  E-value=2.5e-21  Score=74.46  Aligned_cols=53  Identities=32%  Similarity=0.685  Sum_probs=50.2

Q ss_pred             CCcccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHHh
Q psy1778           1 MRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHV   59 (66)
Q Consensus         1 ~~~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~   59 (66)
                      ||||.|.   ||+.|.....|..|+++|++++| |.|..  |++.|...+.|..|+++|
T Consensus         1 EK~y~C~---Cgk~F~~~~~l~~H~~~Ht~ekp-y~C~~--C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ---CGKSFTHKSQRDRHMSMHLGLRP-YGCGV--CGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT---TSCEESSHHHHHHHHHHHSCCCS-EECTT--TSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC---CCCeECCHHHhHHHhhccccccC-CcCCC--cCCEecCHHHHHHHHhcC
Confidence            7999993   99999999999999999999999 99987  999999999999999875



>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure