Psyllid ID: psy17795

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520---
MKYDHKNGYLKLKMTDDNARYSMKYDHKNGYLKLKMTDDNVCLIYKTEMSQDLKKIDNAKKHVESCDFDWGPSEGHKIPTSFPGLTQTFVSCGWTTNDTTPGPLKGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYYPSADLQKFVLDMVQEYKINIRYLQEFWDIIHQQICISLYWTWYRNTRSTYGIYRNSLHWVQEAVYFTLEIRSDVVILMHSLYSMAILVTVMATEATRQQSVYYGCIVRKQQTSEISHYVEKPSTFVSTLVNCGVYLFSLDIFQNIAAVFQSKQDEFYNGNYMVNGKDTDFNHIQLEKEIIMPLAGSGKAYVYQTSKWWSQLKSAGSAIYANRHYLQLYKTRHPERLQCSSQCKTIGDVYIHSSASVHPTAIVGPNVSIDDGAVIGPGVRIKESIILQGASIGNHSLVLNSIVGRNSKVGNWSRVEGTPCDPNPNKAFAKMDNPPLFNSNGKLNPSITILGDGVTVPGELIVLNSIVLPYKELTRSFKNEILL
ccccccccEEEEEEccccccEEEEEcccccEEEEEEEcccEEEEEEEEccccccccccccccccccccccccccccccccccccccEEEEEEccEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccHHHHHHcccccccccEEEEEEEcccHHHHHHHHHHccccccEEEEEEccccccccEEEEEccccccEEEEEEccccccccccccEEEEEcHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHcccccccccEEccccEEEccEEEccccEEccccEEcccEEEccccEEccccEEcccEEccccEEccccEEEccEEccccEEccccEEccccccccccccccccccccccccccccccccEEEccccEEcccEEEEccEEccccEEcccccccccc
ccccccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEEEccccccccccHHHccccccccccccccccccccccccccEEEEccccEEEEEEEcccccEcccccccccccccccccccHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHcHHcccccccHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHcccEEEEEEEEcccccccccEEEEEcccccEEEEEEEccccccccEEccEEEEEcHHHHHHHHHHHHHcHHHHcHHcccccccccccccccHHHHHHHHHHccccEEEEEcccHHHHcccccHHHHHHHHHHHHHHHcccHHHccccccEEEccEEEccccEEccccEEcccEEEcccEEEcccEEEEEEEEEcccEEccccEEEEEEEEcccEccEEEEEcccccccccccccccccccccEcccccEcccEEEEcccEEEccEEEEEccEEccccHccccccccEcc
mkydhkngylklkmtddnarysmkydhkngylklkmtddnvCLIYKTEMSQDLKKIDNAKKHvescdfdwgpseghkiptsfpgltqtfvscgwttndttpgplkgtrfrplsldspkplfpvaglpmIQHHIEACVQVPNLKEIIIlgyypsadLQKFVLDMVQEYKINIRYLQEFWDIIHQQICISLYWTWYRNTRSTYGIYRNSLHWVQEAVYFTLEIRSDVVILMHSLYSMAILVTVMATEATRQQSVYYGCIVRKQQtseishyvekpstfVSTLVNCGVYLFSLDIFQNIAAVFQSkqdefyngnymvngkdtdfnhIQLEKEIImplagsgkaYVYQTSKWWSQLKSAGSAIYANRHYLQLYktrhperlqcssqcktigdvyihssasvhptaivgpnvsiddgavigpgvrikESIILQGASIGNHSLVLNSIVgrnskvgnwsrvegtpcdpnpnkafakmdnpplfnsngklnpsitilgdgvtvpgeLIVLNSIVLPYKELTRSFKNEILL
mkydhkngylklkmtddnarysMKYDHKNGYLKLKMTDDNVCLIYKTEMSQDLKKIDNAKKHVESCDFDWGPSEGHKIPTSFPGLTQTFVSCGWTTNDTTPGPLKGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYYPSADLQKFVLDMVQEYKINIRYLQEFWDIIHQQICISLYWTWYRNTRSTYGIYRNSLHWVQEAVYFTLEIRSDVVILMHSLYSMAILVTVMATEATRQQSVYYGCIVRKQQTSEISHYVEKPSTFVSTLVNCGVYLFSLDIFQNIAAVFQSKQDEFYNGNYMVNGKDTDFNHIQLEKEIIMPLAGSGKAYVYQTSKWWSQLKSAGSAIYANRHYLQLYKTRHPERLQCSSQCKTIGDVYIHSSASVHPTAIVGPNVSIDDGAVIGPGVRIKESIILQGASIGNHSLVLNSIVGRNSKVGNWSRVEGTPCDPNPNKAFAKMDNPPLFNSNGKLNPSITILGDGVTVPGELIVLNsivlpykeltrsfkneill
MKYDHKNGYLKLKMTDDNARYSMKYDHKNGYLKLKMTDDNVCLIYKTEMSQDLKKIDNAKKHVESCDFDWGPSEGHKIPTSFPGLTQTFVSCGWTTNDTTPGPLKGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYYPSADLQKFVLDMVQEYKINIRYLQEFWDIIHQQICISLYWTWYRNTRSTYGIYRNSLHWVQEAVYFTLEIRSDVVILMHSLYSMAILVTVMATEATRQQSVYYGCIVRKQQTSEISHYVEKPSTFVSTLVNCGVYLFSLDIFQNIAAVFQSKQDEFYNGNYMVNGKDTDFNHIQLEKEIIMPLAGSGKAYVYQTSKWWSQLKSAGSAIYANRHYLQLYKTRHPERLQCSSQCKTIGDVYIHSSASVHPTAIVGPNVSIDDGAVIGPGVRIKESIILQGASIGNHSLVLNSIVGRNSKVGNWSRVEGTPCDPNPNKAFAKMDNPPLFNSNGKLNPSITILGDGVTVPGELIVLNSIVLPYKELTRSFKNEILL
*****************NARYSMKYDHKNGYLKLKMTDDNVCLIYKTEMSQDLKKIDNAKKHVESCDFDWGPSEGHKIPTSFPGLTQTFVSCGWTTNDTTP******RFR*L*L**PKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYYPSADLQKFVLDMVQEYKINIRYLQEFWDIIHQQICISLYWTWYRNTRSTYGIYRNSLHWVQEAVYFTLEIRSDVVILMHSLYSMAILVTVMATEATRQQSVYYGCIVRKQQTSEISHYVEKPSTFVSTLVNCGVYLFSLDIFQNIAAVFQSKQDEFYNGNYMVNGKDTDFNHIQLEKEIIMPLAGSGKAYVYQTSKWWSQLKSAGSAIYANRHYLQLYKTRHPERLQCSSQCKTIGDVYIHSSASVHPTAIVGPNVSIDDGAVIGPGVRIKESIILQGASIGNHSLVLNSIVGRNSKVGNWSRV***************************LNPSITILGDGVTVPGELIVLNSIVLPYKELTRS*******
******NGYLKLKMTDDNARYSMKYDHKNGYLKLKMTDDNVCLIYKTEMSQDLKKIDNAKKHVESC*********************TFVSCGWTTNDTTPGPLKGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYYPSADLQKFVLDMVQEYKINIRYLQEFWDIIHQQICISLYWTWYRNTRSTYGIYRNSLHWVQEAVYFTLEIRSDVVILMHSLYSMAILVTVMATEATRQQSVYYGCIVRKQQTSEISHYVEKPSTFVSTLVNCGVYLFSLDIFQNIAAVFQ***********MVNGKDTDFNHIQLEKEIIMPLAGSGKAYVYQTSKWWSQLKSAGSAIYANRHYLQLYKTRHP*RLQCSSQCKTIGDVYIHSSASVHPTAIVGPNVSIDDGAVIGPGVRIKESIILQGASIGNHSLVLNSIVGRNSKVGNWSRVEGTPCDPNPNKAFAKMDNPPLFNSNGKLNPSITILGDGVTVPGELIVLNSIVLPYKELTRSFKNEILL
MKYDHKNGYLKLKMTDDNARYSMKYDHKNGYLKLKMTDDNVCLIYKTEMSQDLKKIDNAKKHVESCDFDWGPSEGHKIPTSFPGLTQTFVSCGWTTNDTTPGPLKGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYYPSADLQKFVLDMVQEYKINIRYLQEFWDIIHQQICISLYWTWYRNTRSTYGIYRNSLHWVQEAVYFTLEIRSDVVILMHSLYSMAILVTVMATEATRQQSVYYGCIVRKQQTSEISHYVEKPSTFVSTLVNCGVYLFSLDIFQNIAAVFQSKQDEFYNGNYMVNGKDTDFNHIQLEKEIIMPLAGSGKAYVYQTSKWWSQLKSAGSAIYANRHYLQLYKTRHPERLQCSSQCKTIGDVYIHSSASVHPTAIVGPNVSIDDGAVIGPGVRIKESIILQGASIGNHSLVLNSIVGRNSKVGNWSRVEGTPCDPNPNKAFAKMDNPPLFNSNGKLNPSITILGDGVTVPGELIVLNSIVLPYKELTRSFKNEILL
*KY*HKNGYLKLKMTDDNARYSMKYDHKNGYLKLKMTDDNVCLIYKTEMSQDLKKIDNAKKHVESCDFDWGPSEGHKIPTSFPGLTQTFVSCGWTTNDTTPGPLKGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYYPSADLQKFVLDMVQEYKINIRYLQEFWDIIHQQICISLYWTWYRNTRSTYGIYRNSLHWVQEAVYFTLEIRSDVVILMHSLYSMAILVTVMATEATRQQSVYYGCIVRKQQTSEISHYVEKPSTFVSTLVNCGVYLFSLDIFQNIAAVFQSKQDEFYNGN***NGKDTDFNHIQLEKEIIMPLAGSGKAYVYQTSKWWSQLKSAGSAIYANRHYLQLYKTRHPERLQCSSQCKTIGDVYIHSSASVHPTAIVGPNVSIDDGAVIGPGVRIKESIILQGASIGNHSLVLNSIVGRNSKVGNWSRVEGTPCDPNPNKAFAKMDNPPLFNSNGKLNPSITILGDGVTVPGELIVLNSIVLPYKELTRSFKNEIL*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYDHKNGYLKLKMTDDNARYSMKYDHKNGYLKLKMTDDNVCLIYKTEMSQDLKKIDNAKKHVESCDFDWGPSEGHKIPTSFPGLTQTFVSCGWTTNDTTPGPLKGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYYPSADLQKFVLDMVQEYKINIRYLQEFWDIIHQQICISLYWTWYRNTRSTYGIYRNSLHWVQEAVYFTLEIRSDVVILMHSLYSMAILVTVMATEATRQQSVYYGCIVRKQQTSEISHYVEKPSTFVSTLVNCGVYLFSLDIFQNIAAVFQSKQDEFYNGNYMVNGKDTDFNHIQLEKEIIMPLAGSGKAYVYQTSKWWSQLKSAGSAIYANRHYLQLYKTRHPERLQCSSQCKTIGDVYIHSSASVHPTAIVGPNVSIDDGAVIGPGVRIKESIILQGASIGNHSLVLNSIVGRNSKVGNWSRVEGTPCDPNPNKAFAKMDNPPLFNSNGKLNPSITILGDGVTVPGELIVLNSIVLPYKELTRSFKNEILL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query523 2.2.26 [Sep-21-2011]
Q6GMK8422 Mannose-1-phosphate guany yes N/A 0.760 0.943 0.496 1e-114
Q0VFM6421 Mannose-1-phosphate guany yes N/A 0.762 0.947 0.503 1e-112
Q66KG5426 Mannose-1-phosphate guany N/A N/A 0.772 0.948 0.503 1e-112
Q7SXP8422 Mannose-1-phosphate guany no N/A 0.768 0.952 0.494 1e-111
Q6DKE9421 Mannose-1-phosphate guany N/A N/A 0.766 0.952 0.505 1e-110
Q5XIC1420 Mannose-1-phosphate guany yes N/A 0.760 0.947 0.473 1e-104
B0CM52420 Mannose-1-phosphate guany N/A N/A 0.768 0.957 0.466 1e-103
Q922H4420 Mannose-1-phosphate guany yes N/A 0.764 0.952 0.468 1e-103
Q96IJ6420 Mannose-1-phosphate guany yes N/A 0.768 0.957 0.466 1e-103
Q86HG0412 Mannose-1-phosphate guany yes N/A 0.741 0.941 0.369 6e-72
>sp|Q6GMK8|GMPAA_DANRE Mannose-1-phosphate guanyltransferase alpha-A OS=Danio rerio GN=gmppaa PE=2 SV=1 Back     alignment and function desciption
 Score =  413 bits (1062), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 217/437 (49%), Positives = 294/437 (67%), Gaps = 39/437 (8%)

Query: 102 GPLKGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYY-PSADLQKFV 160
           GP KGTRFRPLS + PKPLFPVAG+PM+QHHIEAC ++PN+KEI+++G+Y P+ +L +F+
Sbjct: 10  GPQKGTRFRPLSFEVPKPLFPVAGVPMLQHHIEACSKLPNMKEILLIGFYQPNEELNRFL 69

Query: 161 LDMVQEYKINIRYLQEFWDIIHQQICISLYWTWYRNTRSTYGIY--RNSLHWVQEAVYFT 218
               Q++KI+IRYLQE                 Y    +  GIY  R+ +       +F 
Sbjct: 70  SCAQQDFKISIRYLQE-----------------YAALGTGGGIYHFRDQILSGGPDAFFV 112

Query: 219 L------EIRSDVVILMHSLYSMAILVTVMATEATRQQSVYYGCIVRKQQTSEISHYVEK 272
           +      E     ++     +       ++ T A R+QS+ YGCIV  +QT E+ HYVEK
Sbjct: 113 MNADVCSEFPLPEMLDFQKEHGDTYSFVILGTTANRKQSLNYGCIVENEQTDEVLHYVEK 172

Query: 273 PSTFVSTLVNCGVYLFSLDIFQNIAAVFQSKQDEFYNGNYMVNGKDTDFNH----IQLEK 328
           P TFVS ++NCG+YLF+ +IFQ+I +VFQ  Q E      M+  + ++  H    I+LE+
Sbjct: 173 PGTFVSDIINCGIYLFTPEIFQHIGSVFQKNQQE------MLLEEQSNGWHRAEVIRLEQ 226

Query: 329 EIIMPLAGSGKAYVYQTSKWWSQLKSAGSAIYANRHYLQLYKTRHPERLQCSSQ--CKTI 386
           +I   LAG GK YVY+T ++WSQ+KSAGSAIYA+R YL  Y   HPERL  +++   KT 
Sbjct: 227 DIFTALAGQGKLYVYKTDRFWSQIKSAGSAIYASRLYLNQYHKTHPERLATNTEGGAKTR 286

Query: 387 GDVYIHSSASVHPTAIVGPNVSIDDGAVIGPGVRIKESIILQGASIGNHSLVLNSIVGRN 446
           G+VYIH +A++ PTA++GPNVSI  G  IG GVR++ESIIL GA++ +HS VLNSIVG  
Sbjct: 287 GNVYIHPTANIDPTAVLGPNVSIGTGVTIGAGVRVRESIILHGATLQDHSCVLNSIVGWE 346

Query: 447 SKVGNWSRVEGTPCDPNPNKAFAKMDNPPLFNSNGKLNPSITILGDGVTVPGELIVLNSI 506
           S +G W+RVEGTP DPNPN  +AK+D+  LF  +GKL PSITILG  V +P E+I+LNSI
Sbjct: 347 STIGKWARVEGTPSDPNPNDPYAKIDSETLFR-DGKLTPSITILGCNVNIPSEVIILNSI 405

Query: 507 VLPYKELTRSFKNEILL 523
           VLP+K+L RSFKN+I+L
Sbjct: 406 VLPHKDLNRSFKNQIIL 422

Danio rerio (taxid: 7955)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 1EC: 3
>sp|Q0VFM6|GMPPA_XENTR Mannose-1-phosphate guanyltransferase alpha OS=Xenopus tropicalis GN=gmppa PE=2 SV=1 Back     alignment and function description
>sp|Q66KG5|GMPAB_XENLA Mannose-1-phosphate guanyltransferase alpha-B OS=Xenopus laevis GN=gmppa-b PE=2 SV=1 Back     alignment and function description
>sp|Q7SXP8|GMPAB_DANRE Mannose-1-phosphate guanyltransferase alpha-B OS=Danio rerio GN=gmppab PE=2 SV=1 Back     alignment and function description
>sp|Q6DKE9|GMPAA_XENLA Mannose-1-phosphate guanyltransferase alpha-A OS=Xenopus laevis GN=gmppa-a PE=2 SV=1 Back     alignment and function description
>sp|Q5XIC1|GMPPA_RAT Mannose-1-phosphate guanyltransferase alpha OS=Rattus norvegicus GN=Gmppa PE=2 SV=1 Back     alignment and function description
>sp|B0CM52|GMPPA_PAPAN Mannose-1-phosphate guanyltransferase alpha OS=Papio anubis GN=GMPPA PE=3 SV=1 Back     alignment and function description
>sp|Q922H4|GMPPA_MOUSE Mannose-1-phosphate guanyltransferase alpha OS=Mus musculus GN=Gmppa PE=2 SV=1 Back     alignment and function description
>sp|Q96IJ6|GMPPA_HUMAN Mannose-1-phosphate guanyltransferase alpha OS=Homo sapiens GN=GMPPA PE=1 SV=1 Back     alignment and function description
>sp|Q86HG0|GMPPA_DICDI Mannose-1-phosphate guanyltransferase alpha OS=Dictyostelium discoideum GN=gmppA PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query523
242011549421 glucose-1-phosphate adenylyltransferase, 0.768 0.954 0.571 1e-136
321477774422 hypothetical protein DAPPUDRAFT_191301 [ 0.772 0.957 0.574 1e-135
170049370429 mannose-1-phosphate guanyltransferase [C 0.770 0.939 0.553 1e-134
157130856429 mannose-1-phosphate guanyltransferase [A 0.770 0.939 0.546 1e-134
57909371428 AGAP011723-PA [Anopheles gambiae str. PE 0.770 0.941 0.547 1e-133
91094119415 PREDICTED: similar to AGAP011723-PA [Tri 0.759 0.956 0.559 1e-133
380012036425 PREDICTED: mannose-1-phosphate guanyltra 0.776 0.955 0.563 1e-130
307170931419 Mannose-1-phosphate guanyltransferase al 0.772 0.964 0.563 1e-130
380012034420 PREDICTED: mannose-1-phosphate guanyltra 0.772 0.961 0.567 1e-129
312373319465 hypothetical protein AND_17581 [Anophele 0.764 0.860 0.543 1e-129
>gi|242011549|ref|XP_002426511.1| glucose-1-phosphate adenylyltransferase, putative [Pediculus humanus corporis] gi|212510637|gb|EEB13773.1| glucose-1-phosphate adenylyltransferase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  491 bits (1264), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 247/432 (57%), Positives = 309/432 (71%), Gaps = 30/432 (6%)

Query: 102 GPLKGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYYPSADLQKFVL 161
           GPLKGTRFRPLSLD  KPLF VAG P+IQHHIEAC+ + NLKEIIILGYYP+ +   F+ 
Sbjct: 10  GPLKGTRFRPLSLDIAKPLFSVAGFPIIQHHIEACLSLSNLKEIIILGYYPANEFSTFIQ 69

Query: 162 DMVQEYKINIRYLQEFWDIIHQQICISLYWTWYRNTRSTYGIYRNSLHWVQEAVYFTLEI 221
           +MVQEYKINIRYLQEF  +                T      +R+ +       +F L  
Sbjct: 70  EMVQEYKINIRYLQEFTPL---------------GTAGGLYHFRDQIKIGNPKAFFVL-- 112

Query: 222 RSDV--------VILMHSLYSMAILVTVMATEATRQQSVYYGCIVRKQQTSEISHYVEKP 273
             DV        ++  H L+  A L T++ TEATRQQS+ YGC+V  + TSE++HYVEKP
Sbjct: 113 NGDVCMNFPLQELLDAHQLHEDA-LGTIVVTEATRQQSLNYGCVVLNKNTSEVAHYVEKP 171

Query: 274 STFVSTLVNCGVYLFSLDIFQNIAAVFQSKQDEFYNGNYMVNGKDTDFNHIQLEKEIIMP 333
            TFVS L+NCGVY+FS+DIFQ +  +F  KQ  F +   + NG   + + I LEKEI++P
Sbjct: 172 ETFVSPLINCGVYIFSVDIFQTMKEIFDKKQTSFCSN--LSNGNGNESSLINLEKEILLP 229

Query: 334 LAGSGKAYVYQTSKWWSQLKSAGSAIYANRHYLQLYKTRHPERL--QCSSQCKTIGDVYI 391
           +AG GK + Y+T KWWSQLK+AGSAIYANRHYL LY+   PERL    + QC  IGDV+I
Sbjct: 230 MAGIGKLFAYKTVKWWSQLKTAGSAIYANRHYLSLYQQSTPERLAENVNGQCTIIGDVFI 289

Query: 392 HSSASVHPTAIVGPNVSIDDGAVIGPGVRIKESIILQGASIGNHSLVLNSIVGRNSKVGN 451
           H +A+V  +A++GPNVSI   AV+GPGVRI+ESIIL GA +  H L+L SI+G  S++G 
Sbjct: 290 HPTATVDQSAVLGPNVSIGKNAVVGPGVRIRESIILSGACLQEHCLILYSIIGCFSQIGK 349

Query: 452 WSRVEGTPCDPNPNKAFAKMDNPPLFNSNGKLNPSITILGDGVTVPGELIVLNSIVLPYK 511
           W+RVEGTPCDPNPNK FAKMDNPPLFN++G+LNPSIT+LG  VT+  E+IVLNSIVLP+K
Sbjct: 350 WARVEGTPCDPNPNKPFAKMDNPPLFNNDGRLNPSITVLGCNVTISSEIIVLNSIVLPHK 409

Query: 512 ELTRSFKNEILL 523
           ELTR+FKNEI+L
Sbjct: 410 ELTRNFKNEIIL 421

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|321477774|gb|EFX88732.1| hypothetical protein DAPPUDRAFT_191301 [Daphnia pulex] Back     alignment and taxonomy information
>gi|170049370|ref|XP_001855817.1| mannose-1-phosphate guanyltransferase [Culex quinquefasciatus] gi|167871239|gb|EDS34622.1| mannose-1-phosphate guanyltransferase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157130856|ref|XP_001662032.1| mannose-1-phosphate guanyltransferase [Aedes aegypti] gi|94469014|gb|ABF18356.1| GDP-mannose pyrophosphorylase A [Aedes aegypti] gi|108871743|gb|EAT35968.1| AAEL011912-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|57909371|ref|XP_552528.1| AGAP011723-PA [Anopheles gambiae str. PEST] gi|55234963|gb|EAL38887.1| AGAP011723-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|91094119|ref|XP_968179.1| PREDICTED: similar to AGAP011723-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380012036|ref|XP_003690096.1| PREDICTED: mannose-1-phosphate guanyltransferase alpha-A-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|307170931|gb|EFN63031.1| Mannose-1-phosphate guanyltransferase alpha [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380012034|ref|XP_003690095.1| PREDICTED: mannose-1-phosphate guanyltransferase alpha-A-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|312373319|gb|EFR21081.1| hypothetical protein AND_17581 [Anopheles darlingi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query523
FB|FBgn0034035438 CG8207 [Drosophila melanogaste 0.558 0.666 0.579 2e-117
ZFIN|ZDB-GENE-040704-37422 gmppaa "GDP-mannose pyrophosph 0.783 0.971 0.517 2.5e-106
ZFIN|ZDB-GENE-040426-1550422 gmppab "GDP-mannose pyrophosph 0.768 0.952 0.496 2.6e-102
UNIPROTKB|E1BEN4420 GMPPA "Uncharacterized protein 0.764 0.952 0.478 8.7e-95
RGD|1560644420 Gmppa "GDP-mannose pyrophospho 0.766 0.954 0.481 1.1e-94
UNIPROTKB|E2R1D1420 GMPPA "Uncharacterized protein 0.768 0.957 0.475 6.1e-94
UNIPROTKB|Q96IJ6420 GMPPA "Mannose-1-phosphate gua 0.768 0.957 0.470 6.1e-94
MGI|MGI:1916330420 Gmppa "GDP-mannose pyrophospho 0.770 0.959 0.479 7.8e-94
UNIPROTKB|I3LUP1419 GMPPA "Uncharacterized protein 0.774 0.966 0.480 7e-93
WB|WBGene00021628401 Y47D9A.1 [Caenorhabditis elega 0.380 0.496 0.57 3e-89
FB|FBgn0034035 CG8207 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 898 (321.2 bits), Expect = 2.0e-117, Sum P(2) = 2.0e-117
 Identities = 179/309 (57%), Positives = 226/309 (73%)

Query:   230 HSLYSMAILVTVMATEATRQQSVYYGCIVRKQQTSEISHYVEKPSTFVSTLVNCGVYLFS 289
             H     + LVT+M+TEATRQQS++YGC+V  + +  +SHYVEKPS++VST +NCGVY+ S
Sbjct:   132 HEKRPASALVTIMSTEATRQQSLHYGCLVFDRSSGAVSHYVEKPSSYVSTFINCGVYVCS 191

Query:   290 LDIFQNIAAVFQSKQDE-----FYNGNYMVNGKDTDFNHIQLEKEIIMPLAGSGKAYVYQ 344
             +DIF  +A +F S+  E     F NGN   NG++    HI+ E+E++ PLAG+ K +   
Sbjct:   192 MDIFTVLAQIFHSRGQEYSCQAFCNGNGNGNGREQ--GHIKWEQEVLTPLAGTDKLFAMP 249

Query:   345 TSKWWSQLKSAGSAIYANRHYLQLYKTRHPERL----------QCSSQCKTIGDVYIHSS 394
                WWSQLK+AGSAIYANRHYL LYK  HPERL            S  C    DVY+H S
Sbjct:   250 VPNWWSQLKTAGSAIYANRHYLGLYKKTHPERLANVGIKRGEGDGSLICTVHPDVYVHPS 309

Query:   395 ASVHPTAIVGPNVSIDDGAVIGPGVRIKESIILQGASIGNHSLVLNSIVGRNSKVGNWSR 454
             A+VH +A++GPNV+I  G  IGPGVRI+ESI+L+ A I +H+LVL+SIVGR S +G W+R
Sbjct:   310 ATVHHSAVLGPNVAIGPGVTIGPGVRIRESIVLEQAQILDHTLVLHSIVGRGSTIGAWAR 369

Query:   455 VEGTPCDPNPNKAFAKMDNPPLFNSNGKLNPSITILGDGVTVPGELIVLNSIVLPYKELT 514
             VEGTP DP+PNK FAKM+NPPLFN+ GKLNPSITILG  V VP E I+LNSIVLP+KEL+
Sbjct:   370 VEGTPSDPDPNKPFAKMENPPLFNNEGKLNPSITILGCFVQVPAEKILLNSIVLPHKELS 429

Query:   515 RSFKNEILL 523
             RSFKNEI+L
Sbjct:   430 RSFKNEIIL 438
GO:0004475 "mannose-1-phosphate guanylyltransferase activity" evidence=ISS
GO:0009058 "biosynthetic process" evidence=IEA
ZFIN|ZDB-GENE-040704-37 gmppaa "GDP-mannose pyrophosphorylase Aa" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1550 gmppab "GDP-mannose pyrophosphorylase Ab" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BEN4 GMPPA "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1560644 Gmppa "GDP-mannose pyrophosphorylase A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R1D1 GMPPA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q96IJ6 GMPPA "Mannose-1-phosphate guanyltransferase alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1916330 Gmppa "GDP-mannose pyrophosphorylase A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3LUP1 GMPPA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00021628 Y47D9A.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q86HG0GMPPA_DICDI2, ., 7, ., 7, ., 1, 30.36950.74180.9417yesN/A
Q922H4GMPPA_MOUSE2, ., 7, ., 7, ., 1, 30.46880.76480.9523yesN/A
O60064YBB2_SCHPO2, ., 7, ., 7, ., 1, 30.31850.76290.9637yesN/A
Q96IJ6GMPPA_HUMAN2, ., 7, ., 7, ., 1, 30.46630.76860.9571yesN/A
Q6GMK8GMPAA_DANRE2, ., 7, ., 7, ., 1, 30.49650.76090.9431yesN/A
Q0VFM6GMPPA_XENTR2, ., 7, ., 7, ., 1, 30.50340.76290.9477yesN/A
Q5XIC1GMPPA_RAT2, ., 7, ., 7, ., 1, 30.47350.76090.9476yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.70.921
3rd Layer2.7.7.130.914

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query523
cd06428257 cd06428, M1P_guanylylT_A_like_N, N-terminal domain 1e-101
COG1208358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph 1e-41
cd04181217 cd04181, NTP_transferase, NTP_transferases catalyz 6e-22
cd0582480 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate 2e-19
TIGR01208353 TIGR01208, rmlA_long, glucose-1-phosphate thymidyl 9e-16
pfam00483247 pfam00483, NTP_transferase, Nucleotidyl transferas 2e-15
TIGR01173451 TIGR01173, glmU, UDP-N-acetylglucosamine diphospho 7e-13
cd06425233 cd06425, M1P_guanylylT_B_like_N, N-terminal domain 1e-12
TIGR03992393 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph 2e-12
PRK00892 343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco 2e-12
cd0335679 cd03356, LbH_G1P_AT_C_like, Left-handed parallel b 3e-12
cd05636163 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-pho 8e-10
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 1e-09
cd06422221 cd06422, NTP_transferase_like_1, NTP_transferase_l 1e-09
TIGR02091361 TIGR02091, glgC, glucose-1-phosphate adenylyltrans 2e-09
cd05636163 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-pho 7e-09
cd04189236 cd04189, G1P_TT_long, G1P_TT_long represents the l 8e-09
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uri 9e-09
TIGR03992393 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph 1e-08
TIGR01853 324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo 9e-08
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph 1e-07
PRK05289 262 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr 1e-07
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase 2e-07
pfam0548676 pfam05486, SRP9-21, Signal recognition particle 9 2e-07
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl 2e-07
cd0335679 cd03356, LbH_G1P_AT_C_like, Left-handed parallel b 4e-07
COG0448393 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb 4e-07
cd04645153 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra 4e-07
cd06426220 cd06426, NTP_transferase_like_2, NTP_trnasferase_l 5e-07
cd03351 254 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin 5e-07
cd02523229 cd02523, PC_cytidylyltransferase, Phosphocholine c 6e-07
cd0020878 cd00208, LbetaH, Left-handed parallel beta-Helix ( 6e-07
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl 7e-07
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl 8e-07
cd06425233 cd06425, M1P_guanylylT_B_like_N, N-terminal domain 1e-06
COG1209286 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel 1e-06
cd02507216 cd02507, eIF-2B_gamma_N_like, The N-terminal of eI 2e-06
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph 3e-06
TIGR03570193 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia 5e-06
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 6e-06
cd04651104 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly 6e-06
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase 9e-06
COG1043 260 COG1043, LpxA, Acyl-[acyl carrier protein] 1e-05
cd00710167 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases ( 1e-05
PRK14354458 PRK14354, glmU, bifunctional N-acetylglucosamine-1 1e-05
TIGR01852 254 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei 2e-05
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 3e-05
COG0663176 COG0663, PaaY, Carbonic anhydrases/acetyltransfera 3e-05
cd02540229 cd02540, GT2_GlmU_N_bac, N-terminal domain of bact 3e-05
cd0465281 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, 5e-05
pfam0013236 pfam00132, Hexapep, Bacterial transferase hexapept 6e-05
cd04197217 cd04197, eIF-2B_epsilon_N, The N-terminal domain o 7e-05
COG1044 338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 1e-04
PRK05293380 PRK05293, glgC, glucose-1-phosphate adenylyltransf 2e-04
COG4750231 COG4750, LicC, CTP:phosphocholine cytidylyltransfe 2e-04
TIGR01853 324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo 3e-04
cd06915223 cd06915, NTP_transferase_WcbM_like, WcbM_like is a 3e-04
cd00710167 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases ( 4e-04
COG0663176 COG0663, PaaY, Carbonic anhydrases/acetyltransfera 4e-04
cd0578779 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit 4e-04
TIGR03991337 TIGR03991, alt_bact_glmU, UDP-N-acetylglucosamine 4e-04
PRK14356456 PRK14356, glmU, bifunctional N-acetylglucosamine-1 5e-04
cd02516218 cd02516, CDP-ME_synthetase, CDP-ME synthetase is i 7e-04
cd03354101 cd03354, LbH_SAT, Serine acetyltransferase (SAT): 0.001
cd04198214 cd04198, eIF-2B_gamma_N, The N-terminal domain of 0.001
cd02517239 cd02517, CMP-KDO-Synthetase, CMP-KDO synthetase ca 0.001
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uri 0.002
PRK12461 255 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltr 0.002
PLN02694294 PLN02694, PLN02694, serine O-acetyltransferase 0.002
PRK14355459 PRK14355, glmU, bifunctional N-acetylglucosamine-1 0.002
cd04189236 cd04189, G1P_TT_long, G1P_TT_long represents the l 0.003
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uri 0.003
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph 0.003
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase 0.003
PLN02357360 PLN02357, PLN02357, serine acetyltransferase 0.003
pfam0013236 pfam00132, Hexapep, Bacterial transferase hexapept 0.004
cd04745155 cd04745, LbH_paaY_like, paaY-like: This group is c 0.004
>gnl|CDD|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information 
 Score =  303 bits (779), Expect = e-101
 Identities = 124/281 (44%), Positives = 166/281 (59%), Gaps = 47/281 (16%)

Query: 102 GPLKGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYYPSADLQKFVL 161
           GP KGTRFRPLSLD PKPLFPVAG PMI HHIEAC +VP+LKE++++G+YP +    F+ 
Sbjct: 7   GPQKGTRFRPLSLDVPKPLFPVAGKPMIHHHIEACAKVPDLKEVLLIGFYPESVFSDFIS 66

Query: 162 DMVQEYKINIRYLQEFWDIIHQQICISLYWTWYRNTRSTYGIYRNSLHWVQEAVYFTLEI 221
           D  QE+ + IRYLQE                 Y+   +  G+Y           +F  +I
Sbjct: 67  DAQQEFNVPIRYLQE-----------------YKPLGTAGGLY-----------HFRDQI 98

Query: 222 RS---DVVILMHS-------LYSM-------AILVTVMATEATRQQSVYYGCIVRKQQTS 264
            +       ++++       L  +           T++ TEA+R+Q+  YGCIV    T 
Sbjct: 99  LAGNPSAFFVLNADVCCDFPLQELLEFHKKHGASGTILGTEASREQASNYGCIVEDPSTG 158

Query: 265 EISHYVEKPSTFVSTLVNCGVYLFSLDIFQNIAAVFQSKQDEFYNGNYMVNGKDTDFNHI 324
           E+ HYVEKP TFVS L+NCGVYLFS +IF  I   FQS+Q E   G+        +   I
Sbjct: 159 EVLHYVEKPETFVSDLINCGVYLFSPEIFDTIKKAFQSRQQEAQLGDDNNREGRAE--VI 216

Query: 325 QLEKEIIMPLAGSGKAYVYQTSKWWSQLKSAGSAIYANRHY 365
           +LE++++ PLAGSGK YVY+T  +WSQ+K+AGSAIYANR Y
Sbjct: 217 RLEQDVLTPLAGSGKLYVYKTDDFWSQIKTAGSAIYANRLY 257

N-terminal domain of the M1P-guanylyltransferase A-isoform like proteins: The proteins of this family are likely to be a isoform of GDP-mannose pyrophosphorylase. Their sequences are highly conserved with mannose-1-phosphate guanyltransferase, but generally about 40-60 bases longer. GDP-mannose pyrophosphorylase (GTP: alpha-d-mannose-1-phosphate guanyltransferase) catalyzes the formation of GDP-d-mannose from GTP and alpha-d-mannose-1-Phosphate. It contains an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH fold domain. GDP-d-mannose is the activated form of mannose for formation of cell wall lipoarabinomannan and various mannose-containing glycolipids and polysaccharides. The function of GDP-mannose pyrophosphorylase is essential for cell wall integrity, morphogenesis and viability. Repression of GDP-mannose pyrophosphorylase in yeast leads to phenotypes including cell lysis, defective cell wall, and failure of polarized growth and cell separation. Length = 257
>gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>gnl|CDD|100062 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>gnl|CDD|215940 pfam00483, NTP_transferase, Nucleotidyl transferase Back     alignment and domain information
>gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|218605 pfam05486, SRP9-21, Signal recognition particle 9 kDa protein (SRP9) Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>gnl|CDD|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>gnl|CDD|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|223973 COG1043, LpxA, Acyl-[acyl carrier protein] Back     alignment and domain information
>gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|223735 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU Back     alignment and domain information
>gnl|CDD|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) Back     alignment and domain information
>gnl|CDD|133040 cd04197, eIF-2B_epsilon_N, The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|227093 COG4750, LicC, CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>gnl|CDD|223735 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|234432 TIGR03991, alt_bact_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|237686 PRK14356, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133009 cd02516, CDP-ME_synthetase, CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>gnl|CDD|100045 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>gnl|CDD|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>gnl|CDD|133010 cd02517, CMP-KDO-Synthetase, CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178297 PLN02694, PLN02694, serine O-acetyltransferase Back     alignment and domain information
>gnl|CDD|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|215205 PLN02357, PLN02357, serine acetyltransferase Back     alignment and domain information
>gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) Back     alignment and domain information
>gnl|CDD|100058 cd04745, LbH_paaY_like, paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 523
KOG1460|consensus407 100.0
KOG1322|consensus371 100.0
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 100.0
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 100.0
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PLN02241436 glucose-1-phosphate adenylyltransferase 100.0
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 100.0
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 100.0
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14358481 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 100.0
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 100.0
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 100.0
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
COG1209286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope 100.0
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
KOG1461|consensus 673 100.0
TIGR01105297 galF UTP-glucose-1-phosphate uridylyltransferase, 100.0
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_gu 100.0
KOG1462|consensus433 100.0
PRK15480292 glucose-1-phosphate thymidylyltransferase RfbA; Pr 100.0
PRK10122297 GalU regulator GalF; Provisional 100.0
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1 100.0
PF00483248 NTP_transferase: Nucleotidyl transferase This Pros 100.0
TIGR01207286 rmlA glucose-1-phosphate thymidylyltransferase, sh 100.0
cd02538240 G1P_TT_short G1P_TT_short is the short form of glu 100.0
PRK13389302 UTP--glucose-1-phosphate uridylyltransferase subun 99.98
cd02541267 UGPase_prokaryotic Prokaryotic UGPase catalyses th 99.97
TIGR01099260 galU UTP-glucose-1-phosphate uridylyltransferase. 99.97
cd04189236 G1P_TT_long G1P_TT_long represents the long form o 99.97
TIGR02623254 G1P_cyt_trans glucose-1-phosphate cytidylyltransfe 99.97
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a 99.97
COG1210291 GalU UDP-glucose pyrophosphorylase [Cell envelope 99.96
cd02524253 G1P_cytidylyltransferase G1P_cytidylyltransferase 99.96
cd04181217 NTP_transferase NTP_transferases catalyze the tran 99.96
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily 99.96
cd06426220 NTP_transferase_like_2 NTP_trnasferase_like_2 is a 99.95
cd04197217 eIF-2B_epsilon_N The N-terminal domain of epsilon 99.93
cd02523229 PC_cytidylyltransferase Phosphocholine cytidylyltr 99.93
cd04183231 GT2_BcE_like GT2_BcbE_like is likely involved in t 99.91
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is in 99.91
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf 99.89
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 99.89
cd02507216 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma 99.87
cd04198214 eIF-2B_gamma_N The N-terminal domain of gamma subu 99.86
PRK05450245 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.86
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 99.85
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th 99.85
COG1213239 Predicted sugar nucleotidyltransferases [Cell enve 99.84
KOG3465|consensus86 99.79
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.79
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 99.78
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 99.74
COG0836333 {ManC} Mannose-1-phosphate guanylyltransferase [Ce 99.73
PLN02917293 CMP-KDO synthetase 99.72
COG4750231 LicC CTP:phosphocholine cytidylyltransferase invol 99.69
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 99.68
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.67
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 99.66
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.66
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.65
PRK12461255 UDP-N-acetylglucosamine acyltransferase; Provision 99.64
TIGR01852254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 99.64
TIGR01852254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 99.64
TIGR01853324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 99.64
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 99.64
PRK05289262 UDP-N-acetylglucosamine acyltransferase; Provision 99.62
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 99.61
PRK05289262 UDP-N-acetylglucosamine acyltransferase; Provision 99.6
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 99.6
PRK13627196 carnitine operon protein CaiE; Provisional 99.6
TIGR01853324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 99.59
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.59
cd04745155 LbH_paaY_like paaY-like: This group is composed by 99.59
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 99.57
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 99.57
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.57
COG1043260 LpxA Acyl-[acyl carrier protein] 99.56
PLN02296269 carbonate dehydratase 99.55
PF0548679 SRP9-21: Signal recognition particle 9 kDa protein 99.54
PLN02472246 uncharacterized protein 99.53
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 99.53
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 99.52
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 99.51
COG1043 260 LpxA Acyl-[acyl carrier protein] 99.5
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 99.5
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 99.49
PRK12461255 UDP-N-acetylglucosamine acyltransferase; Provision 99.48
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 99.47
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 99.47
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 99.47
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 99.46
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 99.46
cd04745155 LbH_paaY_like paaY-like: This group is composed by 99.45
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 99.45
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.44
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 99.43
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 99.43
PLN02296269 carbonate dehydratase 99.41
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 99.41
PRK09382378 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp 99.4
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 99.4
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.4
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 99.39
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 99.39
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 99.39
TIGR00466238 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe 99.37
PRK00155227 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 99.37
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 99.36
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.36
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 99.36
PLN02472246 uncharacterized protein 99.36
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 99.35
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 99.35
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.34
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 99.34
TIGR00453217 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 99.34
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 99.33
KOG1462|consensus433 99.32
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.32
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 99.32
KOG1461|consensus 673 99.31
PRK13627196 carnitine operon protein CaiE; Provisional 99.31
PRK14358481 glmU bifunctional N-acetylglucosamine-1-phosphate 99.31
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in 99.3
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 99.29
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 99.29
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.28
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 99.28
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 99.26
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 99.26
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 99.25
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 99.25
PRK10502182 putative acyl transferase; Provisional 99.25
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 99.24
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 99.23
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 99.23
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 99.22
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.2
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 99.19
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 99.18
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 99.18
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 99.18
PF12804160 NTP_transf_3: MobA-like NTP transferase domain; PD 99.18
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 99.16
PLN02728252 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.16
TIGR00454183 conserved hypothetical protein TIGR00454. At this 99.15
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 99.15
PRK13385230 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.14
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 99.14
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.14
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 99.13
PF01128221 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidyly 99.12
cd02513223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- 99.11
PLN02694294 serine O-acetyltransferase 99.11
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 99.11
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 99.08
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 99.06
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 99.06
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 99.05
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 99.05
PRK11132273 cysE serine acetyltransferase; Provisional 99.04
COG1211230 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt 99.03
PRK10092183 maltose O-acetyltransferase; Provisional 99.03
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 99.01
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 99.0
PRK10502182 putative acyl transferase; Provisional 99.0
COG1212247 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase 98.99
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 98.98
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 98.98
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protei 98.98
PLN02739355 serine acetyltransferase 98.97
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 98.96
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 98.95
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 98.94
TIGR03584222 PseF pseudaminic acid CMP-transferase. The sequenc 98.94
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 98.93
PRK10191146 putative acyl transferase; Provisional 98.92
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 98.9
PLN02241436 glucose-1-phosphate adenylyltransferase 98.89
PRK11132273 cysE serine acetyltransferase; Provisional 98.89
KOG4042|consensus190 98.88
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 98.88
PLN02357360 serine acetyltransferase 98.88
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 98.88
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 98.87
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 98.87
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 98.87
PRK10191146 putative acyl transferase; Provisional 98.86
COG2266177 GTP:adenosylcobinamide-phosphate guanylyltransfera 98.85
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 98.85
PLN02739355 serine acetyltransferase 98.8
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 98.79
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB 98.79
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 98.78
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 98.77
cd04180266 UGPase_euk_like Eukaryotic UGPase-like includes UD 98.77
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthes 98.77
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 98.76
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 98.76
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 98.75
KOG3121|consensus184 98.74
PLN02357360 serine acetyltransferase 98.74
cd02503181 MobA MobA catalyzes the formation of molybdopterin 98.73
cd04193323 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catala 98.71
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 98.71
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 98.69
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 98.69
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 98.67
PRK00560196 molybdopterin-guanine dinucleotide biosynthesis pr 98.67
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 98.66
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 98.66
PRK10092183 maltose O-acetyltransferase; Provisional 98.64
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 98.63
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 98.62
TIGR02665186 molyb_mobA molybdopterin-guanine dinucleotide bios 98.61
PLN02694294 serine O-acetyltransferase 98.6
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 98.59
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 98.58
COG2068199 Uncharacterized MobA-related protein [General func 98.56
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis pr 98.56
PLN02474469 UTP--glucose-1-phosphate uridylyltransferase 98.52
COG1083228 NeuA CMP-N-acetylneuraminic acid synthetase [Cell 98.51
KOG4750|consensus269 98.46
PTZ00339482 UDP-N-acetylglucosamine pyrophosphorylase; Provisi 98.45
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 98.44
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 98.43
KOG4042|consensus190 98.42
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 98.31
COG0746192 MobA Molybdopterin-guanine dinucleotide biosynthes 98.27
cd02518233 GT2_SpsF SpsF is a glycosyltrnasferase implicated 98.27
KOG1460|consensus407 98.26
KOG3121|consensus184 98.12
TIGR02353 695 NRPS_term_dom non-ribosomal peptide synthetase ter 98.06
TIGR02353695 NRPS_term_dom non-ribosomal peptide synthetase ter 98.01
KOG1322|consensus371 97.97
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 97.89
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 97.88
cd00897300 UGPase_euk Eukaryotic UGPase catalyses the synthes 97.77
COG4801 277 Predicted acyltransferase [General function predic 97.76
PRK14500346 putative bifunctional molybdopterin-guanine dinucl 97.66
KOG4750|consensus269 97.65
PF02348217 CTP_transf_3: Cytidylyltransferase; InterPro: IPR0 97.64
PF01704420 UDPGP: UTP--glucose-1-phosphate uridylyltransferas 97.58
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 97.38
PLN02435493 probable UDP-N-acetylglucosamine pyrophosphorylase 97.36
PF0013236 Hexapep: Bacterial transferase hexapeptide (six re 97.28
COG1861241 SpsF Spore coat polysaccharide biosynthesis protei 97.25
PF0013236 Hexapep: Bacterial transferase hexapeptide (six re 97.23
COG4284472 UDP-glucose pyrophosphorylase [Carbohydrate transp 97.04
cd06424315 UGGPase UGGPase catalyzes the synthesis of UDP-Glu 97.02
PF1460234 Hexapep_2: Hexapeptide repeat of succinyl-transfer 97.01
COG4801 277 Predicted acyltransferase [General function predic 96.83
PRK13412 974 fkp bifunctional fucokinase/L-fucose-1-P-guanylylt 96.58
KOG2638|consensus498 96.27
PLN02830615 UDP-sugar pyrophosphorylase 95.08
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 89.81
PRK00576178 molybdopterin-guanine dinucleotide biosynthesis pr 89.19
>KOG1460|consensus Back     alignment and domain information 
Probab=100.00  E-value=9.2e-60  Score=444.26  Aligned_cols=394  Identities=47%  Similarity=0.828  Sum_probs=348.8

Q ss_pred             cceeEEEEecCCCCCCcCCCCCCCCCcccceeCCcchHHHHHHHHhcCCCccEEEEEccCChHHHHHHHHhhhhccCeeE
Q psy17795         92 CGWTTNDTTPGPLKGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYYPSADLQKFVLDMVQEYKINI  171 (523)
Q Consensus        92 ~~m~~iila~g~g~g~R~~~lT~~~pK~ll~i~g~pli~~~l~~~~~~~g~~~i~vv~~~~~~~i~~~l~~~~~~~~~~i  171 (523)
                      |..+||||.+|+-+||||+||+.+.||||+||+|+|||+|.++++.+.++..+|+++.-|+++.+.+|+....+++.+.+
T Consensus         1 ~~~~AVIlVGGP~kGTRFRPLSf~vPKPLfpiaG~pmI~Hhi~ac~qi~~l~eI~LvGFy~e~~f~~fis~~~~e~~~pv   80 (407)
T KOG1460|consen    1 MKVKAVILVGGPQKGTRFRPLSFNVPKPLFPIAGVPMIHHHISACKQISGLAEILLVGFYEERVFTDFISAIQQEFKVPV   80 (407)
T ss_pred             CceEEEEEecCCCCCccccccccCCCCCccccCCcchhhhhHHHHhcccchhheeEEecccchHHHHHHHHHHhhcccch
Confidence            45689999999999999999999999999999999999999999999999999999999999999999998777788999


Q ss_pred             EEEecccccchhhhhcccccccccCCCchhHHH--Hhhcc-cCCcceEEEEc--cchHH----HHHHHHhcCCcceEEEE
Q psy17795        172 RYLQEFWDIIHQQICISLYWTWYRNTRSTYGIY--RNSLH-WVQEAVYFTLE--IRSDV----VILMHSLYSMAILVTVM  242 (523)
Q Consensus       172 ~~~~~~~~~g~~~~~~~~~~~~~~g~~ta~al~--~~~i~-~~~d~~~Lvl~--i~~D~----l~~~h~~~~~~~~~tv~  242 (523)
                      +|++++.++|                 ||+.|+  ++.|- +.++. ++++|  ++|||    |++.|+.++  ..++++
T Consensus        81 rYL~E~~plG-----------------taGgLyhFrdqIl~g~ps~-vFvlnaDVCcsfPl~~ml~ahr~~g--~~~tll  140 (407)
T KOG1460|consen   81 RYLREDNPLG-----------------TAGGLYHFRDQILAGSPSA-VFVLNADVCCSFPLQDMLEAHRRYG--GIGTLL  140 (407)
T ss_pred             hhhccCCCCC-----------------cccceeehhhHHhcCCCce-EEEEecceecCCcHHHHHHHHhhcC--CceEEE
Confidence            9999999999                 999999  77765 66777 99999  88888    999999988  999999


Q ss_pred             EEeeCCCCCcceeEEEEcCCCCcEEEEeecCCCcccceeeeeEEEeeHHHHHHHHHhhccccc-ccccccccccCCCC-C
Q psy17795        243 ATEATRQQSVYYGCIVRKQQTSEISHYVEKPSTFVSTLVNCGVYLFSLDIFQNIAAVFQSKQD-EFYNGNYMVNGKDT-D  320 (523)
Q Consensus       243 ~~~~~~~~~~~~g~v~~d~~~~~V~~~~ekp~~~~~~l~~~Giyif~~~il~~l~~~~~~~~~-e~~~~~~~~~~~~~-~  320 (523)
                      ++++.+++.++||.++.|++|++|+++.|||..+.++.++||+|+|++++|+.+.+.+...++ +-...+++  +-|. .
T Consensus       141 ~tkvs~e~asnfG~lV~dP~t~evlHYveKPsTfvSd~InCGvYlF~~eif~~i~~v~~q~~~~~~~~~~~~--~l~~g~  218 (407)
T KOG1460|consen  141 VTKVSREQASNFGCLVEDPSTGEVLHYVEKPSTFVSDIINCGVYLFTPEIFNAIAEVYRQRQDLLEVEKDLP--LLQPGP  218 (407)
T ss_pred             EEEecHhHhhccCeeeecCCcCceEEeecCcchhhhcccceeEEEecHHHHHHHHHHHHHHHhhhhhhhccc--ccCCCc
Confidence            999998899999999999889999999999999999999999999999999999887665422 00000111  1111 3


Q ss_pred             cccccchhhhhhhhhcCCcEEEEEcchhHhhhccchhhhhccHHHHhhhcccCCcccccCCC--ceEecCcEECCCCEEC
Q psy17795        321 FNHIQLEKEIIMPLAGSGKAYVYQTSKWWSQLKSAGSAIYANRHYLQLYKTRHPERLQCSSQ--CKTIGDVYIHSSASVH  398 (523)
Q Consensus       321 ~~~~~~~~dil~~li~~g~v~~~~~~g~w~dIgt~~dyl~an~~~l~~~~~~~~~~~~~~~~--~~i~~~~~i~~~~~I~  398 (523)
                      .+...+++|++..|+.++++|+|...++|..+.|+.+.+.+++.||+.+....|.++...++  +.|.++++|+|++.++
T Consensus       219 ~d~irLeqDvlspLag~k~lY~y~t~~fW~QiKtagsal~as~lYLs~yk~t~p~~Lak~pgt~a~IigdVyIhPsakvh  298 (407)
T KOG1460|consen  219 ADFIRLEQDVLSPLAGSKQLYAYETTDFWSQIKTAGSALYASRLYLSQYKRTHPARLAKGPGTQAEIIGDVYIHPSAKVH  298 (407)
T ss_pred             cceEEeechhhhhhcCCCceEEEecccHHHHhccccceeehhhhHHHHHhhcCchhhcCCCCCCceEEeeeEEcCcceeC
Confidence            45678899999999999999999999999999999999999999999988888877765444  4599999999999999


Q ss_pred             CCCEECCCcEECCCCEECCCCEEeeeEECCCCEECCCCEEeceEECCCCEECCCcEEcCCCCCCCCCCCceecCCCCeec
Q psy17795        399 PTAIVGPNVSIDDGAVIGPGVRIKESIILQGASIGNHSLVLNSIVGRNSKVGNWSRVEGTPCDPNPNKAFAKMDNPPLFN  478 (523)
Q Consensus       399 ~~~~I~~~~~Ig~~~~I~~~~~I~~s~Ig~~~~Ig~~~~I~~~iIg~~~~Ig~~~~i~~~~~~~~~~~~~v~I~~~~~ig  478 (523)
                      |+++||+|+.||+++.||+++.|.+|+|-++|.|.+|+.+.+|+||.++.||.++++.+....++...+..         
T Consensus       299 ptAkiGPNVSIga~vrvg~GvRl~~sIIl~d~ei~enavVl~sIigw~s~iGrWaRVe~~pv~~s~~~~~~---------  369 (407)
T KOG1460|consen  299 PTAKIGPNVSIGANVRVGPGVRLRESIILDDAEIEENAVVLHSIIGWKSSIGRWARVEGIPVEPSPNLPFA---------  369 (407)
T ss_pred             CccccCCCceecCCceecCCceeeeeeeccCcEeeccceEEeeeecccccccceeeecccccccCCCCCcc---------
Confidence            99999999999999999999999999999999999999999999999999999999988765544322211         


Q ss_pred             CCCeecCCcEEeCCCCEECCCcEEeCeEEcCCcEeCCCCCCcccC
Q psy17795        479 SNGKLNPSITILGDGVTVPGELIVLNSIVLPYKELTRSFKNEILL  523 (523)
Q Consensus       479 ~~~~i~~g~~iIG~~~~Ig~~~~i~~~~v~~~~~i~~~~~~~~i~  523 (523)
                             ..+++|+.|.+++.+.|.+|++.|+++++.++.++|||
T Consensus       370 -------a~Tilga~v~v~dev~v~~s~vlp~k~l~vs~~~eIil  407 (407)
T KOG1460|consen  370 -------ALTILGADVSVEDEVIVLNSIVLPNKELNVSVQDEIIL  407 (407)
T ss_pred             -------eeEEecccceecceeEEeeeeEecCCccceeeecceeC
Confidence                   22899999999999999999999999999999999986

>KOG1322|consensus Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>KOG1461|consensus Back     alignment and domain information
>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>KOG1462|consensus Back     alignment and domain information
>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>PRK10122 GalU regulator GalF; Provisional Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry Back     alignment and domain information
>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional Back     alignment and domain information
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3465|consensus Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02917 CMP-KDO synthetase Back     alignment and domain information
>COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>PF05486 SRP9-21: Signal recognition particle 9 kDa protein (SRP9); InterPro: IPR008832 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase Back     alignment and domain information
>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1462|consensus Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>KOG1461|consensus Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>TIGR00454 conserved hypothetical protein TIGR00454 Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01128 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; InterPro: IPR001228 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, a bacterial ispD protein, catalyzes the third step of the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis; the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate [] Back     alignment and domain information
>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR03584 PseF pseudaminic acid CMP-transferase Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>KOG4042|consensus Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>KOG3121|consensus Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>cd04193 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>COG2068 Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>PLN02474 UTP--glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG4750|consensus Back     alignment and domain information
>PTZ00339 UDP-N-acetylglucosamine pyrophosphorylase; Provisional Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>KOG4042|consensus Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>KOG1460|consensus Back     alignment and domain information
>KOG3121|consensus Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>KOG1322|consensus Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>cd00897 UGPase_euk Eukaryotic UGPase catalyses the synthesis of UDP-Glucose Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>PRK14500 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MoaC/MobA; Provisional Back     alignment and domain information
>KOG4750|consensus Back     alignment and domain information
>PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2 Back     alignment and domain information
>PF01704 UDPGP: UTP--glucose-1-phosphate uridylyltransferase; InterPro: IPR002618 This family consists of UTP--glucose-1-phosphate uridylyltransferases (2 Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>PLN02435 probable UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix Back     alignment and domain information
>COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix Back     alignment and domain information
>COG4284 UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06424 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/UDP-Galactose Back     alignment and domain information
>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional Back     alignment and domain information
>KOG2638|consensus Back     alignment and domain information
>PLN02830 UDP-sugar pyrophosphorylase Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query523
1e8o_A85 Core Of The Alu Domain Of The Mammalian Srp Length 7e-07
3foq_A503 Crystal Structure Of N-Acetylglucosamine-1-Phosphat 6e-06
2qkx_A391 N-Acetyl Glucosamine 1-Phosphate Uridyltransferase 7e-06
3spt_A501 Crystal Structure Of Glmu From Mycobacterium Tuberc 7e-06
3d8v_A495 Crystal Structure Of Glmu From Mycobacterium Tuberc 7e-06
1914_A232 Signal Recognition Particle Alu Rna Binding Heterod 2e-05
2ggo_A401 Crystal Structure Of Glucose-1-Phosphate Thymidylyl 4e-05
>pdb|1E8O|A Chain A, Core Of The Alu Domain Of The Mammalian Srp Length = 85 Back     alignment and structure 
Iteration: 1

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (72%), Gaps = 1/48 (2%)
Query: 11 KLKMTDD-NARYSMKYDHKNGYLKLKMTDDNVCLIYKTEMSQDLKKID 57
          KL + D   AR  +KY H +G L +K+TDD VCL+YKT+ +QD+KKI+
Sbjct: 15 KLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIE 62
>pdb|3FOQ|A Chain A, Crystal Structure Of N-Acetylglucosamine-1-Phosphate Uridyltransferase (Glmu) From Mycobacterium Tuberculosis In A Cubic Space Group Length = 503 Back     alignment and structure
>pdb|2QKX|A Chain A, N-Acetyl Glucosamine 1-Phosphate Uridyltransferase From Mycobacterium Tuberculosis Complex With N-Acetyl Glucosamine 1-Phosphate Length = 391 Back     alignment and structure
>pdb|3SPT|A Chain A, Crystal Structure Of Glmu From Mycobacterium Tuberculosis In Complex With Acetyl Coenzyme A And Uridine-Diphosphate-N-Acetylglucosamine Length = 501 Back     alignment and structure
>pdb|3D8V|A Chain A, Crystal Structure Of Glmu From Mycobacterium Tuberculosis In Complex With Uridine-Diphosphate-N-Acetylglucosamine Length = 495 Back     alignment and structure
>pdb|1914|A Chain A, Signal Recognition Particle Alu Rna Binding Heterodimer, Srp914 Length = 232 Back     alignment and structure
>pdb|2GGO|A Chain A, Crystal Structure Of Glucose-1-Phosphate Thymidylyltransferase From Sulfolobus Tokodaii Length = 401 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query523
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 3e-35
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransfera 3e-15
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 2e-12
1914_A232 Signal recognition particle 9/14 fusion protein; A 6e-12
2iu8_A 374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 4e-10
3pmo_A 372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 4e-10
3eh0_A 341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 5e-10
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 5e-10
4evw_A255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 4e-09
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 2e-08
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 4e-04
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 6e-04
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 3e-08
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 4e-04
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 4e-08
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 2e-06
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 3e-06
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 7e-04
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 5e-08
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 3e-04
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 9e-08
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 1e-07
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 1e-07
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 2e-07
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 4e-04
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 8e-04
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 2e-07
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 3e-06
3r0s_A 266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 2e-07
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 3e-07
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 3e-05
4eqy_A 283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 4e-07
3t57_A 305 UDP-N-acetylglucosamine O-acyltransferase domain- 6e-07
2qia_A 262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 6e-07
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 4e-06
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 4e-06
3c8v_A 496 Putative acetyltransferase; YP_390128.1, structura 1e-04
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 1e-05
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 2e-05
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 2e-05
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 3e-05
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 4e-05
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 8e-05
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 9e-05
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 2e-04
3r3r_A187 Ferripyochelin binding protein; structural genomic 3e-04
2dpw_A232 Hypothetical protein TTHA0179; transferase, struct 4e-04
2yc3_A228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 6e-04
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; n 8e-04
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 Back     alignment and structure
 Score =  135 bits (342), Expect = 3e-35
 Identities = 74/416 (17%), Positives = 136/416 (32%), Gaps = 84/416 (20%)

Query: 105 KGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYYPSADLQKFVLDMV 164
            G R  P++   PK   P+   P+I++ IE   +       +I+             +  
Sbjct: 10  SGERLEPITHTRPKAFVPILSKPLIEYQIEYLRKCGIRDITVIVSSKNK--------EYF 61

Query: 165 QEYKINIRY-LQEFWDIIHQQICISLYWTWYRNTRSTYGIYRNSLHWVQEA-------VY 216
           ++    I    Q+            +  T         G        +  A       + 
Sbjct: 62  EKKLKEISIVTQK------DD----IKGT---------G------AAILSAKFNDEALII 96

Query: 217 F--TLEIRSDVVILMHSLYSMAILVTVMATEATRQQSVYYGCIVRKQQTSEISHYVEKPS 274
           +          +  + +L   AI+   ++          YG +V   Q + +S  +EKP 
Sbjct: 97  YGDLFFSNEKEICNIITLKENAIIGVKVS-NPKD-----YGVLVLDNQ-NNLSKIIEKPE 149

Query: 275 TFVSTLVNCGVYLFSLDIFQNIAAVFQSKQDEFYNGNYMVNGKDTDFNHIQLEKEIIMPL 334
              S L+N G+Y  + DIF  +  +  S++ E            TD   I L       +
Sbjct: 150 IPPSNLINAGIYKLNSDIFTYLDKISISERGELEL---------TDA--INL-------M 191

Query: 335 AGSGKAYVYQTSKWWSQLKSAGSAIYANRHYLQLYKTRHPERLQCSSQCKTIGDVYIHSS 394
           A   +  V +   +W  +    + I  N+  L                 K  G V I   
Sbjct: 192 AKDHRVKVIEYEGYWMDIGKPWNIIDVNKWALD-NLVFSQNLGNVEDNVKIKGKVIIEED 250

Query: 395 ASVHPTAIVGPNVSIDDGAVIGPGVRIK-ESIILQGASIGNHSLVLNSIVGRNSKVGNWS 453
           A +     +   V I  G+ IGP   ++  +I+++   IG    V  S++   SK+ + S
Sbjct: 251 AEIKSGTYIEGPVYIGKGSEIGPNSYLRPYTILVEKNKIGASVEVKESVIMEGSKIPHLS 310

Query: 454 RVE------------GT-PCDPNPNKAFAKMDNPPLFNSNGKLNPSITILGDGVTV 496
            V             GT   +   ++   K++      S+G+       +G  V  
Sbjct: 311 YVGDSVIAEDVNFGAGTLIANLRFDEKEVKVNVKGKRISSGR-RKLGAFIGGHVRT 365
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Length = 254 Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Length = 232 Back     alignment and structure
>1914_A Signal recognition particle 9/14 fusion protein; ALU domain, RNA binding, signal recognition particle (SRP), translation regulation; 2.53A {Mus musculus} SCOP: d.49.1.1 d.49.1.1 PDB: 1e8o_A* 1e8s_A 1ry1_C* Length = 232 Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Length = 196 Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Length = 255 Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Length = 283 Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Length = 305 Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Length = 262 Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Length = 173 Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Length = 173 Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Length = 213 Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Length = 191 Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240 Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} Length = 246 Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Length = 189 Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} Length = 187 Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Length = 232 Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Length = 228 Back     alignment and structure
>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Length = 245 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query523
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 100.0
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 100.0
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 100.0
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 100.0
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 100.0
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 100.0
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 100.0
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 100.0
4ecm_A269 Glucose-1-phosphate thymidylyltransferase; HET: DA 99.97
3pnn_A303 Conserved domain protein; structural genomics, PSI 99.96
2e3d_A302 UTP--glucose-1-phosphate uridylyltransferase; UDP- 99.96
1fxo_A293 Glucose-1-phosphate thymidylyltransferase; rhamnos 99.96
1lvw_A295 Glucose-1-phosphate thymidylyltransferase; protein 99.96
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 99.96
2pa4_A323 UTP-glucose-1-phosphate uridylyltransferase; phosp 99.96
1mc3_A296 Glucose-1-phosphate thymidylyltransferase; glucose 99.96
1tzf_A259 Glucose-1-phosphate cytidylyltransferase; nucleoti 99.96
4evw_A255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 99.95
2qh5_A308 PMI, ALGA, mannose-6-phosphate isomerase; structur 99.93
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.9
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransfera 99.9
2x65_A336 Mannose-1-phosphate guanylyltransferase; nucleotid 99.89
2cu2_A337 Putative mannose-1-phosphate guanylyl transferase; 99.87
3tqd_A256 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.83
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; K 99.83
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; n 99.81
2y6p_A234 3-deoxy-manno-octulosonate cytidylyltransferase; l 99.81
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 99.81
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.8
1vic_A262 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.79
4fcu_A253 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.79
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.71
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 99.71
2icy_A469 Probable UTP-glucose-1-phosphate uridylyltransfera 99.7
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 99.7
1j2z_A270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.68
3r0s_A266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.68
3hsq_A259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 99.67
4e6u_A265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.66
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 99.66
4eqy_A283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.66
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 99.66
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 99.66
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, 99.66
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 99.66
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 99.65
3r0s_A266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.65
2yc3_A228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 99.65
2dpw_A232 Hypothetical protein TTHA0179; transferase, struct 99.65
4e79_A 357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 99.65
3t57_A 305 UDP-N-acetylglucosamine O-acyltransferase domain- 99.65
4eqy_A283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.64
3r3r_A187 Ferripyochelin binding protein; structural genomic 99.63
3hsq_A259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 99.63
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 99.63
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 99.63
1914_A232 Signal recognition particle 9/14 fusion protein; A 99.63
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 99.63
2vsh_A236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly 99.63
2qia_A262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 99.63
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 99.63
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 99.63
4e6u_A265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.62
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 99.62
2qia_A262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 99.62
2xwl_A223 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 99.61
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 99.61
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 99.6
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 99.6
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 99.59
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 99.58
4e79_A357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 99.57
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 99.56
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.56
1j2z_A270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.56
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 99.56
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.54
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 99.54
2i5k_A488 UTP--glucose-1-phosphate uridylyltransferase; LEFT 99.54
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 99.53
3t57_A305 UDP-N-acetylglucosamine O-acyltransferase domain- 99.52
1qwj_A229 Cytidine monophospho-N-acetylneuraminic acid synth 99.51
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.51
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 99.5
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 99.5
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 99.5
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 99.49
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 99.49
1jv1_A505 Glcnac1P uridyltransferase isoform 1: AGX1; nucleo 99.49
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 99.49
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 99.48
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural 99.48
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 99.48
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 99.47
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1 99.47
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.47
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.46
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 99.46
3r3r_A187 Ferripyochelin binding protein; structural genomic 99.46
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 99.45
3q80_A231 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; 99.45
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 99.45
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 99.45
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 99.44
1i52_A236 4-diphosphocytidyl-2-C-methylerythritol synthase; 99.44
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 99.44
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 99.43
1vpa_A234 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 99.43
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.43
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.4
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 99.4
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 99.38
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.37
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 99.36
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 99.35
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 99.34
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 99.32
2px7_A236 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.32
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 99.32
2e8b_A201 Probable molybdopterin-guanine dinucleotide biosy 99.3
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 99.3
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 99.29
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 99.29
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 99.28
4hur_A220 Virginiamycin A acetyltransferase; structural geno 99.26
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 99.25
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural 99.25
3srt_A188 Maltose O-acetyltransferase; structural genomics, 99.23
2yqc_A486 UDP-N-acetylglucosamine pyrophosphorylase; uridine 99.23
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 99.23
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, P 99.22
2oeg_A505 UTP-glucose-1-phosphate uridylyltransferase 2, put 99.2
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 99.2
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 99.18
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 99.18
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis pr 99.18
3oc9_A405 UDP-N-acetylglucosamine pyrophosphorylase; structu 99.17
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 99.17
1w55_A371 ISPD/ISPF bifunctional enzyme; biosynthetic pathwa 99.14
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 99.12
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 99.09
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 99.08
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 99.06
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 99.02
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 99.02
4hur_A220 Virginiamycin A acetyltransferase; structural geno 99.02
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 99.02
3ngw_A208 Molybdopterin-guanine dinucleotide biosynthesis P 99.01
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 98.99
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 98.97
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 98.97
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 98.97
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 98.97
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 98.96
3srt_A188 Maltose O-acetyltransferase; structural genomics, 98.93
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 98.93
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 98.92
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 98.92
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 98.91
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 98.82
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 98.81
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 98.81
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 98.76
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 98.75
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 98.69
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 98.6
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 98.59
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 98.35
3r3i_A528 UTP--glucose-1-phosphate uridylyltransferase; ross 98.07
3gue_A484 UTP-glucose-1-phosphate uridylyltransferase 2; pho 96.87
3ogz_A630 UDP-sugar pyrophosphorylase; LEFT handed beta heli 96.26
2i5e_A211 Hypothetical protein MM_2497; APC86122, methanosar 89.08
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
Probab=100.00  E-value=3.6e-45  Score=393.58  Aligned_cols=373  Identities=20%  Similarity=0.220  Sum_probs=274.8

Q ss_pred             eeEEEEecCCCCCCcCCCCCCCCCcccceeCCcchHHHHHHHHhcCCCccEEEEEccCChHHHHHHHHhhhhccCeeEEE
Q psy17795         94 WTTNDTTPGPLKGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYYPSADLQKFVLDMVQEYKINIRY  173 (523)
Q Consensus        94 m~~iila~g~g~g~R~~~lT~~~pK~ll~i~g~pli~~~l~~~~~~~g~~~i~vv~~~~~~~i~~~l~~~~~~~~~~i~~  173 (523)
                      +.+||||||  +||||+|+|   ||||+||+|||||+|+|+++.++ |+++|+||++|+.+++++|+.+..+.++.++.|
T Consensus        13 ~~vvILAaG--~GtRm~~~~---pK~l~pv~gkp~i~~~l~~~~~~-g~~~i~vv~~~~~~~i~~~~~~~~~~~~~~i~~   86 (501)
T 3st8_A           13 TAVLVLAAG--PGTRMRSDT---PKVLHTLAGRSMLSHVLHAIAKL-APQRLIVVLGHDHQRIAPLVGELADTLGRTIDV   86 (501)
T ss_dssp             EEEEEEECS--CCGGGCCSS---CGGGCEETTEEHHHHHHHHHHHH-CCSEEEEEECTTHHHHHHHHHHHHHHHTSCCEE
T ss_pred             ceEEEECCc--CcccCCCCC---CHHHeEECChhHHHHHHHHHHhC-CCCEEEEEeCCCHHHHHHHHHHHHHhcCCcEEE
Confidence            468999999  999999954   99999999999999999999996 999999999999999999998865668889999


Q ss_pred             EecccccchhhhhcccccccccCCCchhHHH--Hhhcc-cCCcceEEEEc----cc-hH-H--HHHHHHhcCCcceEEEE
Q psy17795        174 LQEFWDIIHQQICISLYWTWYRNTRSTYGIY--RNSLH-WVQEAVYFTLE----IR-SD-V--VILMHSLYSMAILVTVM  242 (523)
Q Consensus       174 ~~~~~~~g~~~~~~~~~~~~~~g~~ta~al~--~~~i~-~~~d~~~Lvl~----i~-~D-~--l~~~h~~~~~~~~~tv~  242 (523)
                      +.|++++|                 ||+|++  ++++. +..+. +|+++    ++ .+ +  ++++|+..+  ++++++
T Consensus        87 ~~q~~~lG-----------------Ta~Av~~a~~~l~~~~~~~-~lvl~gd~~l~~~~~~~~l~~~h~~~~--~~~ti~  146 (501)
T 3st8_A           87 ALQDRPLG-----------------TGHAVLCGLSALPDDYAGN-VVVTSGDTPLLDADTLADLIATHRAVS--AAVTVL  146 (501)
T ss_dssp             EECSSCCC-----------------HHHHHHHHHTTSCTTCCSE-EEEEETTCTTCCHHHHHHHHHHHHHTT--CSEEEE
T ss_pred             EEcCCCCC-----------------cHHHHHHHHHHhccccccc-eeeecCcceeecHHHHHHHHHHHhhcc--ccceEe
Confidence            99999999                 999999  77886 33456 77776    22 23 2  788999888  899999


Q ss_pred             EEeeCCCCCcceeEEEEcCCCCcEEEEeecCCC----cccceeeeeEEEeeHHHHHHHHHhhcc-c-ccccccccccccC
Q psy17795        243 ATEATRQQSVYYGCIVRKQQTSEISHYVEKPST----FVSTLVNCGVYLFSLDIFQNIAAVFQS-K-QDEFYNGNYMVNG  316 (523)
Q Consensus       243 ~~~~~~~~~~~~g~v~~d~~~~~V~~~~ekp~~----~~~~l~~~Giyif~~~il~~l~~~~~~-~-~~e~~~~~~~~~~  316 (523)
                      +.+++  +|..||.+..|++ |+|..|.|||+.    ...+++++|+|+|++++|..+...... + ++|||+       
T Consensus       147 ~~~~~--dp~~yG~i~~~~~-g~v~~ivEk~~~~~~~~~i~~in~Giy~f~~~~l~~~l~~l~~~n~~~e~yl-------  216 (501)
T 3st8_A          147 TTTLD--DPFGYGRILRTQD-HEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYL-------  216 (501)
T ss_dssp             EEECS--CCTTSCEEEECTT-CCEEEEECGGGCCHHHHHCCEEEEEEEEEEHHHHHHHHTTCCCCSTTCSCCT-------
T ss_pred             eeccC--Cchhccccccccc-eeEEeeccccCCChhhccceeeeceeeeecchhHHHhhhhhcccccccccch-------
Confidence            99884  6889999999987 999999999753    356899999999999988766543332 2 678876       


Q ss_pred             CCCCcccccchhhhhhhhhcCCc-EEEEEcchhHhhhccchh--hhhccHHH---------HhhhcccCCcccccC----
Q psy17795        317 KDTDFNHIQLEKEIIMPLAGSGK-AYVYQTSKWWSQLKSAGS--AIYANRHY---------LQLYKTRHPERLQCS----  380 (523)
Q Consensus       317 ~~~~~~~~~~~~dil~~li~~g~-v~~~~~~g~w~dIgt~~d--yl~an~~~---------l~~~~~~~~~~~~~~----  380 (523)
                                 ++++..+...+. +.++....+|...+....  +......+         +.......|......    
T Consensus       217 -----------td~i~~~~~~g~~v~~~~~~~~~~~~g~n~~~~l~~~~~~~~~r~~~~~~~~gv~~~dp~~~~i~~dv~  285 (501)
T 3st8_A          217 -----------TDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVT  285 (501)
T ss_dssp             -----------THHHHHHHHTTCCEEEEECSSGGGGCCCSSHHHHHHHHHHHHHHHHHHHHHTTCEESCGGGEEECTTCE
T ss_pred             -----------hhHHHHHHhcCceEEEEeccchhhhcccccHHHHHHHHHHhhhhhhhhhcccCceeeeeccccccCceE
Confidence                       688888887776 777777777765544322  22221111         111111122111100    


Q ss_pred             --------CCceEecCcE---------------------------------ECCCCEECCCCEECCCcEECCCCEECCCC
Q psy17795        381 --------SQCKTIGDVY---------------------------------IHSSASVHPTAIVGPNVSIDDGAVIGPGV  419 (523)
Q Consensus       381 --------~~~~i~~~~~---------------------------------i~~~~~I~~~~~I~~~~~Ig~~~~I~~~~  419 (523)
                              +...+.+++.                                 +++++.|++.+.++++++|+++|.||.++
T Consensus       286 IG~dv~I~~~v~i~g~~~Ig~~~~I~~~~~i~~~~i~~~~~i~~~~i~~~~ig~~~~ig~~~~i~~~~~i~~~v~IG~~v  365 (501)
T 3st8_A          286 IGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFV  365 (501)
T ss_dssp             ECTTCEECSSEEEETTCEECTTCEECSSCEEEEEEECTTCEECSEEEEEEEECTTCEECSSEEECTTCEECTTCEEEETE
T ss_pred             ECCcceecceeeecCccccccceEEeeceeecCceEecCCEEEeecccccccccccccCCceeecCCcEEccccccCCeE
Confidence                    1222222222                                 23334444555555666677777777777


Q ss_pred             EEeeeEECCCCEECCCCEEeceEECCCCEECCCcEEcCCCCCCCCCCCceecCCCCeecCCCeecCCcEEeCCCCEECCC
Q psy17795        420 RIKESIILQGASIGNHSLVLNSIVGRNSKVGNWSRVEGTPCDPNPNKAFAKMDNPPLFNSNGKLNPSITILGDGVTVPGE  499 (523)
Q Consensus       420 ~I~~s~Ig~~~~Ig~~~~I~~~iIg~~~~Ig~~~~i~~~~~~~~~~~~~v~I~~~~~ig~~~~i~~g~~iIG~~~~Ig~~  499 (523)
                      .|.+++||++|.|++.+.|.+++||++|.||+++.+.+.   ....+.+++||++|+||.++.+.++ +.||++|.||+|
T Consensus       366 ~ik~s~Ig~gskI~~~~~i~d~~Ig~~v~IG~g~i~~n~---dg~~~~~t~IGd~~~iG~~~~l~~~-v~Ig~~~~i~ag  441 (501)
T 3st8_A          366 EVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNY---DGTSKRRTTVGSHVRTGSDTMFVAP-VTIGDGAYTGAG  441 (501)
T ss_dssp             EEESCEECTTCEEEESCEEESEEECSSCEECTTCEEECB---CSSSBCCEEECTTCEECTTCEEESS-EEECTTCEECTT
T ss_pred             EEccceecCCcEEeccceecCceEcCCCEECCCEEEEcc---cCCcccCCEECCCcEECCCCEEcCC-cEECCCCEECCC
Confidence            777788999999999999999999999999999998652   1223446889999999999999999 677999999999


Q ss_pred             cEEeCeEEcCCcEeCCCCC
Q psy17795        500 LIVLNSIVLPYKELTRSFK  518 (523)
Q Consensus       500 ~~i~~~~v~~~~~i~~~~~  518 (523)
                      ++|... |.|++..-.+.|
T Consensus       442 s~v~~d-vp~~~l~~~~~~  459 (501)
T 3st8_A          442 TVVRED-VPPGALAVSAGP  459 (501)
T ss_dssp             CEECSC-BCTTCEECCCCC
T ss_pred             CEECcc-cCCCCeEEeccC
Confidence            999443 245554434444
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Back     alignment and structure
>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... Back     alignment and structure
>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 Back     alignment and structure
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Back     alignment and structure
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Back     alignment and structure
>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Back     alignment and structure
>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Back     alignment and structure
>2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A* Back     alignment and structure
>2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20 Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Back     alignment and structure
>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>1914_A Signal recognition particle 9/14 fusion protein; ALU domain, RNA binding, signal recognition particle (SRP), translation regulation; 2.53A {Mus musculus} SCOP: d.49.1.1 d.49.1.1 PDB: 1e8o_A* 1e8s_A 1ry1_C* Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>2i5k_A UTP--glucose-1-phosphate uridylyltransferase; LEFT-handed beta-helix, SGC domain; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>1jv1_A Glcnac1P uridyltransferase isoform 1: AGX1; nucleotidyltransferase, alternative splicing; HET: UD1; 1.90A {Homo sapiens} SCOP: c.68.1.5 PDB: 1jv3_A* 1jvg_A* 1jvd_A* 1vm8_A* Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N- acetylglucosamine, N-acetylglucosamine-1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A* Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Back     alignment and structure
>2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative; rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG; 2.30A {Leishmania major} PDB: 2oef_A* Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Back     alignment and structure
>3oc9_A UDP-N-acetylglucosamine pyrophosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.80A {Entamoeba histolytica} Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>3r3i_A UTP--glucose-1-phosphate uridylyltransferase; rossmann fold, beta barrel, nucleotidyltransferase; 3.57A {Homo sapiens} PDB: 3r2w_A Back     alignment and structure
>3gue_A UTP-glucose-1-phosphate uridylyltransferase 2; phosphatase, UDP, structural GE structural genomics consortium, SGC; HET: UPG PG4; 1.92A {Trypanosoma brucei} Back     alignment and structure
>3ogz_A UDP-sugar pyrophosphorylase; LEFT handed beta helix, rossmann fold, UDP sugar pyrophospho transferase; 2.03A {Leishmania major} PDB: 3oh3_A* 3oh1_A* 3oh0_A* 3oh2_A* 3oh4_A* Back     alignment and structure
>2i5e_A Hypothetical protein MM_2497; APC86122, methanosarcina mazei GO1, hypothetic protein, STRU genomics, PSI-2, protein structure initiative; 2.10A {Methanosarcina mazei} SCOP: c.68.1.21 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 523
d1fxoa_292 c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa 1e-16
d1mc3a_291 c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} 3e-14
d1lvwa_295 c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacteri 5e-14
d1914a178 d.49.1.1 (A:4004-4081) Signal recognition particle 9e-14
d1yp2a2307 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr 4e-12
d1tzfa_259 c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf 6e-12
d1fxja178 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha 6e-11
d1jyka_229 c.68.1.13 (A:) CTP:phosphocholine cytidylytransfer 3e-09
d2jf2a1 262 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra 2e-08
d2jf2a1 262 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra 0.001
d1j2za_ 259 b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer 6e-08
d1j2za_ 259 b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer 2e-04
d2oi6a2248 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate 5e-07
d1g97a2250 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate 5e-07
d2f9ca1 320 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm 2e-06
d2f9ca1 320 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm 2e-04
d2f9ca1 320 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm 0.002
d2dpwa1231 c.68.1.19 (A:1-231) Uncharacterized protein TTHA01 1e-05
d2cu2a2268 c.68.1.20 (A:1-268) Putative mannose-1-phosphate g 1e-05
d1qrea_210 b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon M 4e-04
d1vpaa_221 c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt 6e-04
d1w77a1226 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl- 7e-04
d1vgwa_226 c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt 9e-04
d1i52a_225 c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt 0.002
d1v3wa_173 b.81.1.5 (A:) Ferripyochelin binding protein {Arch 0.002
d1qwja_228 c.68.1.13 (A:) CMP acylneuraminate synthetase {Mou 0.004
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: RmlA (RfbA)
species: Pseudomonas aeruginosa [TaxId: 287]

 Score = 78.3 bits (193), Expect = 1e-16
 Identities = 39/224 (17%), Positives = 73/224 (32%), Gaps = 35/224 (15%)

Query: 105 KGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGYYPSADLQKFVLDMV 164
            GTR  P +L   K L PV   PMI + +   +    ++EI+I+         + +L   
Sbjct: 11  SGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLA-GIREILIISTPQDTPRFQQLLGDG 69

Query: 165 QEYKINIRYLQEFWD-------IIHQQICISLYWTWYRNTRSTYGIYRNSLHWVQEAVYF 217
             + ++++Y  +          +I +    +            YG      H   E +  
Sbjct: 70  SNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYG------HDFHELLGS 123

Query: 218 TLEIRSDVVILMHSLYSMAILVTVMATEATRQQSVYYGCIVRKQQTSEISHYVEKPSTFV 277
             + ++                +V A      +   YG +V   Q  +     EKP    
Sbjct: 124 ASQRQTG--------------ASVFAYHVLDPER--YG-VVEFDQGGKAISLEEKPLEPK 166

Query: 278 STLVNCGVYLFSLDIFQNIAAVFQSKQDEF----YNGNYMVNGK 317
           S     G+Y +   +      +  S + E      N  Y+  G+
Sbjct: 167 SNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQ 210
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Length = 291 Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 295 Back     information, alignment and structure
>d1914a1 d.49.1.1 (A:4004-4081) Signal recognition particle 9KDa protein, SRP9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307 Back     information, alignment and structure
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259 Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Length = 229 Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 Back     information, alignment and structure
>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 248 Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 250 Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 Back     information, alignment and structure
>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Length = 231 Back     information, alignment and structure
>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Length = 268 Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Length = 210 Back     information, alignment and structure
>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} Length = 221 Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 226 Back     information, alignment and structure
>d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} Length = 226 Back     information, alignment and structure
>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} Length = 225 Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 173 Back     information, alignment and structure
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query523
d1fxoa_292 RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} 100.0
d1mc3a_291 RffH {Escherichia coli [TaxId: 562]} 100.0
d1lvwa_295 RmlA (RfbA) {Archaeon Methanobacterium thermoautot 99.97
d1yp2a2307 Glucose-1-phosphate adenylyltransferase small subu 99.97
d1tzfa_259 Glucose-1-phosphate cytidylyltransferase RfbF {Sal 99.94
d1jyka_229 CTP:phosphocholine cytidylytransferase LicC {Strep 99.93
d2cu2a2268 Putative mannose-1-phosphate guanylyl transferase 99.93
d1914a178 Signal recognition particle 9KDa protein, SRP9 {Mo 99.91
d1g97a2250 N-acetylglucosamine 1-phosphate uridyltransferase 99.89
d2oi6a2248 N-acetylglucosamine 1-phosphate uridyltransferase 99.86
d1j2za_259 UDP N-acetylglucosamine acyltransferase {Helicobac 99.65
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.63
d2jf2a1262 UDP N-acetylglucosamine acyltransferase {Escherich 99.63
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 99.61
d2jf2a1262 UDP N-acetylglucosamine acyltransferase {Escherich 99.56
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 99.56
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 99.5
d1j2za_259 UDP N-acetylglucosamine acyltransferase {Helicobac 99.5
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 99.49
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 99.47
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.47
d1i52a_225 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.46
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 99.43
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 99.42
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 99.42
d1vpaa_221 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.38
d1w77a1226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.35
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 99.34
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 99.32
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 99.3
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 99.29
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 99.27
d1vgwa_226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.25
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 99.23
d1h7ea_245 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.19
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 99.18
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 99.18
d1vh1a_246 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.14
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 99.12
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 99.09
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 99.09
d1vica_255 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.08
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 99.02
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 98.98
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 98.96
d2dpwa1231 Uncharacterized protein TTHA0179 {Thermus thermoph 98.92
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 98.91
d1e5ka_188 Molybdenum cofactor biosynthesis protein MobA {Esc 98.81
d1eyra_225 CMP acylneuraminate synthetase {Neisseria meningit 98.72
d2f9ca1 320 Hypothetical protein YdcK {Salmonella enterica [Ta 98.67
d1w55a1205 IspD/IspF bifunctional enzyme, CDP-me synthase dom 98.65
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 98.6
d2icya2378 UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c 98.58
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 98.57
d1qwja_228 CMP acylneuraminate synthetase {Mouse (Mus musculu 98.46
d2f9ca1 320 Hypothetical protein YdcK {Salmonella enterica [Ta 98.43
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 98.34
d1jv1a_501 UDP-N-acetylglucosamine pyrophosphorylase {Human ( 97.44
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: RmlA (RfbA)
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=100.00  E-value=1.6e-37  Score=306.52  Aligned_cols=228  Identities=18%  Similarity=0.198  Sum_probs=199.8

Q ss_pred             ceeEEEEecCCCCCCcCCCCCCCCCcccceeCCcchHHHHHHHHhcCCCccEEEEEcc-CChHHHHHHHHhhhhccCeeE
Q psy17795         93 GWTTNDTTPGPLKGTRFRPLSLDSPKPLFPVAGLPMIQHHIEACVQVPNLKEIIILGY-YPSADLQKFVLDMVQEYKINI  171 (523)
Q Consensus        93 ~m~~iila~g~g~g~R~~~lT~~~pK~ll~i~g~pli~~~l~~~~~~~g~~~i~vv~~-~~~~~i~~~l~~~~~~~~~~i  171 (523)
                      ++||||||||  +||||+|+|..+||||+||+|+|||+|+|+.|..+ |+++|+|++. ++.+.+++++++. +++++++
T Consensus         1 k~KavILAgG--~GtRl~plT~~~pKpllpi~gkPiI~~~l~~l~~~-Gi~ei~ii~~~~~~~~i~~~~~~~-~~~g~~I   76 (292)
T d1fxoa_           1 KRKGIILAGG--SGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLA-GIREILIISTPQDTPRFQQLLGDG-SNWGLDL   76 (292)
T ss_dssp             CEEEEEECCC--CCTTTTTHHHHSCGGGSEETTEETTHHHHHHHHHT-TCCEEEEEECTTTHHHHHHHHTTS-GGGTCEE
T ss_pred             CcEEEEECCC--CCCcCChhhcCCCcccCEECCEehHHHHHHHHHHC-CCCEEEEEeCcCCHHHHHHHhccc-cccCeEE
Confidence            3689999999  99999999999999999999999999999999996 9999987766 4778899988873 6789999


Q ss_pred             EEEecccccchhhhhcccccccccCCCchhHHH--HhhcccCCcceEEEEc--cc--hHH--HHHHHHhcCCcceEEEEE
Q psy17795        172 RYLQEFWDIIHQQICISLYWTWYRNTRSTYGIY--RNSLHWVQEAVYFTLE--IR--SDV--VILMHSLYSMAILVTVMA  243 (523)
Q Consensus       172 ~~~~~~~~~g~~~~~~~~~~~~~~g~~ta~al~--~~~i~~~~d~~~Lvl~--i~--~D~--l~~~h~~~~~~~~~tv~~  243 (523)
                      .|+.|++++|                 ||+|++  .+++.+ ++. ||+++  ++  .|+  ++++|.+.+  +.+++++
T Consensus        77 ~y~~q~~~~G-----------------ta~ai~~a~~~i~~-~~~-~lil~dD~~~~~dl~~ll~~h~~~~--~~~~i~~  135 (292)
T d1fxoa_          77 QYAVQPSPDG-----------------LAQAFLIGESFIGN-DLS-ALVLGDNLYYGHDFHELLGSASQRQ--TGASVFA  135 (292)
T ss_dssp             EEEECSSCCC-----------------GGGHHHHTHHHHTT-SEE-EEEETTEEEECTTHHHHHHHHHTCC--SSEEEEE
T ss_pred             EEccCCCCCc-----------------HHHHHHhhhhhcCC-Cce-EEEEccccccCcCHHHHHHHHHhCC--CCcEEEE
Confidence            9999999999                 999999  778873 344 77777  43  466  999999988  8889999


Q ss_pred             EeeCCCCCcceeEEEEcCCCCcEEEEeecCCCcccceeeeeEEEeeHHHHHHHHHhhcccccccccccccccCCCCCccc
Q psy17795        244 TEATRQQSVYYGCIVRKQQTSEISHYVEKPSTFVSTLVNCGVYLFSLDIFQNIAAVFQSKQDEFYNGNYMVNGKDTDFNH  323 (523)
Q Consensus       244 ~~~~~~~~~~~g~v~~d~~~~~V~~~~ekp~~~~~~l~~~Giyif~~~il~~l~~~~~~~~~e~~~~~~~~~~~~~~~~~  323 (523)
                      .+++  +|++||++..|++ +++..|.|||+.+.++++.+|+|+|++++++.+..+.++.++|+++              
T Consensus       136 ~~V~--~p~~yGV~~~d~~-~ki~~~~EKP~~p~Snla~~G~Y~f~~~~~~~~~~l~~s~rgE~ei--------------  198 (292)
T d1fxoa_         136 YHVL--DPERYGVVEFDQG-GKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEI--------------  198 (292)
T ss_dssp             EECS--CGGGSEEEEECTT-SCEEEEEESCSSCSSSEEEEEEEEECTTHHHHHHHCCCCTTSSCCH--------------
T ss_pred             EECC--CHHHCeEEEEcCC-CCEeEEEECCCCCCCCcEEEEEEEEChHHHHHHHhCCCCCCCchhh--------------
Confidence            9984  5789999999987 9999999999999999999999999999999998887777777766              


Q ss_pred             ccchhhhhhhhhcCCcEEEEEcc--hhHhhhccchhhhhccHHHH
Q psy17795        324 IQLEKEIIMPLAGSGKAYVYQTS--KWWSQLKSAGSAIYANRHYL  366 (523)
Q Consensus       324 ~~~~~dil~~li~~g~v~~~~~~--g~w~dIgt~~dyl~an~~~l  366 (523)
                          +|+++.+++++++.++.+.  .+|+|+||+++|++|++.+.
T Consensus       199 ----tD~~~~~l~~~~~~~~~~~~~~~W~D~Gt~~~l~~a~~~v~  239 (292)
T d1fxoa_         199 ----TDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIA  239 (292)
T ss_dssp             ----HHHHHHHHHTTCEEEEECCTTSEEEECCSHHHHHHHHHHHH
T ss_pred             ----HHHHHHHHHcCCeEEEEeCCCCEEEeCCCHHHHHHHHHHHH
Confidence                7999999999987776653  36999999999999998654
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1914a1 d.49.1.1 (A:4004-4081) Signal recognition particle 9KDa protein, SRP9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jv1a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX1 [TaxId: 9606]} Back     information, alignment and structure