Psyllid ID: psy17824
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 272 | ||||||
| 383850407 | 578 | PREDICTED: uncharacterized protein LOC10 | 0.676 | 0.318 | 0.777 | 1e-85 | |
| 322778800 | 547 | hypothetical protein SINV_06109 [Solenop | 0.680 | 0.338 | 0.774 | 6e-85 | |
| 350417107 | 565 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.683 | 0.329 | 0.752 | 7e-85 | |
| 340713178 | 565 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.683 | 0.329 | 0.752 | 7e-85 | |
| 193652624 | 548 | PREDICTED: hypothetical protein LOC10016 | 0.716 | 0.355 | 0.734 | 2e-84 | |
| 307202211 | 564 | Peptidyl-prolyl cis-trans isomerase G [H | 0.683 | 0.329 | 0.763 | 5e-84 | |
| 332026905 | 556 | NK-tumor recognition protein [Acromyrmex | 0.691 | 0.338 | 0.761 | 5e-84 | |
| 229608905 | 430 | moca cyclophilin [Nasonia vitripennis] | 0.639 | 0.404 | 0.781 | 2e-81 | |
| 427787425 | 943 | hypothetical protein [Rhipicephalus pulc | 0.647 | 0.186 | 0.738 | 5e-81 | |
| 195055829 | 912 | GH17446 [Drosophila grimshawi] gi|193892 | 0.816 | 0.243 | 0.64 | 6e-81 |
| >gi|383850407|ref|XP_003700787.1| PREDICTED: uncharacterized protein LOC100879476 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 322 bits (824), Expect = 1e-85, Method: Compositional matrix adjust.
Identities = 143/184 (77%), Positives = 160/184 (86%)
Query: 1 MKLIRPRCYFDVEISDIPLGRIVFELYSDICPITCENFRALCTGEKGIGKTTGKNLHYLN 60
M + PR +FD+E+ +P+GRI+FEL++DICPITCENFRALCTGEKG+GKTT K LHY
Sbjct: 14 MVNVNPRVFFDIEVGGLPMGRIIFELFADICPITCENFRALCTGEKGLGKTTSKPLHYKG 73
Query: 61 IVFHRVVKGFMIQSGDFSVGNGTGGESIYGGTFEDENFELKHDEPFLLSMANRGKDTNGS 120
IVFHRVVK FMIQ GDFSVGNGTGGESIYGGTF DENF +KH +PFLLSMANRG+DTNGS
Sbjct: 74 IVFHRVVKDFMIQGGDFSVGNGTGGESIYGGTFADENFIIKHSKPFLLSMANRGRDTNGS 133
Query: 121 QFFITTQPAPHLDGVHVVFGHVVSGQNVVSHIENLPVDKMSRPLQDVRVVKCNELVLKSK 180
QFFITTQPAPHLD VHVVFG VVSGQ +V+HIE LPVD+MSRPLQD +VV C ELVLK K
Sbjct: 134 QFFITTQPAPHLDNVHVVFGEVVSGQEIVTHIEGLPVDRMSRPLQDAKVVNCGELVLKVK 193
Query: 181 LKAK 184
KAK
Sbjct: 194 SKAK 197
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|322778800|gb|EFZ09216.1| hypothetical protein SINV_06109 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|350417107|ref|XP_003491260.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340713178|ref|XP_003395124.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1-like isoform 1 [Bombus terrestris] gi|340713180|ref|XP_003395125.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|193652624|ref|XP_001949110.1| PREDICTED: hypothetical protein LOC100168064 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307202211|gb|EFN81698.1| Peptidyl-prolyl cis-trans isomerase G [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332026905|gb|EGI67006.1| NK-tumor recognition protein [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|229608905|ref|NP_001153475.1| moca cyclophilin [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|427787425|gb|JAA59164.1| hypothetical protein [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|195055829|ref|XP_001994815.1| GH17446 [Drosophila grimshawi] gi|193892578|gb|EDV91444.1| GH17446 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 272 | ||||||
| FB|FBgn0039581 | 1002 | Moca-cyp "Moca-cyp" [Drosophil | 0.632 | 0.171 | 0.622 | 4.7e-56 | |
| UNIPROTKB|E1C591 | 747 | PPIG "Uncharacterized protein" | 0.647 | 0.235 | 0.590 | 3.7e-55 | |
| UNIPROTKB|A8E658 | 753 | PPIG "Uncharacterized protein" | 0.647 | 0.233 | 0.590 | 1.3e-54 | |
| RGD|620315 | 752 | Ppig "peptidylprolyl isomerase | 0.647 | 0.234 | 0.590 | 1.3e-54 | |
| UNIPROTKB|O55035 | 752 | Ppig "Peptidyl-prolyl cis-tran | 0.647 | 0.234 | 0.590 | 1.3e-54 | |
| UNIPROTKB|J9PAE8 | 753 | PPIG "Uncharacterized protein" | 0.647 | 0.233 | 0.585 | 1.6e-54 | |
| UNIPROTKB|C9JN15 | 246 | PPIG "Peptidyl-prolyl cis-tran | 0.647 | 0.715 | 0.585 | 1.6e-54 | |
| UNIPROTKB|Q13427 | 754 | PPIG "Peptidyl-prolyl cis-tran | 0.647 | 0.233 | 0.585 | 1.6e-54 | |
| UNIPROTKB|F1S1V5 | 753 | PPIG "Uncharacterized protein" | 0.647 | 0.233 | 0.585 | 1.6e-54 | |
| MGI|MGI:2445173 | 752 | Ppig "peptidyl-prolyl isomeras | 0.647 | 0.234 | 0.585 | 1.6e-54 |
| FB|FBgn0039581 Moca-cyp "Moca-cyp" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 585 (211.0 bits), Expect = 4.7e-56, P = 4.7e-56
Identities = 107/172 (62%), Positives = 125/172 (72%)
Query: 5 RPRCYFDVEISDIPLGRIVFELYSDICPITCENFRALCXXXXXXXXXXXXNLHYLNIVFH 64
RPRC+FD+ + + +GRIVFEL++D+ P T ENFRALC L Y ++FH
Sbjct: 44 RPRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFH 103
Query: 65 RVVKGFMIQSGDFSVGNGTGGESIYGGTFEDENFELKHDEPFLLSMANRGKDTNGSQFFI 124
RVVK FM+Q+GDFS GNGTGGESIYGGTFEDE+FE KHD PFLLSMANRGK+TNGSQFFI
Sbjct: 104 RVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFI 163
Query: 125 TTQPAPHLDXXXXXXXXXXSGQNVVSHIENLPVDKMSRPLQDVRVVKCNELV 176
TTQPAPHLD SGQ +V +E LPVD+ SRPLQD + C ELV
Sbjct: 164 TTQPAPHLDNIHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGELV 215
|
|
| UNIPROTKB|E1C591 PPIG "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8E658 PPIG "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|620315 Ppig "peptidylprolyl isomerase G" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O55035 Ppig "Peptidyl-prolyl cis-trans isomerase G" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9PAE8 PPIG "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JN15 PPIG "Peptidyl-prolyl cis-trans isomerase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13427 PPIG "Peptidyl-prolyl cis-trans isomerase G" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S1V5 PPIG "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2445173 Ppig "peptidyl-prolyl isomerase G (cyclophilin G)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 272 | |||
| cd01926 | 164 | cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik | 9e-89 | |
| PTZ00060 | 183 | PTZ00060, PTZ00060, cyclophilin; Provisional | 1e-75 | |
| cd00317 | 146 | cd00317, cyclophilin, cyclophilin: cyclophilin-typ | 2e-62 | |
| pfam00160 | 144 | pfam00160, Pro_isomerase, Cyclophilin type peptidy | 2e-59 | |
| PLN03149 | 186 | PLN03149, PLN03149, peptidyl-prolyl isomerase H (c | 3e-58 | |
| COG0652 | 158 | COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase | 3e-56 | |
| cd01927 | 148 | cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo | 2e-55 | |
| cd01928 | 153 | cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 | 1e-51 | |
| cd01923 | 159 | cd01923, cyclophilin_RING, cyclophilin_RING: cyclo | 5e-49 | |
| cd01922 | 146 | cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY | 7e-44 | |
| cd01925 | 171 | cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC | 2e-35 | |
| cd01921 | 166 | cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph | 1e-32 | |
| PTZ00221 | 249 | PTZ00221, PTZ00221, cyclophilin; Provisional | 5e-32 | |
| cd01920 | 155 | cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP | 1e-18 | |
| PRK10903 | 190 | PRK10903, PRK10903, peptidyl-prolyl cis-trans isom | 1e-09 | |
| PRK10791 | 164 | PRK10791, PRK10791, peptidyl-prolyl cis-trans isom | 3e-08 | |
| cd01924 | 176 | cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 | 3e-08 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 2e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 3e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 4e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 5e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-05 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 6e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 1e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 2e-04 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 2e-04 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 2e-04 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 2e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 3e-04 | |
| PLN02967 | 581 | PLN02967, PLN02967, kinase | 3e-04 | |
| pfam14303 | 147 | pfam14303, NAM-associated, No apical meristem-asso | 3e-04 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 3e-04 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 3e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 4e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 6e-04 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 6e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 7e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 7e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 7e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 8e-04 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.001 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.001 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 0.001 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 0.001 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.002 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 0.002 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.003 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 0.003 | |
| PLN03083 | 803 | PLN03083, PLN03083, E3 UFM1-protein ligase 1 homol | 0.003 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 0.004 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 0.004 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.004 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.004 | |
| pfam09831 | 177 | pfam09831, DUF2058, Uncharacterized protein conser | 0.004 |
| >gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain | Back alignment and domain information |
|---|
Score = 260 bits (667), Expect = 9e-89
Identities = 97/167 (58%), Positives = 113/167 (67%), Gaps = 4/167 (2%)
Query: 6 PRCYFDVEISDIPLGRIVFELYSDICPITCENFRALCTGEKGIGKTTGKNLHYLNIVFHR 65
P+ +FD+ I P GRIV EL++D+ P T ENFRALCTGEKG G GK Y FHR
Sbjct: 1 PKVFFDITIGGEPAGRIVMELFADVVPKTAENFRALCTGEKGKG---GKPFGYKGSTFHR 57
Query: 66 VVKGFMIQSGDFSVGNGTGGESIYGGTFEDENFELKHDEPFLLSMANRGKDTNGSQFFIT 125
V+ FMIQ GDF+ GNGTGG+SIYG F DENF+LKH P LLSMAN G +TNGSQFFIT
Sbjct: 58 VIPDFMIQGGDFTRGNGTGGKSIYGEKFPDENFKLKHTGPGLLSMANAGPNTNGSQFFIT 117
Query: 126 TQPAPHLDGVHVVFGHVVSGQNVVSHIENLPVDKMSRPLQDVRVVKC 172
T P LDG HVVFG VV G +VV IEN+ +P + V + C
Sbjct: 118 TVKTPWLDGKHVVFGKVVEGMDVVKKIENVGSGN-GKPKKKVVIADC 163
|
This family represents the archetypal cystolic cyclophilin similar to human cyclophilins A, B and H. PPIase is an enzyme which accelerates protein folding by catalyzing the cis-trans isomerization of the peptide bonds preceding proline residues. These enzymes have been implicated in protein folding processes which depend on catalytic /chaperone-like activities. As cyclophilins, Human hCyP-A, human cyclophilin-B (hCyP-19), S. cerevisiae Cpr1 and C. elegans Cyp-3, are inhibited by the immunosuppressive drug cyclopsporin A (CsA). CsA binds to the PPIase active site. Cyp-3. S. cerevisiae Cpr1 interacts with the Rpd3 - Sin3 complex and in addition is a component of the Set3 complex. S. cerevisiae Cpr1 has also been shown to have a role in Zpr1p nuclear transport. Human cyclophilin H associates with the [U4/U6.U5] tri-snRNP particles of the splicesome. Length = 164 |
| >gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases | Back alignment and domain information |
|---|
| >gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD | Back alignment and domain information |
|---|
| >gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain | Back alignment and domain information |
|---|
| >gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like | Back alignment and domain information |
|---|
| >gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 | Back alignment and domain information |
|---|
| >gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 | Back alignment and domain information |
|---|
| >gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) | Back alignment and domain information |
|---|
| >gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E | Back alignment and domain information |
|---|
| >gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215521 PLN02967, PLN02967, kinase | Back alignment and domain information |
|---|
| >gnl|CDD|222665 pfam14303, NAM-associated, No apical meristem-associated C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|215565 PLN03083, PLN03083, E3 UFM1-protein ligase 1 homolog; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|220431 pfam09831, DUF2058, Uncharacterized protein conserved in bacteria (DUF2058) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 272 | |||
| KOG0546|consensus | 372 | 100.0 | ||
| KOG0880|consensus | 217 | 100.0 | ||
| KOG0879|consensus | 177 | 100.0 | ||
| PTZ00221 | 249 | cyclophilin; Provisional | 100.0 | |
| cd01926 | 164 | cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph | 100.0 | |
| PTZ00060 | 183 | cyclophilin; Provisional | 100.0 | |
| PLN03149 | 186 | peptidyl-prolyl isomerase H (cyclophilin H); Provi | 100.0 | |
| KOG0111|consensus | 298 | 100.0 | ||
| KOG0881|consensus | 164 | 100.0 | ||
| cd01923 | 159 | cyclophilin_RING cyclophilin_RING: cyclophilin-typ | 100.0 | |
| COG0652 | 158 | PpiB Peptidyl-prolyl cis-trans isomerase (rotamase | 100.0 | |
| cd01921 | 166 | cyclophilin_RRM cyclophilin_RRM: cyclophilin-type | 100.0 | |
| cd01927 | 148 | cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ | 100.0 | |
| cd01928 | 153 | Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro | 100.0 | |
| cd01922 | 146 | cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c | 100.0 | |
| KOG0883|consensus | 518 | 100.0 | ||
| cd01925 | 171 | cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: | 100.0 | |
| KOG0882|consensus | 558 | 100.0 | ||
| PRK10903 | 190 | peptidyl-prolyl cis-trans isomerase A (rotamase A) | 100.0 | |
| KOG0884|consensus | 161 | 100.0 | ||
| KOG0865|consensus | 167 | 100.0 | ||
| PRK10791 | 164 | peptidyl-prolyl cis-trans isomerase B (rotamase B) | 100.0 | |
| cd01920 | 155 | cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc | 100.0 | |
| KOG0885|consensus | 439 | 100.0 | ||
| PF00160 | 155 | Pro_isomerase: Cyclophilin type peptidyl-prolyl ci | 100.0 | |
| cd00317 | 146 | cyclophilin cyclophilin: cyclophilin-type peptidyl | 100.0 | |
| KOG0415|consensus | 479 | 100.0 | ||
| cd01924 | 176 | cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc | 100.0 | |
| KOG0882|consensus | 558 | 97.76 | ||
| TIGR03268 | 503 | methan_mark_3 putative methanogenesis marker prote | 96.43 | |
| PRK00969 | 508 | hypothetical protein; Provisional | 96.37 | |
| TIGR03268 | 503 | methan_mark_3 putative methanogenesis marker prote | 96.35 | |
| COG4070 | 512 | Predicted peptidyl-prolyl cis-trans isomerase (rot | 96.31 | |
| PRK00969 | 508 | hypothetical protein; Provisional | 96.0 | |
| PF12903 | 147 | DUF3830: Protein of unknown function (DUF3830); In | 95.04 | |
| COG4070 | 512 | Predicted peptidyl-prolyl cis-trans isomerase (rot | 94.53 | |
| KOG2572|consensus | 498 | 88.21 | ||
| PF04126 | 120 | Cyclophil_like: Cyclophilin-like; InterPro: IPR007 | 84.66 | |
| PF06138 | 130 | Chordopox_E11: Chordopoxvirus E11 protein; InterPr | 82.89 | |
| KOG2270|consensus | 520 | 80.64 |
| >KOG0546|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=9e-67 Score=476.11 Aligned_cols=177 Identities=69% Similarity=1.128 Sum_probs=174.2
Q ss_pred CCCeEEEEEEECCeeceeEEEEEcCCCChhHHHHHHHHhcccCCCCccCCccceeeCcEEEEeecCceeeecCccCCCCC
Q psy17824 4 IRPRCYFDVEISDIPLGRIVFELYSDICPITCENFRALCTGEKGIGKTTGKNLHYLNIVFHRVVKGFMIQSGDFSVGNGT 83 (272)
Q Consensus 4 ~~p~v~~di~v~~t~~G~IvIeL~~d~aP~t~~nF~~L~~g~~g~g~~~~k~~~Y~g~~f~Rvi~~f~iqgGd~~~~~g~ 83 (272)
.||+|||||.|++.++|||||+||.|+||+||+||++||||+.|.+.++++.++|+|+.|||||++|||||||++.++|+
T Consensus 7 ~~pr~ffDISI~ge~~GRIvfeLf~dv~PKTaENFraLCtGE~G~~~~~gk~L~YKG~~FHRViK~FMiQgGDfs~gnGt 86 (372)
T KOG0546|consen 7 TNPRVFFDISIGGEPAGRIVFELFNDVVPKTAENFRALCTGEKGGGLTTGKPLHYKGSRFHRVIKNFMIQGGDFSEGNGT 86 (372)
T ss_pred CCceEEEEEEeCCcccceEEEEeecccCchhHHHHHHHhccccCCCCCCCCeeeecCchhheeeecceeeccccccCCCC
Confidence 48999999999999999999999999999999999999999999889999999999999999999999999999999999
Q ss_pred CCCccCCCCCCCCCcCcCCCcceeEeeeccCCCCCccEEEEEcCCCCCCCCCCcEEEEEecCHHHHHHHhcCCCCCCCCC
Q psy17824 84 GGESIYGGTFEDENFELKHDEPFLLSMANRGKDTNGSQFFITTQPAPHLDGVHVVFGHVVSGQNVVSHIENLPVDKMSRP 163 (272)
Q Consensus 84 gg~s~~g~~~~de~~~~~h~~~G~lsm~~~g~~s~~SqFfItl~~~p~ld~~~~VFG~Vi~G~dVl~~I~~~~~d~~~~P 163 (272)
||+||||..|+||+|.++|+++|||||||.||||||||||||+.++|||||.|||||+||.|++||+.|+++.||..++|
T Consensus 87 GGeSIYG~~FdDEnF~lKHdrpflLSMAN~GpNTNgSQFFITT~p~PHLdGkHVVFGqVI~G~~VVr~IEn~~~d~~skP 166 (372)
T KOG0546|consen 87 GGESIYGEKFDDENFELKHDRPFLLSMANRGPNTNGSQFFITTVPTPHLDGKHVVFGQVIKGKEVVREIENLETDEESKP 166 (372)
T ss_pred CcccccccccccccceeccCcchhhhhhcCCCCCCCcceEEeCCCCCCcCCceeEEeeEeechhHHHHHhccccccCCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCeEEeEeeeeccccc
Q psy17824 164 LQDVRVVKCNELVLKSK 180 (272)
Q Consensus 164 ~~~i~I~~cg~l~~~~~ 180 (272)
+.+|+|.+||+|+....
T Consensus 167 ~~dV~I~dCGel~~~~~ 183 (372)
T KOG0546|consen 167 LADVVISDCGELVKKSK 183 (372)
T ss_pred ccceEeccccccccccc
Confidence 99999999999998876
|
|
| >KOG0880|consensus | Back alignment and domain information |
|---|
| >KOG0879|consensus | Back alignment and domain information |
|---|
| >PTZ00221 cyclophilin; Provisional | Back alignment and domain information |
|---|
| >cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain | Back alignment and domain information |
|---|
| >PTZ00060 cyclophilin; Provisional | Back alignment and domain information |
|---|
| >PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional | Back alignment and domain information |
|---|
| >KOG0111|consensus | Back alignment and domain information |
|---|
| >KOG0881|consensus | Back alignment and domain information |
|---|
| >cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain | Back alignment and domain information |
|---|
| >COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) | Back alignment and domain information |
|---|
| >cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain | Back alignment and domain information |
|---|
| >cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like | Back alignment and domain information |
|---|
| >cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 | Back alignment and domain information |
|---|
| >KOG0883|consensus | Back alignment and domain information |
|---|
| >cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 | Back alignment and domain information |
|---|
| >KOG0882|consensus | Back alignment and domain information |
|---|
| >PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional | Back alignment and domain information |
|---|
| >KOG0884|consensus | Back alignment and domain information |
|---|
| >KOG0865|consensus | Back alignment and domain information |
|---|
| >PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional | Back alignment and domain information |
|---|
| >cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E | Back alignment and domain information |
|---|
| >KOG0885|consensus | Back alignment and domain information |
|---|
| >PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms | Back alignment and domain information |
|---|
| >cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases | Back alignment and domain information |
|---|
| >KOG0415|consensus | Back alignment and domain information |
|---|
| >cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 | Back alignment and domain information |
|---|
| >KOG0882|consensus | Back alignment and domain information |
|---|
| >TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 | Back alignment and domain information |
|---|
| >PRK00969 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 | Back alignment and domain information |
|---|
| >COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00969 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins | Back alignment and domain information |
|---|
| >COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2572|consensus | Back alignment and domain information |
|---|
| >PF04126 Cyclophil_like: Cyclophilin-like; InterPro: IPR007256 Proteins of this family have no known function | Back alignment and domain information |
|---|
| >PF06138 Chordopox_E11: Chordopoxvirus E11 protein; InterPro: IPR009201 This group represents a virion core protein, vaccinia E11L type | Back alignment and domain information |
|---|
| >KOG2270|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 272 | ||||
| 2gw2_A | 198 | Crystal Structure Of The Peptidyl-Prolyl Isomerase | 4e-58 | ||
| 2wfi_A | 179 | Atomic Resolution Crystal Structure Of The Ppiase D | 4e-58 | ||
| 2wfj_A | 179 | Atomic Resolution Crystal Structure Of The Ppiase D | 5e-58 | ||
| 2he9_A | 192 | Structure Of The Peptidylprolyl Isomerase Domain Of | 6e-54 | ||
| 1c5f_A | 177 | Crystal Structure Of The Cyclophilin-Like Domain Fr | 6e-49 | ||
| 1ihg_A | 370 | Bovine Cyclophilin 40, Monoclinic Form Length = 370 | 8e-43 | ||
| 1qng_A | 170 | Plasmodium Falciparum Cyclophilin Complexed With Cy | 8e-40 | ||
| 1qnh_A | 170 | Plasmodium Falciparum Cyclophilin (Double Mutant) C | 8e-39 | ||
| 1ist_A | 162 | Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng | 2e-38 | ||
| 2plu_A | 186 | Crystal Structure Of Cryptosporidium Parvum Cycloph | 2e-37 | ||
| 3ich_A | 188 | Crystal Structure Of Cyclophilin B At 1.2 A Resolut | 1e-36 | ||
| 1cyn_A | 178 | Cyclophilin B Complexed With [d-(Cholinylester)ser8 | 2e-36 | ||
| 4fru_A | 185 | Crystal Structure Of Horse Wild-Type Cyclophilin B | 9e-36 | ||
| 4frv_A | 185 | Crystal Structure Of Mutated Cyclophilin B That Cau | 1e-35 | ||
| 2ck1_A | 172 | The Structure Of Oxidised Cyclophilin A From S. Man | 2e-34 | ||
| 2cfe_A | 162 | The 1.5 A Crystal Structure Of The Malassezia Sympo | 2e-34 | ||
| 2hqj_A | 183 | Cyclophilin From Leishmania Major Length = 183 | 2e-34 | ||
| 1dyw_A | 173 | Biochemical And Structural Characterization Of A Di | 3e-34 | ||
| 3bt8_A | 172 | Crystal Structure Of Mutant Cyclophilin (R147a) Fro | 1e-33 | ||
| 2haq_A | 172 | Crystal Structure Of Cyclophilin A From Leishmania | 1e-33 | ||
| 3rdd_A | 184 | Human Cyclophilin A Complexed With An Inhibitor Len | 2e-33 | ||
| 1m9e_A | 164 | X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- | 2e-33 | ||
| 2x2a_A | 165 | Free Acetyl-Cypa Trigonal Form Length = 165 | 2e-33 | ||
| 2rma_A | 165 | Crystal Structures Of Cyclophilin A Complexed With | 3e-33 | ||
| 2xgy_B | 173 | Complex Of Rabbit Endogenous Lentivirus (Relik)caps | 3e-33 | ||
| 2x2c_K | 165 | Acetyl-Cypa:cyclosporine Complex Length = 165 | 3e-33 | ||
| 2alf_A | 164 | Crystal Structure Of Human Cypa Mutant K131a Length | 4e-33 | ||
| 3k0o_A | 165 | Room Temperature Structure Of Cypa Mutant Ser99thr | 5e-33 | ||
| 1bck_A | 165 | Human Cyclophilin A Complexed With 2-Thr Cyclospori | 5e-33 | ||
| 5cyh_A | 164 | Cyclophilin A Complexed With Dipeptide Gly-Pro Leng | 5e-33 | ||
| 3r49_A | 166 | Human Cyclophilin D Complexed With Quinolin-8-Amine | 5e-33 | ||
| 3k0r_A | 165 | Cryogenic Structure Of Cypa Mutant Arg55lys Length | 6e-33 | ||
| 2bit_X | 165 | Crystal Structure Of Human Cyclophilin D At 1.7 A R | 6e-33 | ||
| 2z6w_A | 165 | Crystal Structure Of Human Cyclophilin D In Complex | 7e-33 | ||
| 3qyu_A | 164 | Crystal Structure Of Human Cyclophilin D At 1.54 A | 7e-33 | ||
| 2x25_B | 169 | Free Acetyl-Cypa Orthorhombic Form Length = 169 | 8e-33 | ||
| 2wlw_A | 165 | Structure Of The N-Terminal Capsid Domain Of Hiv-2 | 1e-32 | ||
| 4dgd_A | 165 | Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 | 1e-32 | ||
| 2x83_B | 163 | Evolutionary Basis Of Hiv Restriction By The Antire | 2e-32 | ||
| 1h0p_A | 182 | Cyclophilin_5 From C. Elegans Length = 182 | 3e-32 | ||
| 2rmc_A | 182 | Crystal Structure Of Murine Cyclophilin C Complexed | 5e-32 | ||
| 3pmp_A | 164 | Crystal Structure Of Cyclophilin A From Moniliophth | 6e-32 | ||
| 3o7t_A | 164 | Crystal Structure Of Cyclophilin A From Moniliophth | 7e-32 | ||
| 1qoi_A | 177 | U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = | 8e-32 | ||
| 2r99_A | 173 | Crystal Structure Of Cyclophilin Abh-Like Domain Of | 1e-31 | ||
| 4i9y_A | 167 | Structure Of The C-terminal Domain Of Nup358 Length | 2e-31 | ||
| 1zmf_A | 165 | C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 | 2e-31 | ||
| 1xo7_A | 166 | Crystal Structure Of Cyclophilin From Trypanosoma C | 2e-31 | ||
| 1aws_A | 164 | Secypa Complexed With Hagpia (Pseudo-Symmetric Mono | 3e-31 | ||
| 2esl_A | 190 | Human Cyclophilin C In Complex With Cyclosporin A L | 4e-31 | ||
| 3uch_A | 174 | Crystal Structure Of A Hypotherical Peptidyl-Prolyl | 2e-29 | ||
| 1z81_A | 229 | Crystal Structure Of Cyclophilin From Plasmodium Yo | 3e-29 | ||
| 3k2c_A | 193 | Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom | 5e-29 | ||
| 2c3b_A | 172 | The Crystal Structure Of Aspergillus Fumigatus Cycl | 1e-28 | ||
| 2fu0_A | 160 | Plasmodium Falciparum Cyclophilin Pfe0505w Putative | 4e-28 | ||
| 2a2n_A | 176 | Crystal Structure Of The Peptidylprolyl Isomerase D | 5e-28 | ||
| 1xyh_A | 161 | Crystal Structure Of Recombinant Human Cyclophilin | 6e-26 | ||
| 2oju_A | 167 | X-Ray Structure Of Complex Of Human Cyclophilin J W | 7e-26 | ||
| 2b71_A | 196 | Plasmodium Yoelii Cyclophilin-Like Protein Length = | 2e-23 | ||
| 2poe_A | 185 | Crystal Structure Of Cryptosporidium Parvum Cycloph | 4e-23 | ||
| 1xwn_A | 174 | Solution Structure Of Cyclophilin Like 1(Ppil1) And | 6e-23 | ||
| 2k7n_A | 203 | Solution Structure Of The Ppil1 Bound To A Fragment | 6e-23 | ||
| 2x7k_A | 166 | The Crystal Structure Of Ppil1 In Complex With Cycl | 7e-23 | ||
| 2hq6_A | 185 | Structure Of The Cyclophilin_cecyp16-like Domain Of | 7e-17 | ||
| 1zkc_A | 197 | Crystal Structure Of The Cyclophiln_ring Domain Of | 1e-14 | ||
| 1w74_A | 191 | X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer | 1e-13 | ||
| 3bo7_A | 201 | Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro | 2e-10 | ||
| 3bkp_A | 232 | Crystal Structure Of The Toxoplasma Gondii Cyclophi | 3e-10 | ||
| 3t1u_A | 163 | Crystal Structure Of The Complex Of Cyclophilin-a E | 9e-05 | ||
| 1lop_A | 164 | Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P | 3e-04 | ||
| 2nul_A | 164 | Peptidylprolyl Isomerase From E. Coli Length = 164 | 4e-04 |
| >pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 | Back alignment and structure |
|
| >pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 | Back alignment and structure |
| >pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 | Back alignment and structure |
| >pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 | Back alignment and structure |
| >pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 | Back alignment and structure |
| >pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 | Back alignment and structure |
| >pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 | Back alignment and structure |
| >pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 | Back alignment and structure |
| >pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 | Back alignment and structure |
| >pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 | Back alignment and structure |
| >pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 | Back alignment and structure |
| >pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 | Back alignment and structure |
| >pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 | Back alignment and structure |
| >pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 | Back alignment and structure |
| >pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 | Back alignment and structure |
| >pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 | Back alignment and structure |
| >pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 | Back alignment and structure |
| >pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 | Back alignment and structure |
| >pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 | Back alignment and structure |
| >pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 | Back alignment and structure |
| >pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 | Back alignment and structure |
| >pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 | Back alignment and structure |
| >pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 | Back alignment and structure |
| >pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 | Back alignment and structure |
| >pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 | Back alignment and structure |
| >pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 | Back alignment and structure |
| >pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 | Back alignment and structure |
| >pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 | Back alignment and structure |
| >pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 | Back alignment and structure |
| >pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 | Back alignment and structure |
| >pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 | Back alignment and structure |
| >pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 | Back alignment and structure |
| >pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 | Back alignment and structure |
| >pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 | Back alignment and structure |
| >pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 | Back alignment and structure |
| >pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 | Back alignment and structure |
| >pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 | Back alignment and structure |
| >pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 | Back alignment and structure |
| >pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 | Back alignment and structure |
| >pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 | Back alignment and structure |
| >pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 | Back alignment and structure |
| >pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 | Back alignment and structure |
| >pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 | Back alignment and structure |
| >pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 | Back alignment and structure |
| >pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 | Back alignment and structure |
| >pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 | Back alignment and structure |
| >pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 | Back alignment and structure |
| >pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 | Back alignment and structure |
| >pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 | Back alignment and structure |
| >pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 | Back alignment and structure |
| >pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 | Back alignment and structure |
| >pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 | Back alignment and structure |
| >pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 | Back alignment and structure |
| >pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 | Back alignment and structure |
| >pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 | Back alignment and structure |
| >pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 | Back alignment and structure |
| >pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 | Back alignment and structure |
| >pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 | Back alignment and structure |
| >pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 | Back alignment and structure |
| >pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 | Back alignment and structure |
| >pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 | Back alignment and structure |
| >pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 | Back alignment and structure |
| >pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 | Back alignment and structure |
| >pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 | Back alignment and structure |
| >pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 | Back alignment and structure |
| >pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 | Back alignment and structure |
| >pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 | Back alignment and structure |
| >pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 | Back alignment and structure |
| >pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 | Back alignment and structure |
| >pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 | Back alignment and structure |
| >pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 272 | |||
| 1a58_A | 177 | Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala | 1e-117 | |
| 2he9_A | 192 | NK-tumor recognition protein; cyclosporin, isomera | 1e-117 | |
| 2wfi_A | 179 | Peptidyl-prolyl CIS-trans isomerase G; phosphoprot | 1e-116 | |
| 1mzw_A | 177 | Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc | 1e-107 | |
| 2igv_A | 173 | Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 | 1e-103 | |
| 2poy_A | 186 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 1e-102 | |
| 1qng_A | 170 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 1e-102 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 1e-102 | |
| 2ose_A | 234 | Probable peptidyl-prolyl CIS-trans isomerase; cycl | 1e-101 | |
| 1z81_A | 229 | Cyclophilin; structural genomics, structural genom | 1e-99 | |
| 2haq_A | 172 | Cyclophilin; rotamase, proline, isomerase, CIS-tra | 2e-97 | |
| 3ich_A | 188 | Peptidyl-prolyl CIS-trans isomerase B; beta sandwi | 1e-96 | |
| 2cmt_A | 172 | Peptidyl-prolyl CIS-trans isomerase E; rotamase ac | 8e-94 | |
| 2r99_A | 173 | Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i | 4e-93 | |
| 2z6w_A | 165 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 9e-93 | |
| 3pmp_A | 164 | Cyclophilin A; peptidyl prolyl isomerase, isomeras | 1e-92 | |
| 3k2c_A | 193 | Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, | 3e-92 | |
| 3rdd_A | 184 | Peptidyl-prolyl CIS-trans isomerase A; beta barrel | 1e-90 | |
| 2c3b_A | 172 | Ppiase, cyclophilin; isomerase, 3D domain swapping | 4e-90 | |
| 2fu0_A | 160 | Cyclophilin, putative; PFE0505W, cyclosporin-bindi | 1e-78 | |
| 2k7n_A | 203 | Peptidyl-prolyl CIS-trans isomerase-like 1; beta b | 2e-78 | |
| 2a2n_A | 176 | Peptidylprolyl isomerase domain and WD repeat CON; | 1e-77 | |
| 2x7k_A | 166 | Peptidyl-prolyl CIS-trans isomerase-like 1; isomer | 1e-77 | |
| 2b71_A | 196 | Cyclophilin-like protein; structural genomics, str | 5e-74 | |
| 2poe_A | 185 | Cyclophilin-like protein, putative; cryptosporidiu | 2e-72 | |
| 2ok3_A | 161 | Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b | 3e-71 | |
| 3bo7_A | 201 | Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; | 9e-70 | |
| 2hq6_A | 185 | Serologically defined colon cancer antigen 10; pro | 2e-69 | |
| 1zkc_A | 197 | Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr | 6e-68 | |
| 1w74_A | 191 | Peptidyl-prolyl CIS-trans isomerase A; cyclophilin | 3e-65 | |
| 3bkp_A | 232 | Cyclophilin; malaria, isomerase, structural GENO s | 5e-60 | |
| 3s6m_A | 167 | Peptidyl-prolyl CIS-trans isomerase; seattle struc | 2e-41 | |
| 1lop_A | 164 | Cyclophilin A; rotamase, isomerase-isomerase inhib | 6e-40 | |
| 1v9t_A | 166 | Cyclophilin B; beta barrel, isomerase-isomerase in | 2e-39 | |
| 3rfy_A | 369 | Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; | 3e-29 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 7e-07 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 4e-05 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 1e-04 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 5e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-04 |
| >1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 | Back alignment and structure |
|---|
Score = 331 bits (852), Expect = e-117
Identities = 108/173 (62%), Positives = 127/173 (73%)
Query: 4 IRPRCYFDVEISDIPLGRIVFELYSDICPITCENFRALCTGEKGIGKTTGKNLHYLNIVF 63
R R + DV I GRIV ELY+DI P TC NF LCTG G GK +GK LHY F
Sbjct: 5 DRRRVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTF 64
Query: 64 HRVVKGFMIQSGDFSVGNGTGGESIYGGTFEDENFELKHDEPFLLSMANRGKDTNGSQFF 123
HRV+K FMIQ GDF+ G+GTGGESIYGG F+DE F +KHDEPF++SMAN+G +TNGSQFF
Sbjct: 65 HRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFF 124
Query: 124 ITTQPAPHLDGVHVVFGHVVSGQNVVSHIENLPVDKMSRPLQDVRVVKCNELV 176
ITT PAPHL+ +HVVFG VVSGQ VV+ IE L + +RPL DV ++ C ELV
Sbjct: 125 ITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGELV 177
|
| >2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 | Back alignment and structure |
|---|
| >2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 | Back alignment and structure |
|---|
| >1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 | Back alignment and structure |
|---|
| >2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 | Back alignment and structure |
|---|
| >2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 | Back alignment and structure |
|---|
| >1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 | Back alignment and structure |
|---|
| >1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 | Back alignment and structure |
|---|
| >2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 | Back alignment and structure |
|---|
| >3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 | Back alignment and structure |
|---|
| >2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 | Back alignment and structure |
|---|
| >2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 | Back alignment and structure |
|---|
| >2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 | Back alignment and structure |
|---|
| >3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 | Back alignment and structure |
|---|
| >3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 | Back alignment and structure |
|---|
| >3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 | Back alignment and structure |
|---|
| >2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 | Back alignment and structure |
|---|
| >2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 | Back alignment and structure |
|---|
| >2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 | Back alignment and structure |
|---|
| >2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 | Back alignment and structure |
|---|
| >2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 | Back alignment and structure |
|---|
| >2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 | Back alignment and structure |
|---|
| >2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 | Back alignment and structure |
|---|
| >3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 | Back alignment and structure |
|---|
| >2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 | Back alignment and structure |
|---|
| >1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 | Back alignment and structure |
|---|
| >3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 | Back alignment and structure |
|---|
| >3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 | Back alignment and structure |
|---|
| >1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 | Back alignment and structure |
|---|
| >1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 | Back alignment and structure |
|---|
| >3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 272 | |||
| 2wfi_A | 179 | Peptidyl-prolyl CIS-trans isomerase G; phosphoprot | 100.0 | |
| 2he9_A | 192 | NK-tumor recognition protein; cyclosporin, isomera | 100.0 | |
| 1a58_A | 177 | Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala | 100.0 | |
| 2igv_A | 173 | Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 | 100.0 | |
| 1qng_A | 170 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 3pmp_A | 164 | Cyclophilin A; peptidyl prolyl isomerase, isomeras | 100.0 | |
| 2poy_A | 186 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 2haq_A | 172 | Cyclophilin; rotamase, proline, isomerase, CIS-tra | 100.0 | |
| 1mzw_A | 177 | Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc | 100.0 | |
| 2z6w_A | 165 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 2cmt_A | 172 | Peptidyl-prolyl CIS-trans isomerase E; rotamase ac | 100.0 | |
| 2r99_A | 173 | Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i | 100.0 | |
| 3ich_A | 188 | Peptidyl-prolyl CIS-trans isomerase B; beta sandwi | 100.0 | |
| 4fru_A | 185 | Cyclophilin B, peptidyl-prolyl CIS-trans isomerase | 100.0 | |
| 3rdd_A | 184 | Peptidyl-prolyl CIS-trans isomerase A; beta barrel | 100.0 | |
| 3k2c_A | 193 | Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, | 100.0 | |
| 1z81_A | 229 | Cyclophilin; structural genomics, structural genom | 100.0 | |
| 2c3b_A | 172 | Ppiase, cyclophilin; isomerase, 3D domain swapping | 100.0 | |
| 2ose_A | 234 | Probable peptidyl-prolyl CIS-trans isomerase; cycl | 100.0 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 100.0 | |
| 2poe_A | 185 | Cyclophilin-like protein, putative; cryptosporidiu | 100.0 | |
| 3bo7_A | 201 | Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; | 100.0 | |
| 1zkc_A | 197 | Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr | 100.0 | |
| 2ok3_A | 161 | Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b | 100.0 | |
| 2b71_A | 196 | Cyclophilin-like protein; structural genomics, str | 100.0 | |
| 2x7k_A | 166 | Peptidyl-prolyl CIS-trans isomerase-like 1; isomer | 100.0 | |
| 1w74_A | 191 | Peptidyl-prolyl CIS-trans isomerase A; cyclophilin | 100.0 | |
| 2fu0_A | 160 | Cyclophilin, putative; PFE0505W, cyclosporin-bindi | 100.0 | |
| 2a2n_A | 176 | Peptidylprolyl isomerase domain and WD repeat CON; | 100.0 | |
| 2k7n_A | 203 | Peptidyl-prolyl CIS-trans isomerase-like 1; beta b | 100.0 | |
| 2hq6_A | 185 | Serologically defined colon cancer antigen 10; pro | 100.0 | |
| 3bkp_A | 232 | Cyclophilin; malaria, isomerase, structural GENO s | 100.0 | |
| 1v9t_A | 166 | Cyclophilin B; beta barrel, isomerase-isomerase in | 100.0 | |
| 1lop_A | 164 | Cyclophilin A; rotamase, isomerase-isomerase inhib | 100.0 | |
| 3s6m_A | 167 | Peptidyl-prolyl CIS-trans isomerase; seattle struc | 100.0 | |
| 3rfy_A | 369 | Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; | 100.0 | |
| 2nnz_A | 153 | Hypothetical protein; beta-barrel, structural geno | 95.52 | |
| 3kop_A | 188 | Uncharacterized protein; protein with A cyclophili | 93.36 | |
| 1zx8_A | 136 | Hypothetical protein TM1367; structural genomics, | 85.31 |
| >2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A | Back alignment and structure |
|---|
Probab=100.00 E-value=6.1e-58 Score=390.98 Aligned_cols=173 Identities=68% Similarity=1.215 Sum_probs=167.6
Q ss_pred CCCCeEEEEEEECCeeceeEEEEEcCCCChhHHHHHHHHhcccCCCCccCCccceeeCcEEEEeecCceeeecCccCCCC
Q psy17824 3 LIRPRCYFDVEISDIPLGRIVFELYSDICPITCENFRALCTGEKGIGKTTGKNLHYLNIVFHRVVKGFMIQSGDFSVGNG 82 (272)
Q Consensus 3 ~~~p~v~~di~v~~t~~G~IvIeL~~d~aP~t~~nF~~L~~g~~g~g~~~~k~~~Y~g~~f~Rvi~~f~iqgGd~~~~~g 82 (272)
..||+|||||+|++|++|+|+|+||++.||+||+||+.||+|+.|.|+..++.+||+|+.||||+|+|||||||+..++|
T Consensus 7 ~~~~~vf~di~i~~t~~G~i~ieL~~~~aP~t~~NF~~L~~g~~g~~~~~~~~~~Y~g~~FhRvi~~f~iQgGd~~~~~g 86 (179)
T 2wfi_A 7 VQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNG 86 (179)
T ss_dssp -CCCEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHCTTCBCTTTCSBSCCTTCBEEEEETTTEEEECCTTTSSS
T ss_pred CCCCeEEEEEEECCccceEEEEEEcCCCCChHHHHHHHHhcCCcCcccccccCCeECCCEEEEEECCCEEEcccccCCCC
Confidence 36999999999999999999999999999999999999999999988878889999999999999999999999988999
Q ss_pred CCCCccCCCCCCCCCcCcCCCcceeEeeeccCCCCCccEEEEEcCCCCCCCCCCcEEEEEecCHHHHHHHhcCCCCCCCC
Q psy17824 83 TGGESIYGGTFEDENFELKHDEPFLLSMANRGKDTNGSQFFITTQPAPHLDGVHVVFGHVVSGQNVVSHIENLPVDKMSR 162 (272)
Q Consensus 83 ~gg~s~~g~~~~de~~~~~h~~~G~lsm~~~g~~s~~SqFfItl~~~p~ld~~~~VFG~Vi~G~dVl~~I~~~~~d~~~~ 162 (272)
+++.++||..|++|++.+.|+.+|+|||||.++++|+||||||+.++||||+.|+|||+|++||+||++|+.++++.+++
T Consensus 87 ~gg~si~g~~f~dE~~~~~h~~~G~lsMAn~gp~tngSQFfIt~~~~~~LDg~~tVFG~Vv~G~dvv~~I~~~~t~~~~~ 166 (179)
T 2wfi_A 87 RGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASK 166 (179)
T ss_dssp SCCCCTTSSCBCCCCCCSCCCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTCCBCTTSC
T ss_pred CCCCcccCCcccccccCcCcCCCeEEEEEeCCCCCcceEEEEEcCCCcccCCCeeEEEEEeCCHHHHHHHHcCCCCCCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999998999
Q ss_pred CccCeEEeEeeee
Q psy17824 163 PLQDVRVVKCNEL 175 (272)
Q Consensus 163 P~~~i~I~~cg~l 175 (272)
|..+|+|.+||+|
T Consensus 167 P~~~v~I~~~G~l 179 (179)
T 2wfi_A 167 PFAEVRILSCGEL 179 (179)
T ss_dssp BSSCEEEEEEEEC
T ss_pred CCCCeEEEeCeeC
Confidence 9999999999986
|
| >2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* | Back alignment and structure |
|---|
| >2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A | Back alignment and structure |
|---|
| >1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* | Back alignment and structure |
|---|
| >3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A | Back alignment and structure |
|---|
| >2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* | Back alignment and structure |
|---|
| >2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A | Back alignment and structure |
|---|
| >1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A | Back alignment and structure |
|---|
| >2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... | Back alignment and structure |
|---|
| >2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A | Back alignment and structure |
|---|
| >2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A | Back alignment and structure |
|---|
| >3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* | Back alignment and structure |
|---|
| >4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* | Back alignment and structure |
|---|
| >3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A | Back alignment and structure |
|---|
| >3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* | Back alignment and structure |
|---|
| >2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A | Back alignment and structure |
|---|
| >1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A | Back alignment and structure |
|---|
| >1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A | Back alignment and structure |
|---|
| >3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* | Back alignment and structure |
|---|
| >3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2nnz_A Hypothetical protein; beta-barrel, structural genomics, ontario centre for structu proteomics, OCSP, unknown function; NMR {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} | Back alignment and structure |
|---|
| >1zx8_A Hypothetical protein TM1367; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: 1PE; 1.90A {Thermotoga maritima} SCOP: b.62.1.3 PDB: 2ka0_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 272 | ||||
| d1a33a_ | 174 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( | 4e-62 | |
| d1qnga_ | 170 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium | 7e-56 | |
| d1ihga2 | 195 | b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain | 4e-55 | |
| d2cfea1 | 162 | b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s | 6e-54 | |
| d2igva1 | 172 | b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno | 5e-53 | |
| d2z6wa1 | 164 | b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c | 6e-51 | |
| d1qoia_ | 173 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom | 1e-48 | |
| d1xo7a_ | 166 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom | 2e-48 | |
| d2rmca_ | 182 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus | 5e-48 | |
| d2c3ba1 | 171 | b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper | 1e-46 | |
| d1h0pa_ | 182 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd | 4e-46 | |
| d1xwna1 | 166 | b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome | 2e-44 | |
| d1z81a1 | 186 | b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas | 3e-44 | |
| d2r99a1 | 161 | b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl | 4e-44 | |
| d1zkca1 | 178 | b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso | 9e-40 | |
| d2ok3a1 | 159 | b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B | 2e-38 | |
| d1w74a_ | 171 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 2e-38 | |
| d2fu0a1 | 155 | b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { | 8e-33 | |
| d2a2na1 | 164 | b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma | 1e-31 | |
| d2b71a1 | 169 | b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 | 1e-30 | |
| d1lopa_ | 164 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 7e-26 | |
| d1v9ta_ | 166 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 1e-23 |
| >d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cyclophilin-like superfamily: Cyclophilin-like family: Cyclophilin (peptidylprolyl isomerase) domain: Cyclophilin (eukaryotic) species: Nematode (Brugia malayi) [TaxId: 6279]
Score = 191 bits (486), Expect = 4e-62
Identities = 108/172 (62%), Positives = 127/172 (73%)
Query: 5 RPRCYFDVEISDIPLGRIVFELYSDICPITCENFRALCTGEKGIGKTTGKNLHYLNIVFH 64
R R + DV I GRIV ELY+DI P TC NF LCTG G GK +GK LHY FH
Sbjct: 3 RRRVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFH 62
Query: 65 RVVKGFMIQSGDFSVGNGTGGESIYGGTFEDENFELKHDEPFLLSMANRGKDTNGSQFFI 124
RV+K FMIQ GDF+ G+GTGGESIYGG F+DE F +KHDEPF++SMAN+G +TNGSQFFI
Sbjct: 63 RVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFI 122
Query: 125 TTQPAPHLDGVHVVFGHVVSGQNVVSHIENLPVDKMSRPLQDVRVVKCNELV 176
TT PAPHL+ +HVVFG VVSGQ VV+ IE L + +RPL DV ++ C ELV
Sbjct: 123 TTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGELV 174
|
| >d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 | Back information, alignment and structure |
|---|
| >d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 | Back information, alignment and structure |
|---|
| >d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 | Back information, alignment and structure |
|---|
| >d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 | Back information, alignment and structure |
|---|
| >d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 | Back information, alignment and structure |
|---|
| >d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 | Back information, alignment and structure |
|---|
| >d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 | Back information, alignment and structure |
|---|
| >d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 | Back information, alignment and structure |
|---|
| >d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 | Back information, alignment and structure |
|---|
| >d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
| >d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 | Back information, alignment and structure |
|---|
| >d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 | Back information, alignment and structure |
|---|
| >d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 | Back information, alignment and structure |
|---|
| >d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 | Back information, alignment and structure |
|---|
| >d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 272 | |||
| d1a33a_ | 174 | Cyclophilin (eukaryotic) {Nematode (Brugia malayi) | 100.0 | |
| d2igva1 | 172 | Cyclophilin (eukaryotic) {Caenorhabditis elegans, | 100.0 | |
| d1qnga_ | 170 | Cyclophilin (eukaryotic) {Plasmodium falciparum [T | 100.0 | |
| d2r99a1 | 161 | Mitochondrial peptidyl-prolyl cis-trans isomerase, | 100.0 | |
| d1ihga2 | 195 | Cyclophilin 40 isomerase domain {Cow (Bos taurus) | 100.0 | |
| d2z6wa1 | 164 | Mitochondrial peptidyl-prolyl cis-trans isomerase, | 100.0 | |
| d1qoia_ | 173 | Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 | 100.0 | |
| d1h0pa_ | 182 | Cyclophilin (eukaryotic) {Caenorhabditis elegans, | 100.0 | |
| d2rmca_ | 182 | Cyclophilin (eukaryotic) {Mouse (Mus musculus), va | 100.0 | |
| d1xo7a_ | 166 | Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId | 100.0 | |
| d1z81a1 | 186 | Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId | 100.0 | |
| d2cfea1 | 162 | Cyclophilin-like allergen Mal s 6 {Malassezia symp | 100.0 | |
| d2c3ba1 | 171 | Cyclophilin (eukaryotic) {Aspergillus fumigatus [T | 100.0 | |
| d2ok3a1 | 159 | Cyclophilin-like protein PPIL3B {Human (Homo sapie | 100.0 | |
| d1zkca1 | 178 | Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop | 100.0 | |
| d1xwna1 | 166 | Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 | 100.0 | |
| d2fu0a1 | 155 | Putative cyclophilin PFE0505w {Plasmodium falcipar | 100.0 | |
| d2b71a1 | 169 | Cyclophilin-like protein PY00693 {Plasmodium yoeli | 100.0 | |
| d1v9ta_ | 166 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche | 100.0 | |
| d2a2na1 | 164 | Peptidylprolyl isomerase domain and WD repeat-cont | 100.0 | |
| d1w74a_ | 171 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob | 100.0 | |
| d1lopa_ | 164 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche | 100.0 | |
| d1zx8a1 | 124 | Hypothetical protein TM1367 {Thermotoga maritima [ | 88.91 |
| >d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cyclophilin-like superfamily: Cyclophilin-like family: Cyclophilin (peptidylprolyl isomerase) domain: Cyclophilin (eukaryotic) species: Nematode (Brugia malayi) [TaxId: 6279]
Probab=100.00 E-value=1e-50 Score=342.38 Aligned_cols=174 Identities=62% Similarity=1.062 Sum_probs=166.7
Q ss_pred CCCCeEEEEEEECCeeceeEEEEEcCCCChhHHHHHHHHhcccCCCCccCCccceeeCcEEEEeecCceeeecCccCCCC
Q psy17824 3 LIRPRCYFDVEISDIPLGRIVFELYSDICPITCENFRALCTGEKGIGKTTGKNLHYLNIVFHRVVKGFMIQSGDFSVGNG 82 (272)
Q Consensus 3 ~~~p~v~~di~v~~t~~G~IvIeL~~d~aP~t~~nF~~L~~g~~g~g~~~~k~~~Y~g~~f~Rvi~~f~iqgGd~~~~~g 82 (272)
+.|++|||||+|+++++|+|+|+||.+.||+||+||+.||++..+.++..++.++|+|+.||||+++++||+|++..+++
T Consensus 1 ~~~~~v~~di~i~~~~~G~I~ieL~~d~aP~tv~nF~~l~~~~~~~~~~~~k~~~Y~~~~f~Rv~~~~~iq~g~~~~~~~ 80 (174)
T d1a33a_ 1 KDRRRVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDG 80 (174)
T ss_dssp CCCEEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHCTTCBCTTTCSBCCCTTCBEEEEETTTEEEECCTTTSSS
T ss_pred CCCCEEEEEEEECCEeceEEEEEECCCCChHHHHHHHHHHhcccCCCcccCccceeCCceeeEEEeCCEEeeCCCCCCCC
Confidence 46899999999999999999999999999999999999999998888888899999999999999999999999988888
Q ss_pred CCCCccCCCCCCCCCcCcCCCcceeEeeeccCCCCCccEEEEEcCCCCCCCCCCcEEEEEecCHHHHHHHhcCCCCCCCC
Q psy17824 83 TGGESIYGGTFEDENFELKHDEPFLLSMANRGKDTNGSQFFITTQPAPHLDGVHVVFGHVVSGQNVVSHIENLPVDKMSR 162 (272)
Q Consensus 83 ~gg~s~~g~~~~de~~~~~h~~~G~lsm~~~g~~s~~SqFfItl~~~p~ld~~~~VFG~Vi~G~dVl~~I~~~~~d~~~~ 162 (272)
.++.+.++..+.++...++|+.+|+|+|++.++++++|||||+|+++|+||+.|+|||+|++|||||++|+.++++.+++
T Consensus 81 ~~~~~~~~~~~~~~~~~~~~~~~g~l~~~~~~~~s~~sqFfI~~~~~p~ld~~~~vFG~VveG~dvl~~I~~~~t~~~~~ 160 (174)
T d1a33a_ 81 TGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNR 160 (174)
T ss_dssp SCCCCTTSSCBCCCCSCSCCCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTSCBCTTSC
T ss_pred CCCCCccCccccccccccccCcceeeeeeccCCCCCCcccccccCCcccccccceeEEEEechHHHHHHHHhCCcCCCCC
Confidence 88888888888888889999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CccCeEEeEeeeec
Q psy17824 163 PLQDVRVVKCNELV 176 (272)
Q Consensus 163 P~~~i~I~~cg~l~ 176 (272)
|..+|+|++||+|+
T Consensus 161 P~~~i~I~~cGel~ 174 (174)
T d1a33a_ 161 PLADVVILNCGELV 174 (174)
T ss_dssp BSSCEEEEEEEECC
T ss_pred CCCCEEEEeeEEEC
Confidence 99999999999985
|
| >d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} | Back information, alignment and structure |
|---|
| >d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zx8a1 b.62.1.3 (A:1-124) Hypothetical protein TM1367 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|