Psyllid ID: psy17881
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 68 | ||||||
| 193656953 | 922 | PREDICTED: actin-binding LIM protein 1-l | 0.485 | 0.035 | 0.757 | 2e-06 | |
| 328709991 | 921 | PREDICTED: actin-binding LIM protein 1-l | 0.485 | 0.035 | 0.757 | 2e-06 | |
| 427782719 | 711 | Putative actin-binding lim zn-finger pro | 0.485 | 0.046 | 0.727 | 3e-06 | |
| 158294174 | 830 | AGAP005425-PA [Anopheles gambiae str. PE | 0.485 | 0.039 | 0.727 | 3e-06 | |
| 427782711 | 735 | Putative actin-binding lim zn-finger pro | 0.485 | 0.044 | 0.727 | 3e-06 | |
| 242017898 | 785 | ablim, putative [Pediculus humanus corpo | 0.470 | 0.040 | 0.781 | 5e-06 | |
| 237681213 | 768 | AT12452p [Drosophila melanogaster] | 0.485 | 0.042 | 0.666 | 1e-05 | |
| 195113929 | 846 | GI21937 [Drosophila mojavensis] gi|19391 | 0.485 | 0.039 | 0.666 | 1e-05 | |
| 194767637 | 861 | GF11572 [Drosophila ananassae] gi|190619 | 0.485 | 0.038 | 0.666 | 1e-05 | |
| 16903148 | 765 | DUNC-115s [Drosophila melanogaster] | 0.485 | 0.043 | 0.666 | 1e-05 |
| >gi|193656953|ref|XP_001949191.1| PREDICTED: actin-binding LIM protein 1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 56.6 bits (135), Expect = 2e-06, Method: Compositional matrix adjust.
Identities = 25/33 (75%), Positives = 28/33 (84%)
Query: 30 LKQSHINPRNASRTPSATKEPMYRLRYQSPVNA 62
K SHI+PRNASR PSA +EP YRLRYQSP+NA
Sbjct: 682 WKVSHIDPRNASRCPSAAREPTYRLRYQSPINA 714
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328709991|ref|XP_003244131.1| PREDICTED: actin-binding LIM protein 1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|427782719|gb|JAA56811.1| Putative actin-binding lim zn-finger protein limatin involved in axon guidance [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|158294174|ref|XP_315432.4| AGAP005425-PA [Anopheles gambiae str. PEST] gi|157015442|gb|EAA11937.4| AGAP005425-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|427782711|gb|JAA56807.1| Putative actin-binding lim zn-finger protein limatin involved in axon guidance [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|242017898|ref|XP_002429421.1| ablim, putative [Pediculus humanus corporis] gi|212514347|gb|EEB16683.1| ablim, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|237681213|gb|ACR10173.1| AT12452p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195113929|ref|XP_002001520.1| GI21937 [Drosophila mojavensis] gi|193918114|gb|EDW16981.1| GI21937 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|194767637|ref|XP_001965921.1| GF11572 [Drosophila ananassae] gi|190619764|gb|EDV35288.1| GF11572 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|16903148|gb|AAL30428.1|AF434684_1 DUNC-115s [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 68 | ||||||
| FB|FBgn0260463 | 806 | Unc-115b [Drosophila melanogas | 0.470 | 0.039 | 0.687 | 4.9e-08 | |
| FB|FBgn0051352 | 844 | Unc-115a [Drosophila melanogas | 0.470 | 0.037 | 0.687 | 5.5e-08 | |
| WB|WBGene00006839 | 639 | unc-115 [Caenorhabditis elegan | 0.529 | 0.056 | 0.552 | 0.00059 | |
| UNIPROTKB|Q95QM5 | 639 | unc-115 "Protein UNC-115, isof | 0.529 | 0.056 | 0.552 | 0.00059 |
| FB|FBgn0260463 Unc-115b [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 131 (51.2 bits), Expect = 4.9e-08, Sum P(2) = 4.9e-08
Identities = 22/32 (68%), Positives = 31/32 (96%)
Query: 31 KQSHINPRNASRTPSATKEPMYRLRYQSPVNA 62
KQ++++PRNASRTPSA+KEP+Y+LRY+SP+ A
Sbjct: 567 KQNNLDPRNASRTPSASKEPLYKLRYESPIGA 598
|
|
| FB|FBgn0051352 Unc-115a [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00006839 unc-115 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q95QM5 unc-115 "Protein UNC-115, isoform b" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 68 | |||
| KOG1044|consensus | 670 | 97.86 | ||
| KOG1044|consensus | 670 | 93.0 |
| >KOG1044|consensus | Back alignment and domain information |
|---|
Probab=97.86 E-value=9.2e-06 Score=67.83 Aligned_cols=58 Identities=28% Similarity=0.237 Sum_probs=52.0
Q ss_pred CCCCCCCCCCCCCCCcceeeeccchhHH-----------------------------------HHhhhcCCCCCCCCCCC
Q psy17881 1 MDPRNASRTPSATKEPMYRLRYQSPVNA-----------------------------------LLKQSHINPRNASRTPS 45 (68)
Q Consensus 1 ~dprnasrtpsa~kep~~r~ry~~p~~A-----------------------------------S~k~~~~DPRnASRtPs 45 (68)
++|++|+++++..+.+++..+|..|+++ +|+.-+.||||++|++.
T Consensus 461 ~~pdpas~~~~e~~~w~~~ps~~V~~~~~~~R~~~R~~eql~Kl~sgigq~ilKeeme~~r~~~~~~p~~sp~nssr~~~ 540 (670)
T KOG1044|consen 461 QAPDPASTPEIETDHWPGKPSFAVPGPEMKRRSLGRQEEQLMKLNSGLGQLILKEEMEKARSSLLASPYDSPRNSSRHIP 540 (670)
T ss_pred cCCCCCCCCcccccCCCCCCcccccCchhhhhhccchhhhhhhccchhhHHHHHHHhhhhhchhhccccCCccccccccC
Confidence 6899999999999999999999999543 46667789999999999
Q ss_pred CCCCCcceecccC
Q psy17881 46 ATKEPMYRLRYQS 58 (68)
Q Consensus 46 A~kEP~~rlRY~s 58 (68)
|.||+.|.++|+.
T Consensus 541 aske~~~~l~~~n 553 (670)
T KOG1044|consen 541 ASKEASLPLYGEN 553 (670)
T ss_pred ccccccccccccC
Confidence 9999999999974
|
|
| >KOG1044|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00