Psyllid ID: psy17883

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MYVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILDLIWY
cEEEHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHHHHHHHHcHHHHHcccccccccHHHHHHHHHHccccccccccEEEEEcccccEEEEEEEcEEEEEEccEEEEEEccccc
cEEEEEEEEHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHHHHHHHHHHHHHHHccHHccccHHHHHHHHHHHccHccccccEEEEccccccEEEEEEEcEEEEEEcccEEEEEEEEEc
MYVTALYFTMTCMTsvgfgnvaaetdnEKIFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAmtkgldtdkvlnycpkdmkadICVHLNrkvfnehpafrlaSDGCLRALAMHFtmshsapgdllyhtgesidslCFIVTGSLEVIQDDEVVAILDLIWY
MYVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWamtkgldtdkVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSleviqddevVAILDLIWY
MYVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILDLIWY
*YVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILDLIW*
MYVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILDLIWY
MYVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILDLIWY
MYVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILDLIWY
oooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILDLIWY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query195 2.2.26 [Sep-21-2011]
Q02280 1174 Potassium voltage-gated c no N/A 0.974 0.161 0.984 1e-112
Q8NCM2 988 Potassium voltage-gated c no N/A 0.994 0.196 0.696 1e-85
Q920E3 988 Potassium voltage-gated c yes N/A 0.994 0.196 0.691 2e-85
Q9EPI9 988 Potassium voltage-gated c yes N/A 0.994 0.196 0.691 2e-85
O95259 989 Potassium voltage-gated c no N/A 0.994 0.196 0.701 3e-85
Q63472 962 Potassium voltage-gated c no N/A 0.994 0.201 0.701 5e-85
O18965 987 Potassium voltage-gated c no N/A 0.994 0.196 0.701 5e-85
Q60603 989 Potassium voltage-gated c no N/A 0.994 0.196 0.701 5e-85
O54853 950 Potassium voltage-gated c no N/A 0.969 0.198 0.502 3e-56
O08962 1163 Potassium voltage-gated c no N/A 0.969 0.162 0.502 3e-55
>sp|Q02280|KCNAE_DROME Potassium voltage-gated channel protein eag OS=Drosophila melanogaster GN=eag PE=1 SV=2 Back     alignment and function desciption
 Score =  403 bits (1036), Expect = e-112,   Method: Composition-based stats.
 Identities = 187/190 (98%), Positives = 189/190 (99%)

Query: 1   MYVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSA 60
           MYVTALYFTMTCMTSVGFGNVAAETDNEK+FTICMMIIAALLYATIFGHVTTIIQQMTSA
Sbjct: 439 MYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAALLYATIFGHVTTIIQQMTSA 498

Query: 61  TAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADIC 120
           TAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDT+KVLNYCPKDMKADIC
Sbjct: 499 TAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTEKVLNYCPKDMKADIC 558

Query: 121 VHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEV 180
           VHLNRKVFNEHPAFRLASDGCLRALAMHF MSHSAPGDLLYHTGESIDSLCFIVTGSLEV
Sbjct: 559 VHLNRKVFNEHPAFRLASDGCLRALAMHFMMSHSAPGDLLYHTGESIDSLCFIVTGSLEV 618

Query: 181 IQDDEVVAIL 190
           IQDDEVVAIL
Sbjct: 619 IQDDEVVAIL 628
Structural component of a potassium channel. Mediates the potassium permeability of membranes; potassium current is regulated by CaMKII and CASK. Has a role in growth of the perineurial glial layer of the larval peripheral nerve.
Drosophila melanogaster (taxid: 7227)
>sp|Q8NCM2|KCNH5_HUMAN Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens GN=KCNH5 PE=1 SV=3 Back     alignment and function description
>sp|Q920E3|KCNH5_MOUSE Potassium voltage-gated channel subfamily H member 5 OS=Mus musculus GN=Kcnh5 PE=2 SV=3 Back     alignment and function description
>sp|Q9EPI9|KCNH5_RAT Potassium voltage-gated channel subfamily H member 5 OS=Rattus norvegicus GN=Kcnh5 PE=2 SV=1 Back     alignment and function description
>sp|O95259|KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens GN=KCNH1 PE=1 SV=1 Back     alignment and function description
>sp|Q63472|KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus GN=Kcnh1 PE=1 SV=1 Back     alignment and function description
>sp|O18965|KCNH1_BOVIN Potassium voltage-gated channel subfamily H member 1 OS=Bos taurus GN=KCNH1 PE=2 SV=2 Back     alignment and function description
>sp|Q60603|KCNH1_MOUSE Potassium voltage-gated channel subfamily H member 1 OS=Mus musculus GN=Kcnh1 PE=1 SV=1 Back     alignment and function description
>sp|O54853|KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus GN=Kcnh6 PE=1 SV=1 Back     alignment and function description
>sp|O08962|KCNH2_RAT Potassium voltage-gated channel subfamily H member 2 OS=Rattus norvegicus GN=Kcnh2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
383849890 1111 PREDICTED: potassium voltage-gated chann 0.974 0.171 1.0 1e-112
332029800 771 Potassium voltage-gated channel protein 0.974 0.246 1.0 1e-112
357614528 1040 Eag K+ channel [Danaus plexippus] 0.974 0.182 0.989 1e-111
33327424 1011 Eag K+ channel [Manduca sexta] 0.974 0.187 0.984 1e-110
442616380 1254 ether a go-go, isoform G [Drosophila mel 0.974 0.151 0.984 1e-110
24642070 1174 ether a go-go, isoform A [Drosophila mel 0.974 0.161 0.984 1e-110
320542083 1268 ether a go-go, isoform D [Drosophila mel 0.974 0.149 0.984 1e-110
198471179 1266 GA23028 [Drosophila pseudoobscura pseudo 0.974 0.150 0.984 1e-110
195478693 1269 GE17158 [Drosophila yakuba] gi|194188140 0.974 0.149 0.984 1e-110
195432719 1267 GK20120 [Drosophila willistoni] gi|19416 0.974 0.149 0.984 1e-110
>gi|383849890|ref|XP_003700567.1| PREDICTED: potassium voltage-gated channel protein eag-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  408 bits (1048), Expect = e-112,   Method: Composition-based stats.
 Identities = 190/190 (100%), Positives = 190/190 (100%)

Query: 1   MYVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSA 60
           MYVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSA
Sbjct: 429 MYVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSA 488

Query: 61  TAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADIC 120
           TAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADIC
Sbjct: 489 TAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADIC 548

Query: 121 VHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEV 180
           VHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEV
Sbjct: 549 VHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEV 608

Query: 181 IQDDEVVAIL 190
           IQDDEVVAIL
Sbjct: 609 IQDDEVVAIL 618

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332029800|gb|EGI69669.1| Potassium voltage-gated channel protein eag [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|357614528|gb|EHJ69134.1| Eag K+ channel [Danaus plexippus] Back     alignment and taxonomy information
>gi|33327424|gb|AAQ09035.1| Eag K+ channel [Manduca sexta] Back     alignment and taxonomy information
>gi|442616380|ref|NP_001259558.1| ether a go-go, isoform G [Drosophila melanogaster] gi|440216780|gb|AGB95400.1| ether a go-go, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24642070|ref|NP_511158.2| ether a go-go, isoform A [Drosophila melanogaster] gi|68068030|sp|Q02280.2|KCNAE_DROME RecName: Full=Potassium voltage-gated channel protein eag; AltName: Full=Ether-a-go-go protein gi|7293023|gb|AAF48410.1| ether a go-go, isoform A [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|320542083|ref|NP_001188592.1| ether a go-go, isoform D [Drosophila melanogaster] gi|318069380|gb|ADV37674.1| ether a go-go, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|198471179|ref|XP_002133679.1| GA23028 [Drosophila pseudoobscura pseudoobscura] gi|198145802|gb|EDY72306.1| GA23028 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195478693|ref|XP_002100616.1| GE17158 [Drosophila yakuba] gi|194188140|gb|EDX01724.1| GE17158 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195432719|ref|XP_002064364.1| GK20120 [Drosophila willistoni] gi|194160449|gb|EDW75350.1| GK20120 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
FB|FBgn0000535 1174 eag "ether a go-go" [Drosophil 0.974 0.161 0.984 1.3e-98
WB|WBGene00001171 956 egl-2 [Caenorhabditis elegans 0.969 0.197 0.772 6.6e-81
UNIPROTKB|O44164 956 egl-2 "Protein EGL-2" [Caenorh 0.969 0.197 0.772 6.6e-81
ZFIN|ZDB-GENE-090319-1 994 kcnh5b "potassium voltage-gate 0.974 0.191 0.726 7.9e-78
ZFIN|ZDB-GENE-121128-4 956 kcnh1b "potassium voltage-gate 0.974 0.198 0.742 1.3e-77
UNIPROTKB|E1BXK7 989 KCNH5 "Uncharacterized protein 0.974 0.192 0.726 2.1e-77
ZFIN|ZDB-GENE-061106-2 1093 kcnh5a "potassium voltage-gate 0.974 0.173 0.715 4e-77
UNIPROTKB|F1NHW2 959 KCNH1 "Uncharacterized protein 0.974 0.198 0.736 7.1e-77
UNIPROTKB|F1MP51 988 KCNH5 "Uncharacterized protein 0.974 0.192 0.726 7.1e-77
UNIPROTKB|J9NRR1 880 KCNH5 "Uncharacterized protein 0.974 0.215 0.726 7.1e-77
FB|FBgn0000535 eag "ether a go-go" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 979 (349.7 bits), Expect = 1.3e-98, P = 1.3e-98
 Identities = 187/190 (98%), Positives = 189/190 (99%)

Query:     1 MYVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSA 60
             MYVTALYFTMTCMTSVGFGNVAAETDNEK+FTICMMIIAALLYATIFGHVTTIIQQMTSA
Sbjct:   439 MYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAALLYATIFGHVTTIIQQMTSA 498

Query:    61 TAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADIC 120
             TAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDT+KVLNYCPKDMKADIC
Sbjct:   499 TAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTEKVLNYCPKDMKADIC 558

Query:   121 VHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEV 180
             VHLNRKVFNEHPAFRLASDGCLRALAMHF MSHSAPGDLLYHTGESIDSLCFIVTGSLEV
Sbjct:   559 VHLNRKVFNEHPAFRLASDGCLRALAMHFMMSHSAPGDLLYHTGESIDSLCFIVTGSLEV 618

Query:   181 IQDDEVVAIL 190
             IQDDEVVAIL
Sbjct:   619 IQDDEVVAIL 628
GO:0007629 "flight behavior" evidence=IMP
GO:0005249 "voltage-gated potassium channel activity" evidence=IDA;TAS
GO:0008076 "voltage-gated potassium channel complex" evidence=ISS;TAS;IPI
GO:0051259 "protein oligomerization" evidence=IPI
GO:0006813 "potassium ion transport" evidence=IDA;TAS
GO:0005887 "integral to plasma membrane" evidence=NAS
GO:0007619 "courtship behavior" evidence=NAS;TAS
GO:0042066 "perineurial glial growth" evidence=IGI
GO:0008016 "regulation of heart contraction" evidence=NAS
GO:0048150 "behavioral response to ether" evidence=NAS
GO:0007608 "sensory perception of smell" evidence=NAS
GO:0007611 "learning or memory" evidence=NAS
GO:0022843 "voltage-gated cation channel activity" evidence=IDA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0000155 "phosphorelay sensor kinase activity" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0007612 "learning" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
WB|WBGene00001171 egl-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O44164 egl-2 "Protein EGL-2" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090319-1 kcnh5b "potassium voltage-gated channel, subfamily H (eag-related), member 5b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-121128-4 kcnh1b "potassium voltage-gated channel, subfamily H (eag-related), member 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXK7 KCNH5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061106-2 kcnh5a "potassium voltage-gated channel, subfamily H (eag-related), member 5a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHW2 KCNH1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MP51 KCNH5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NRR1 KCNH5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9EPI9KCNH5_RATNo assigned EC number0.69150.99480.1963yesN/A
Q02280KCNAE_DROMENo assigned EC number0.98420.97430.1618noN/A
Q920E3KCNH5_MOUSENo assigned EC number0.69150.99480.1963yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-13
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 4e-07
pfam0788574 pfam07885, Ion_trans_2, Ion channel 8e-07
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 7e-06
PRK10537393 PRK10537, PRK10537, voltage-gated potassium channe 1e-05
pfam00520194 pfam00520, Ion_trans, Ion transport protein 0.002
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information 
 Score = 68.0 bits (166), Expect = 2e-13
 Identities = 47/193 (24%), Positives = 97/193 (50%), Gaps = 5/193 (2%)

Query: 2   YVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSAT 61
           Y++A+Y+++T MT+VG+G++ A    E IF I  M+    L A + G++T ++ + T  T
Sbjct: 251 YISAIYWSITTMTTVGYGDLHAVNTIEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRT 310

Query: 62  AKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADICV 121
            ++ + +     F+  + +P  L ++++ Y+   +   + L+  ++++  PK +   IC 
Sbjct: 311 MEFRNSIEAASNFVGRNRLPPRLKDQILAYMCLRFK-AESLNQQQLIDQLPKSICKSICQ 369

Query: 122 HLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEVI 181
           HL   V  +   F+  S   L  L       +  P + +    E+ D +  +V+G +E+I
Sbjct: 370 HLFLPVVEKVYLFKGVSREILLLLVTKMKAEYIPPREDVIMQNEAPDDVYIVVSGEVEII 429

Query: 182 ----QDDEVVAIL 190
               + + VV  L
Sbjct: 430 DSEGEKERVVGTL 442

Length = 823
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel Back     alignment and domain information
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|236711 PRK10537, PRK10537, voltage-gated potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|215968 pfam00520, Ion_trans, Ion transport protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 195
KOG0498|consensus 727 100.0
KOG0500|consensus 536 100.0
PLN03192 823 Voltage-dependent potassium channel; Provisional 100.0
KOG0499|consensus 815 100.0
KOG0501|consensus 971 100.0
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 99.29
KOG3713|consensus477 99.13
KOG1113|consensus 368 98.94
KOG0614|consensus 732 98.9
KOG1419|consensus 654 98.9
KOG0614|consensus 732 98.73
PLN02868 413 acyl-CoA thioesterase family protein 98.73
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 98.69
PRK10537393 voltage-gated potassium channel; Provisional 98.69
cd00038115 CAP_ED effector domain of the CAP family of transc 98.65
PRK09392 236 ftrB transcriptional activator FtrB; Provisional 98.62
KOG3684|consensus489 98.62
KOG1418|consensus 433 98.55
KOG1420|consensus 1103 98.45
KOG1545|consensus507 98.41
KOG1113|consensus368 98.33
COG2905 610 Predicted signal-transduction protein containing c 98.3
PRK11753 211 DNA-binding transcriptional dual regulator Crp; Pr 98.19
KOG4390|consensus632 98.17
COG0664 214 Crp cAMP-binding proteins - catabolite gene activa 98.06
PRK11161 235 fumarate/nitrate reduction transcriptional regulat 98.06
KOG4404|consensus350 97.96
KOG4404|consensus350 97.95
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 97.82
PRK10402 226 DNA-binding transcriptional activator YeiL; Provis 97.71
KOG1418|consensus433 97.32
PRK09391 230 fixK transcriptional regulator FixK; Provisional 97.21
PF01007336 IRK: Inward rectifier potassium channel; InterPro: 97.03
KOG3542|consensus 1283 96.79
KOG3193|consensus 1087 95.12
KOG3542|consensus 1283 94.48
KOG2968|consensus 1158 94.43
PF08006181 DUF1700: Protein of unknown function (DUF1700); In 94.38
COG4709195 Predicted membrane protein [Function unknown] 93.33
KOG2968|consensus 1158 92.81
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 92.09
PF00060148 Lig_chan: Ligand-gated ion channel; InterPro: IPR0 92.0
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 91.85
KOG3827|consensus400 91.8
PF07697222 7TMR-HDED: 7TM-HD extracellular; InterPro: IPR0116 83.44
PF14377108 DUF4414: Domain of unknown function (DUF4414) 83.25
PF1331458 DUF4083: Domain of unknown function (DUF4083) 82.24
KOG0498|consensus 727 80.99
>KOG0498|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.5e-47  Score=324.45  Aligned_cols=194  Identities=35%  Similarity=0.609  Sum_probs=190.8

Q ss_pred             ceehhhhhhhheeeeecCCcccCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCC
Q psy17883          2 YVTALYFTMTCMTSVGFGNVAAETDNEKIFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVP   81 (195)
Q Consensus         2 Y~~sly~~~~tl~t~gygdi~p~t~~e~~~~i~~~~~g~~~~a~~i~~i~~~~~~~~~~~~~~~~~~~~l~~~l~~~~l~   81 (195)
                      |++||||++++|+|+|||+++|.|..|++|+|++|++|.+++|++||+++.+++....+..+|+.++.++++||++|++|
T Consensus       295 Y~~aLyw~l~tLstvG~g~~~s~~~~E~iFsi~~mi~GllL~A~lIGNmt~~iqs~tsR~~~~r~k~rd~e~~m~~~~LP  374 (727)
T KOG0498|consen  295 YVYALYWGLSTLSTVGYGLVHANNMGEKIFSIFIMLFGLLLFAYLIGNMTALLQSLTSRTEEMRDKMRDAEQWMSRRQLP  374 (727)
T ss_pred             HHHHHHHHhhHhhhccCCccCCCCcHHHHHHHHHHHHhHHHHHHHHhhHHHhHHHHhHHHHHHHHHHHHHHHHHHhccCC
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhcCCCCHhHHHhhCCHhHHHHHHHHHhHHHhhcCCccccCChHHHHHHhhhcccccccCCceeE
Q psy17883         82 KALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLY  161 (195)
Q Consensus        82 ~~l~~rv~~y~~~~~~~~~~~~~~~il~~lp~~L~~~i~~~~~~~~l~~~~~f~~~~~~~l~~l~~~l~~~~~~~g~~i~  161 (195)
                      +.|++|+++|++++|+.++|.|+++++++||+.||.+|.++++.++++++|+|+++++.++.+|+.+++.++|.|||+|+
T Consensus       375 ~~LRqRi~~y~q~kw~~t~Gvdee~lL~~LP~~LR~dI~~hL~~~lv~~vpLF~~md~~~L~al~~rlk~~~f~pge~ii  454 (727)
T KOG0498|consen  375 PDLRQRIRRYEQYKWLATRGVDEEELLQSLPKDLRRDIKRHLCLDLVRKVPLFAGMDDGLLDALCSRLKPEYFTPGEYII  454 (727)
T ss_pred             HHHHHHHHHHHHHHHhhccCcCHHHHHHhCCHHHHHHHHHHHhHHHHhhCchhhcCCHHHHHHHHHHhhhhccCCCCeEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCCCCeEEEEEeeeEEEEeCC----cEEEEeecccC
Q psy17883        162 HTGESIDSLCFIVTGSLEVIQDD----EVVAILDLIWY  195 (195)
Q Consensus       162 ~~g~~~~~~y~i~~G~v~v~~~~----~~~~~l~~~~~  195 (195)
                      ++||+.++||||.+|.+++.+.+    .+++.|+.|+|
T Consensus       455 reGd~v~~myFI~rG~le~~~~~~g~~~~~~~L~~Gd~  492 (727)
T KOG0498|consen  455 REGDPVTDMYFIVRGSLESITTDGGGFFVVAILGPGDF  492 (727)
T ss_pred             ecCCccceeEEEEeeeEEEEEccCCceEEEEEecCCCc
Confidence            99999999999999999999987    68899999875

>KOG0500|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>KOG3713|consensus Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG1419|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>KOG3684|consensus Back     alignment and domain information
>KOG1418|consensus Back     alignment and domain information
>KOG1420|consensus Back     alignment and domain information
>KOG1545|consensus Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>KOG4390|consensus Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>KOG4404|consensus Back     alignment and domain information
>KOG4404|consensus Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>KOG1418|consensus Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG3193|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>PF08006 DUF1700: Protein of unknown function (DUF1700); InterPro: IPR012963 This family contains many hypothetical bacterial proteins and two putative membrane proteins (Q6GFD0 from SWISSPROT and Q6G806 from SWISSPROT) Back     alignment and domain information
>COG4709 Predicted membrane protein [Function unknown] Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>KOG3827|consensus Back     alignment and domain information
>PF07697 7TMR-HDED: 7TM-HD extracellular; InterPro: IPR011624 This entry represents the extracellular domain of the 7TM-HD (7TM Receptors with HD hydrolase) protein family [] Back     alignment and domain information
>PF14377 DUF4414: Domain of unknown function (DUF4414) Back     alignment and domain information
>PF13314 DUF4083: Domain of unknown function (DUF4083) Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
4f8a_A160 Cyclic Nucleotide Binding-Homology Domain From Mous 5e-40
3ukn_A212 Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN 2e-26
2ptm_A198 Structure And Rearrangements In The Carboxy-Termina 7e-06
3etq_A204 X-Ray Structure Of Cysteine-Free Fragment Of Mhcn2 2e-05
1q3e_A207 Hcn2j 443-645 In The Presence Of Cgmp Length = 207 8e-05
3u11_A210 Tetramerization Dynamics Of The C-Terminus Underlie 8e-05
3ffq_A202 Hcn2i 443-640 Apo-State Length = 202 8e-05
3u10_A210 Tetramerization Dynamics Of The C-Terminus Underlie 9e-05
3bpz_A202 Hcn2-I 443-460 E502k In The Presence Of Camp Length 1e-04
3t1c_A97 Crystal Structure Of Nak Channel D66y Mutant Length 3e-04
2q0a_A200 Structure And Rearrangements In The Carboxy-Termina 3e-04
3u0z_A210 Tetramerization Dynamics Of The C-Terminus Underlie 4e-04
3tet_A97 Crystal Structure Of Nak2k Channel Y66f Mutant Leng 4e-04
4hbn_A205 Crystal Structure Of The Human Hcn4 Channel C-termi 5e-04
3otf_A220 Structural Basis For The Camp-Dependent Gating In H 5e-04
1q43_A207 Hcn2i 443-640 In The Presence Of Camp, Selenomethio 7e-04
>pdb|4F8A|A Chain A, Cyclic Nucleotide Binding-Homology Domain From Mouse Eag1 Potassium Channel Length = 160 Back     alignment and structure 
Iteration: 1

 Score =  160 bits (404), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 74/98 (75%), Positives = 81/98 (82%), Gaps = 7/98 (7%)
Query: 104 TDKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHT 163
           T+KVL  CPKDM+ADICVHLNRKVF EHPAFRLASDGCLRALAM F   H APGDL+YH 
Sbjct: 5   TEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHA 64
Query: 164 GESIDSLCFIVTGSLEVIQDDEVVAIL-------DLIW 194
           GES+DSLCF+V+GSLEVIQDDEVVAIL       D+ W
Sbjct: 65  GESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFW 102
>pdb|3UKN|A Chain A, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN C 2 2 21 SPACE Group Length = 212 Back     alignment and structure
>pdb|2PTM|A Chain A, Structure And Rearrangements In The Carboxy-Terminal Region Of Spih Channels Length = 198 Back     alignment and structure
>pdb|3ETQ|A Chain A, X-Ray Structure Of Cysteine-Free Fragment Of Mhcn2 C- Terminal Region From Amino Acids 443-630 Including C508n, C584s, And C601s Mutations Length = 204 Back     alignment and structure
>pdb|1Q3E|A Chain A, Hcn2j 443-645 In The Presence Of Cgmp Length = 207 Back     alignment and structure
>pdb|3U11|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|3FFQ|A Chain A, Hcn2i 443-640 Apo-State Length = 202 Back     alignment and structure
>pdb|3U10|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|3BPZ|A Chain A, Hcn2-I 443-460 E502k In The Presence Of Camp Length = 202 Back     alignment and structure
>pdb|3T1C|A Chain A, Crystal Structure Of Nak Channel D66y Mutant Length = 97 Back     alignment and structure
>pdb|2Q0A|A Chain A, Structure And Rearrangements In The Carboxy-Terminal Region Of Spih Channels Length = 200 Back     alignment and structure
>pdb|3U0Z|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|3TET|A Chain A, Crystal Structure Of Nak2k Channel Y66f Mutant Length = 97 Back     alignment and structure
>pdb|4HBN|A Chain A, Crystal Structure Of The Human Hcn4 Channel C-terminus Carrying The S672r Mutation Length = 205 Back     alignment and structure
>pdb|3OTF|A Chain A, Structural Basis For The Camp-Dependent Gating In Human Hcn4 Channel Length = 220 Back     alignment and structure
>pdb|1Q43|A Chain A, Hcn2i 443-640 In The Presence Of Camp, Selenomethionine Derivative Length = 207 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
3ukn_A212 Novel protein similar to vertebrate potassium VOL 5e-55
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 3e-49
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 1e-45
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 2e-33
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 5e-09
1lnq_A336 MTHK channels, potassium channel related protein; 3e-08
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 7e-08
2q67_A114 Potassium channel protein; inverted teepee, helix 1e-07
3ouf_A97 Potassium channel protein; ION channel, membrane, 2e-07
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 2e-07
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 8e-07
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 3e-05
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 1e-04
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 7e-05
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 9e-05
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 9e-05
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 1e-04
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 1e-04
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 1e-04
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 2e-04
2pqq_A149 Putative transcriptional regulator; APC7345, strep 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3dkw_A 227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 9e-04
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
 Score =  172 bits (439), Expect = 5e-55
 Identities = 49/138 (35%), Positives = 95/138 (68%), Gaps = 1/138 (0%)

Query: 53  IIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCP 112
           + Q+M S  + YH    ++++F+++H +PKAL++R+++   +TW++  G+D  ++L   P
Sbjct: 3   MDQRMYSRRSLYHTRTKDLKDFIRVHRLPKALAQRMLECFQTTWSVNNGIDVSELLKDFP 62

Query: 113 KDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCF 172
            +++ADI +HLN+++  + P F  AS GCLR+L++    S  APG+ L   G+++ ++ F
Sbjct: 63  DELRADIAMHLNKELL-QLPLFESASRGCLRSLSLIIKTSFCAPGEFLIRQGDALQAIYF 121

Query: 173 IVTGSLEVIQDDEVVAIL 190
           + +GS+EV++D+ V+AIL
Sbjct: 122 VCSGSMEVLKDNTVLAIL 139
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.96
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.96
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.96
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.88
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 99.67
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.64
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 99.64
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 99.51
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.47
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 99.43
2a9h_A155 Voltage-gated potassium channel; potassium channel 99.43
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 99.42
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 99.4
2q67_A114 Potassium channel protein; inverted teepee, helix 99.39
3ouf_A97 Potassium channel protein; ION channel, membrane, 99.37
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 99.36
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.32
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.3
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.26
3um7_A309 Potassium channel subfamily K member 4; potassium 99.22
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.19
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 99.14
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.14
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.13
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.09
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.06
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.05
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 99.05
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.05
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 99.03
2qks_A321 KIR3.1-prokaryotic KIR channel chimera; G-protein 99.02
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.02
1p7b_A333 Integral membrane channel and cytosolic domains; t 99.0
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 98.98
3ukm_A280 Potassium channel subfamily K member 1; membrane p 98.98
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 98.95
3ukm_A280 Potassium channel subfamily K member 1; membrane p 98.94
1xl4_A301 Inward rectifier potassium channel; integral membr 98.94
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 98.94
4ev0_A 216 Transcription regulator, CRP family; CAMP binding, 98.92
3e97_A 231 Transcriptional regulator, CRP/FNR family; YP_6044 98.91
3fx3_A 237 Cyclic nucleotide-binding protein; helix_TURN_heli 98.91
3dv8_A 220 Transcriptional regulator, CRP/FNR family; cyclic 98.9
3d0s_A 227 Transcriptional regulatory protein; CAMP receptor 98.9
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 98.9
3um7_A309 Potassium channel subfamily K member 4; potassium 98.9
3dn7_A 194 Cyclic nucleotide binding regulatory protein; stru 98.89
3dkw_A 227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 98.88
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 98.88
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 98.88
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 98.86
1zyb_A 232 Transcription regulator, CRP family; NP_813211.1, 98.85
1lnq_A336 MTHK channels, potassium channel related protein; 98.82
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 98.82
3iwz_A 230 CAP-like, catabolite activation-like protein; XCC, 98.81
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 98.79
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 98.77
4din_B381 CAMP-dependent protein kinase type I-beta regulat 98.77
2gau_A 232 Transcriptional regulator, CRP/FNR family; structu 98.75
2fmy_A 220 COOA, carbon monoxide oxidation system transcripti 98.73
1ft9_A 222 Carbon monoxide oxidation system transcription reg 98.67
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 98.65
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 98.64
3ryp_A 210 Catabolite gene activator; CAMP receptor protein ( 98.56
3sya_A340 G protein-activated inward rectifier potassium CH; 98.52
3kcc_A 260 Catabolite gene activator; helix-turn-helix, CAMP, 98.39
3spc_A343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 98.35
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 98.34
1o5l_A 213 Transcriptional regulator, CRP family; TM1171, str 98.26
2bgc_A 238 PRFA; bacterial infection, human pathogen, transcr 98.01
3la7_A 243 Global nitrogen regulator; activator, DNA-binding, 97.92
3rvy_A285 ION transport protein; tetrameric ION channel, vol 97.75
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 91.55
3lwc_A119 Uncharacterized protein; structural genomics, unkn 84.49
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 84.2
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 83.12
3h8u_A125 Uncharacterized conserved protein with double-STR 81.93
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 81.5
3bcw_A123 Uncharacterized protein; structural genomics, join 81.32
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 81.25
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
Probab=99.96  E-value=7.9e-30  Score=191.24  Aligned_cols=143  Identities=34%  Similarity=0.726  Sum_probs=127.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHHHHhcCCCCHhHHHhhCCHhHHHHHHHHHhHHHhhcC
Q psy17883         52 TIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADICVHLNRKVFNEH  131 (195)
Q Consensus        52 ~~~~~~~~~~~~~~~~~~~l~~~l~~~~l~~~l~~rv~~y~~~~~~~~~~~~~~~il~~lp~~L~~~i~~~~~~~~l~~~  131 (195)
                      .++++++.++.+|++++..+++||+.+++|+.|+.||++||++.|+.+++.+++++++.||++||.++..+++..++ ++
T Consensus         2 ~ii~~~~~~~~~~~~~~~~i~~ym~~~~i~~~l~~rv~~y~~~~~~~~~~~~~~~il~~Lp~~L~~~i~~~~~~~l~-~~   80 (212)
T 3ukn_A            2 AMDQRMYSRRSLYHTRTKDLKDFIRVHRLPKALAQRMLECFQTTWSVNNGIDVSELLKDFPDELRADIAMHLNKELL-QL   80 (212)
T ss_dssp             ----------CHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHCCTGGGCCCCCTTTTSCHHHHHHHHTTCCCGGG-GS
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHhcCCCCHHHHHHHcCHHHHHHHHHHHHHHHH-hc
Confidence            56788899999999999999999999999999999999999999998898899999999999999999999998777 89


Q ss_pred             CccccCChHHHHHHhhhcccccccCCceeEecCCCCCeEEEEEeeeEEEEeCCcEEEEeecccC
Q psy17883        132 PAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILDLIWY  195 (195)
Q Consensus       132 ~~f~~~~~~~l~~l~~~l~~~~~~~g~~i~~~g~~~~~~y~i~~G~v~v~~~~~~~~~l~~~~~  195 (195)
                      |+|+++++++++.++..++...|.|||+|+++||.++++|||.+|.|+++.++..+..++.|.+
T Consensus        81 ~~f~~l~~~~l~~l~~~~~~~~~~~ge~I~~~G~~~~~ly~I~~G~v~v~~~~~~~~~l~~G~~  144 (212)
T 3ukn_A           81 PLFESASRGCLRSLSLIIKTSFCAPGEFLIRQGDALQAIYFVCSGSMEVLKDNTVLAILGKGDL  144 (212)
T ss_dssp             GGGTTCCHHHHHHHHHHCEEEEECTTCEEECTTSBCCEEEEEEECCEEEESSSCEEEEECTTCE
T ss_pred             HHhhcCCHHHHHHHHHHhheEEeCCCCEEEECCCcccEEEEEEecEEEEEECCeEEEEecCCCC
Confidence            9999999999999999999999999999999999999999999999999998888888888863
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 195
d1q3ea_193 b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus mu 2e-14
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 7e-10
d1xl4a2116 f.14.1.1 (A:23-138) Inward rectifier potassium cha 2e-06
d1r3jc_103 f.14.1.1 (C:) Potassium channel protein {Streptomy 2e-05
d1p7ba2116 f.14.1.1 (A:36-151) Inward rectifier potassium cha 3e-05
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Length = 193 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: HCN pacemaker channel
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 66.2 bits (160), Expect = 2e-14
 Identities = 27/131 (20%), Positives = 49/131 (37%), Gaps = 1/131 (0%)

Query: 59  SATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKAD 118
           S+  +Y +    V ++M  H++P    +++ DY    +   K  D D +L      ++ +
Sbjct: 2   SSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRY-QGKMFDEDSILGELNGPLREE 60

Query: 119 ICVHLNRKVFNEHPAFRLASDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSL 178
           I     RK+    P F  A    + A+          PGD +   G     + FI  G +
Sbjct: 61  IVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVV 120

Query: 179 EVIQDDEVVAI 189
            V+        
Sbjct: 121 SVLTKGNKEMK 131
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.96
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 99.51
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.45
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.4
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.33
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.32
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.32
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.32
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.31
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 99.26
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 99.25
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.25
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 99.24
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.17
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 98.67
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 98.66
d1i5za2132 Catabolite gene activator protein, N-terminal doma 98.61
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 98.6
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 98.46
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 98.31
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 98.07
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 89.98
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 88.6
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 87.16
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 81.03
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 80.48
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: HCN pacemaker channel
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.96  E-value=7.5e-29  Score=181.87  Aligned_cols=137  Identities=21%  Similarity=0.368  Sum_probs=129.3

Q ss_pred             HHHHHHHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHHHHhcCCCCHhHHHhhCCHhHHHHHHHHHhHHHhhcCCccccC
Q psy17883         58 TSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTDKVLNYCPKDMKADICVHLNRKVFNEHPAFRLA  137 (195)
Q Consensus        58 ~~~~~~~~~~~~~l~~~l~~~~l~~~l~~rv~~y~~~~~~~~~~~~~~~il~~lp~~L~~~i~~~~~~~~l~~~~~f~~~  137 (195)
                      |+++.+|++++..+++||+.+++|+.++.||++||++.|++ +..+++++++.+|++|+.++..+++.++++++|+|+++
T Consensus         1 ds~~~~f~~~~~~i~~~m~~~~i~~~l~~rv~~y~~~~~~~-~~~~~~~i~~~lp~~l~~~i~~~~~~~~l~~~~~F~~~   79 (193)
T d1q3ea_           1 DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQG-KMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANA   79 (193)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHTT-CCCCHHHHHHHSCHHHHHHHHHHHTHHHHHHCHHHHTS
T ss_pred             ChhHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHhhc-ccccHHHHHHHCCcchhHHHHHHHHHHHHhcchHHHhh
Confidence            35688999999999999999999999999999999999954 66788899999999999999999999999999999999


Q ss_pred             ChHHHHHHhhhcccccccCCceeEecCCCCCeEEEEEeeeEEEEeCCcEEEEeecccC
Q psy17883        138 SDGCLRALAMHFTMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILDLIWY  195 (195)
Q Consensus       138 ~~~~l~~l~~~l~~~~~~~g~~i~~~g~~~~~~y~i~~G~v~v~~~~~~~~~l~~~~~  195 (195)
                      ++.++..|+..|+...|.|||+|+++||.+++||||.+|+|++..+++.+..++.|.+
T Consensus        80 ~~~~l~~l~~~~~~~~~~~g~~I~~~g~~~~~ly~i~~G~v~v~~~~~~~~~l~~G~~  137 (193)
T d1q3ea_          80 DPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSY  137 (193)
T ss_dssp             CHHHHHHHHTTCEEEEECTTCEEECTTSBCCEEEEEEECCEEEEC-CCCEEEECTTCE
T ss_pred             hHHHHHHHHHHHHHHhhccCceecccCCCCcceeEeeeeeEEeecCCcceeeecccee
Confidence            9999999999999999999999999999999999999999999999888888988864
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure