Psyllid ID: psy17897

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-
MTVRRYALLFSGLNDGLLSRAEALAAVDIGKHSASSTPTLPTLKHDMMYHHGMNGTHGGPNGRPHQMSHHGMDGLEMLDSISSSMTTLTPMSDPTPNPHQLHSSSMYGPSMNSMMTGHHHHHHHSGALPASHHHVATPSLLLFPQMSHHGMDGLEMLDSISSSMTTLTPMSDPTPNPHQLHSSSMYGPSMNSMMTGHHHHHHHSGALPASHHHGATHHPVMPPGLQHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFAAQH
ccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHccccccEEEEHHcHHHHHHHcccccccc
ccccccccEHcccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHEccccHHHHHHHHHHcEccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEHcHHHHHHHHHHccccccHHHHHHHHHHccccHHHEEHHHHHHHHHHHcccccccc
MTVRRYALLFSGLNDGLLSRAEALAAVDigkhsasstptlptlkhdmmyhhgmngthggpngrphqmshhgmdgLEMLDSIsssmttltpmsdptpnphqlhsssmygpsmnsmmtghhhhhhhsgalpashhhvatpslllfpqmshhgmdglEMLDSIsssmttltpmsdptpnphqlhsssmygpsmnsmmtghhhhhhhsgalpashhhgathhpvmppglqhpdtdtdpRELEAFAERFKQRRIKLGVTQADVGKALAnlklpgvgalsqsticRFESLTLSHNNMIALKPILQAWLEEAEAQAKnkrrdpdapsvlpagekkrkrtsiaapekrsleayfavqprpsgEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFAAQH
MTVRRYALLFSGLNDGLLSRAEALAAVDIGKHSASSTPTLPTLKHDMMYHHGMNGTHGGPNGRPHQMSHHGMDGLEMLDSISSSMTTLTPMSDPTPNPHQLHSSSMYGPSMNSMMTGHHHHHHHSGALPASHHHVATPSLLLFPQMSHHGMDGLEMLDSISSSMTTLTPMSDPTPNPHQLHSSSMYGPSMNSMMTGHHHHHHHSGALPASHHHGATHHPVMPPGLQHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQaknkrrdpdapsvlpagekkrkrtsiaapekrsleayfavqprpsgEKIAAIAEkldlkknvvRVWFCNqrqkqkrmkfaaqh
MTVRRYALLFSGLNDGLLSRAEALAAVDIGKHSASSTPTLPTLKHDMMYHHGMNGTHGGPNGRPHQMSHHGMDGLEMLDSISSSMTTLTPMSDPTPNPHQLHSSSMYGPSMNSMMTghhhhhhhsgalpashhhVATPSLLLFPQMSHHGMDGLEMLDSISSSMTTLTPMSDPTPNPHQLHSSSMYGPSMNSMMTghhhhhhhsgalpashhhgaTHHPVMPPGLQHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPIlqawleeaeaqaKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFAAQH
****RYALLFSGLNDGLLSRAEALAAVDI*********************************************************************************************************************************************************************************************************************RFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLE******************************************F*********KIAAIAEKLDLKKNVVRVWFCN**************
******A*LFSGLNDGLLSRAEA*************************************************************************************************************************************************************************************************************************AERFKQRRI********************************************LKPILQAWLEEAEAQAK*************************APEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQ***********
MTVRRYALLFSGLNDGLLSRAEALAAVDIGKHSASSTPTLPTLKHDMMYHHGMNGTHGGPNGRPHQMSHHGMDGLEMLDSISSSMTTLTPMSDPTPNPHQLHSSSMYGPSMNSMM****************HHHVATPSLLLFPQMSHHGMDGLEMLDSISSSMTTLTPMSDPTPNPHQLHSSSMYGPSMNSMM********************ATHHPVMPPGLQHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEA******************************APEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ*************
******ALLFSGLNDGLLSRAEALAAVDIGKHS*****TLPTLKH****HHGMNGTHGGPNGRPHQMSHHGMDGLEMLDSISSSMTTLTPMSDPTP***************************HSGALPASHHHVATPSLLLFPQMSHHGMDGLEMLDSISSSMTTLTPMSDPTPNPHQLHSSSMYGPSMNSMMTGHHHH*HH****************************TDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEA***********************RTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQK**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTVRRYALLFSGLNDGLLSRAEALAAVDIGKHSASSTPTLPTLKHDMMYHHGMNGTHGGPNGRPHQMSHHGMDGLEMLDSISSSMTTLTPMSDPTPNPHQLHSSSMYGPSMNSMMTGHHHHHHHSGALPASHHHVATPSLLLFPQMSHHGMDGLEMLDSISSSMTTLTPMSDPTPNPHQLHSSSMYGPSMNSMMTGHHHHHHHSGALPASHHHGATHHPVMPPGLQHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFAAQH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query391 2.2.26 [Sep-21-2011]
P24350396 Inhibitory POU protein OS yes N/A 0.644 0.636 0.727 1e-100
Q91998341 Brain-specific homeobox/P yes N/A 0.493 0.565 0.735 3e-79
Q01851419 POU domain, class 4, tran yes N/A 0.409 0.381 0.852 1e-77
P17208421 POU domain, class 4, tran yes N/A 0.409 0.380 0.852 2e-77
Q63955338 POU domain, class 4, tran no N/A 0.565 0.653 0.624 2e-77
Q15319338 POU domain, class 4, tran no N/A 0.565 0.653 0.624 2e-77
Q90435331 POU domain, class 4, tran no N/A 0.549 0.649 0.640 8e-77
Q63934411 POU domain, class 4, tran no N/A 0.503 0.479 0.699 5e-76
Q12837409 POU domain, class 4, tran no N/A 0.455 0.435 0.760 8e-76
P13528467 Transcription factor unc- yes N/A 0.421 0.353 0.738 2e-68
>sp|P24350|IPOU_DROME Inhibitory POU protein OS=Drosophila melanogaster GN=acj6 PE=1 SV=3 Back     alignment and function desciption
 Score =  365 bits (938), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 200/275 (72%), Positives = 211/275 (76%), Gaps = 23/275 (8%)

Query: 121 HHHHSGALPASHHHVATPSLLLFPQMSHHGMDGLEMLDSISSSMTTLTPMSDP--TPNPH 178
           +HHHS + P        P    F +  HH MD L+MLD  + SMTTL P+S+   TP   
Sbjct: 117 YHHHSMSGPPQRPLQENP----FSRQMHHSMDQLDMLDP-TGSMTTLAPISESPLTPTHQ 171

Query: 179 QLHSSSMYGPSMNSMMTGHHHHHHHSGALPASHHH----GATHHPVMPPGLQ----HPDT 230
            LH S     SMN MM+     HHH G L           A HHPV+   +     HPDT
Sbjct: 172 HLHGSYH---SMNHMMS-----HHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDT 223

Query: 231 DTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNN 290
           DTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNN
Sbjct: 224 DTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNN 283

Query: 291 MIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQP 350
           MIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQP
Sbjct: 284 MIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQP 343

Query: 351 RPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRM 385
           RPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKR+
Sbjct: 344 RPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRI 378
Modulates gene transcription; simultaneously generates both a specific activator and an inhibitor of gene transcription, capable of modulating two distinct regulatory programs during neural development. Has a role in olfactory behavior.
Drosophila melanogaster (taxid: 7227)
>sp|Q91998|BRN3_CHICK Brain-specific homeobox/POU domain protein 3 OS=Gallus gallus GN=BRN3 PE=2 SV=1 Back     alignment and function description
>sp|Q01851|PO4F1_HUMAN POU domain, class 4, transcription factor 1 OS=Homo sapiens GN=POU4F1 PE=2 SV=4 Back     alignment and function description
>sp|P17208|PO4F1_MOUSE POU domain, class 4, transcription factor 1 OS=Mus musculus GN=Pou4f1 PE=2 SV=3 Back     alignment and function description
>sp|Q63955|PO4F3_MOUSE POU domain, class 4, transcription factor 3 OS=Mus musculus GN=Pou4f3 PE=2 SV=2 Back     alignment and function description
>sp|Q15319|PO4F3_HUMAN POU domain, class 4, transcription factor 3 OS=Homo sapiens GN=POU4F3 PE=1 SV=1 Back     alignment and function description
>sp|Q90435|PO4F3_DANRE POU domain, class 4, transcription factor 3 OS=Danio rerio GN=pou4f3 PE=2 SV=2 Back     alignment and function description
>sp|Q63934|PO4F2_MOUSE POU domain, class 4, transcription factor 2 OS=Mus musculus GN=Pou4f2 PE=2 SV=1 Back     alignment and function description
>sp|Q12837|PO4F2_HUMAN POU domain, class 4, transcription factor 2 OS=Homo sapiens GN=POU4F2 PE=1 SV=2 Back     alignment and function description
>sp|P13528|UNC86_CAEEL Transcription factor unc-86 OS=Caenorhabditis elegans GN=unc-86 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query391
189235030353 PREDICTED: similar to RT01016p [Triboliu 0.782 0.866 0.601 1e-103
157110244357 inhibitory pou [Aedes aegypti] gi|108878 0.613 0.672 0.801 1e-102
349584651355 abnormal chemosensory jump 6, isoform B 0.654 0.721 0.772 1e-102
349584655336 abnormal chemosensory jump 6, isoform D 0.654 0.761 0.772 1e-102
358350601241 abnormal chemosensory jump 6, splice for 0.608 0.987 0.808 1e-102
242017557296 Inhibitory POU protein, putative [Pedicu 0.629 0.831 0.792 1e-101
349584649356 abnormal chemosensory jump 6, isoform A 0.608 0.668 0.808 1e-101
270004858365 abnormal chemosensory jump 6 [Tribolium 0.764 0.819 0.593 1e-101
349584653350 abnormal chemosensory jump 6, isoform C 0.641 0.717 0.768 1e-101
357622600306 inhibitory pou [Danaus plexippus] 0.601 0.767 0.818 1e-100
>gi|189235030|ref|XP_972320.2| PREDICTED: similar to RT01016p [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 231/384 (60%), Positives = 242/384 (63%), Gaps = 78/384 (20%)

Query: 9   LFSGLNDGLLSRAEALAAVDIGKHSASSTPTLPTLKHDMMYHHGMNGTHGGPNGRPHQMS 68
           LFSGLNDGL+SRAEALAAVDI KH +S                      GGP G P Q+ 
Sbjct: 47  LFSGLNDGLISRAEALAAVDI-KHQSS----------------------GGPGGLP-QLK 82

Query: 69  HHGMDGLEMLDSISSSMTTLTPMSDPTPNPHQLHSSSMYGPSMNSMMTGHHHHHHHSGAL 128
           H  M                                               +HH      
Sbjct: 83  HDMM-----------------------------------------------YHHSMGAPP 95

Query: 129 PASHHHVATPSLLLFPQMSHHGMDGLEMLDSIS-SSMTTLTPMSDPTPNPHQLHSSSMYG 187
           P S  H  +P      QM H  MDGLEMLD IS SSMTTLTPMS+ + + H    + +  
Sbjct: 96  PVSRPHQDSP---FMRQMGH--MDGLEMLDPISTSSMTTLTPMSETSSHMHSYGMNHVMN 150

Query: 188 PSMNSMMTGHHHHHHHSGALPASHHHGATHHPVMPPGLQHPDTDTDPRELEAFAERFKQR 247
              +      H  HH            A        GL HPD DTDPRELEAFAERFKQR
Sbjct: 151 HHHHGGPVAPHPGHHGGHPGAHHPAMAAAAAAAAVAGL-HPDADTDPRELEAFAERFKQR 209

Query: 248 RIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEA 307
           RIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEA
Sbjct: 210 RIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEA 269

Query: 308 QAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLK 367
           QAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLK
Sbjct: 270 QAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLK 329

Query: 368 KNVVRVWFCNQRQKQKRMKFAAQH 391
           KNVVRVWFCNQRQKQKRMKFAAQH
Sbjct: 330 KNVVRVWFCNQRQKQKRMKFAAQH 353

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|157110244|ref|XP_001651018.1| inhibitory pou [Aedes aegypti] gi|108878787|gb|EAT43012.1| AAEL005507-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|349584651|dbj|BAL03078.1| abnormal chemosensory jump 6, isoform B [Bombyx mori] Back     alignment and taxonomy information
>gi|349584655|dbj|BAL03080.1| abnormal chemosensory jump 6, isoform D [Bombyx mori] Back     alignment and taxonomy information
>gi|358350601|dbj|BAL15791.1| abnormal chemosensory jump 6, splice form A, partial [Bombyx mori] Back     alignment and taxonomy information
>gi|242017557|ref|XP_002429254.1| Inhibitory POU protein, putative [Pediculus humanus corporis] gi|212514150|gb|EEB16516.1| Inhibitory POU protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|349584649|dbj|BAL03077.1| abnormal chemosensory jump 6, isoform A [Bombyx mori] Back     alignment and taxonomy information
>gi|270004858|gb|EFA01306.1| abnormal chemosensory jump 6 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|349584653|dbj|BAL03079.1| abnormal chemosensory jump 6, isoform C [Bombyx mori] Back     alignment and taxonomy information
>gi|357622600|gb|EHJ74026.1| inhibitory pou [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query391
FB|FBgn0000028396 acj6 "abnormal chemosensory ju 0.608 0.601 0.714 1.7e-82
UNIPROTKB|Q01851419 POU4F1 "POU domain, class 4, t 0.409 0.381 0.797 3.7e-72
MGI|MGI:102525421 Pou4f1 "POU domain, class 4, t 0.409 0.380 0.797 3.7e-72
ZFIN|ZDB-GENE-000523-2368 pou4f1 "POU domain, class 4, t 0.409 0.434 0.797 4.2e-71
ZFIN|ZDB-GENE-990415-24361 pou4f3 "POU domain, class 4, t 0.578 0.626 0.576 5.3e-71
ZFIN|ZDB-GENE-040401-1384 pou4f2 "POU domain, class 4, t 0.404 0.411 0.776 2.5e-70
UNIPROTKB|E1BJ03338 POU4F3 "Uncharacterized protei 0.432 0.5 0.735 7.7e-70
UNIPROTKB|E2QUY3338 POU4F3 "Uncharacterized protei 0.432 0.5 0.735 7.7e-70
UNIPROTKB|Q15319338 POU4F3 "POU domain, class 4, t 0.432 0.5 0.735 7.7e-70
UNIPROTKB|F1RM14338 POU4F3 "Uncharacterized protei 0.432 0.5 0.735 7.7e-70
FB|FBgn0000028 acj6 "abnormal chemosensory jump 6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 827 (296.2 bits), Expect = 1.7e-82, P = 1.7e-82
 Identities = 178/249 (71%), Positives = 187/249 (75%)

Query:   143 FPQMSHHGMDGLEMLDSISSSMTTLTPMSD-P-TPNPHQLHSSSMYGPSMNSMMTXXXXX 200
             F +  HH MD L+MLD  + SMTTL P+S+ P TP    LH S  Y  SMN MM+     
Sbjct:   135 FSRQMHHSMDQLDMLDP-TGSMTTLAPISESPLTPTHQHLHGS--YH-SMNHMMSHHHPG 190

Query:   201 XXXXXXXXXXXXXXXTHHPVMPPGLQ----HPDTDTDPRELEAFAERFKQRRIKLGVTQA 256
                             HHPV+   +     HPDTDTDPRELEAFAERFKQRRIKLGVTQA
Sbjct:   191 TLSGHTGGHHGHSA-VHHPVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQA 249

Query:   257 DVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPIXXXXXXXXXXXXKNKRRDP 316
             DVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPI            KNKRRDP
Sbjct:   250 DVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDP 309

Query:   317 DAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFC 376
             DAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFC
Sbjct:   310 DAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFC 369

Query:   377 NQRQKQKRM 385
             NQRQKQKR+
Sbjct:   370 NQRQKQKRI 378
GO:0007636 "chemosensory jump behavior" evidence=IMP
GO:0003714 "transcription corepressor activity" evidence=IGI;IPI
GO:0005634 "nucleus" evidence=ISS;NAS
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS
GO:0008039 "synaptic target recognition" evidence=IMP
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0048813 "dendrite morphogenesis" evidence=IMP;TAS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0007411 "axon guidance" evidence=IMP
GO:0070983 "dendrite guidance" evidence=IMP
GO:0050911 "detection of chemical stimulus involved in sensory perception of smell" evidence=IDA
UNIPROTKB|Q01851 POU4F1 "POU domain, class 4, transcription factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:102525 Pou4f1 "POU domain, class 4, transcription factor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000523-2 pou4f1 "POU domain, class 4, transcription factor 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-24 pou4f3 "POU domain, class 4, transcription factor 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040401-1 pou4f2 "POU domain, class 4, transcription factor 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BJ03 POU4F3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUY3 POU4F3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q15319 POU4F3 "POU domain, class 4, transcription factor 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RM14 POU4F3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P17208PO4F1_MOUSENo assigned EC number0.85270.40920.3800yesN/A
P24350IPOU_DROMENo assigned EC number0.72720.64450.6363yesN/A
P13528UNC86_CAEELNo assigned EC number0.73800.42190.3533yesN/A
Q01851PO4F1_HUMANNo assigned EC number0.85270.40920.3818yesN/A
Q91998BRN3_CHICKNo assigned EC number0.7350.49360.5659yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query391
smart0035275 smart00352, POU, Found in Pit-Oct-Unc transcriptio 4e-47
pfam0015775 pfam00157, Pou, Pou domain - N-terminal to homeobo 3e-36
pfam0004657 pfam00046, Homeobox, Homeobox domain 2e-19
smart0038957 smart00389, HOX, Homeodomain 2e-16
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 4e-16
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 3e-05
cd0009358 cd00093, HTH_XRE, Helix-turn-helix XRE-family like 0.002
>gnl|CDD|197673 smart00352, POU, Found in Pit-Oct-Unc transcription factors Back     alignment and domain information 
 Score =  154 bits (392), Expect = 4e-47
 Identities = 56/78 (71%), Positives = 61/78 (78%), Gaps = 3/78 (3%)

Query: 229 DTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSH 288
           D DTDPRELEAFA++FKQRRIKLG TQADVG AL  L  P   A SQ+TICRFE+L LS 
Sbjct: 1   DDDTDPRELEAFAKQFKQRRIKLGFTQADVGLALGALYGP---AFSQTTICRFEALQLSF 57

Query: 289 NNMIALKPILQAWLEEAE 306
            NM  LKP+LQ WLEEAE
Sbjct: 58  KNMCKLKPLLQKWLEEAE 75

Length = 75
>gnl|CDD|189427 pfam00157, Pou, Pou domain - N-terminal to homeobox domain Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|238045 cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 391
KOG1168|consensus385 100.0
KOG3802|consensus398 100.0
PF0015775 Pou: Pou domain - N-terminal to homeobox domain; I 99.92
smart0035275 POU Found in Pit-Oct-Unc transcription factors. 99.82
KOG0775|consensus304 99.67
KOG0489|consensus261 99.65
KOG2252|consensus558 99.62
KOG0488|consensus309 99.62
KOG0842|consensus307 99.6
KOG4577|consensus 383 99.6
KOG0487|consensus308 99.58
KOG0843|consensus197 99.58
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.56
KOG0484|consensus125 99.55
KOG0485|consensus268 99.55
KOG2251|consensus 228 99.54
KOG0850|consensus245 99.49
KOG0848|consensus317 99.47
KOG0494|consensus 332 99.47
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.42
KOG0492|consensus246 99.42
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.42
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.41
KOG0844|consensus 408 99.34
COG5576156 Homeodomain-containing transcription factor [Trans 99.33
KOG0493|consensus342 99.31
KOG0486|consensus 351 99.31
KOG0491|consensus194 99.3
KOG0483|consensus198 99.25
KOG0847|consensus288 99.12
KOG0849|consensus 354 99.02
KOG0490|consensus 235 99.01
KOG0774|consensus334 98.78
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.3
KOG0490|consensus235 97.81
KOG1146|consensus 1406 97.27
KOG0773|consensus342 96.46
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 95.83
KOG3623|consensus 1007 94.9
PF1356064 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_ 94.29
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 94.26
COG3620187 Predicted transcriptional regulator with C-termina 92.91
TIGR0307058 couple_hipB transcriptional regulator, y4mF family 92.28
PHA0197667 helix-turn-helix protein 91.5
PF04814180 HNF-1_N: Hepatocyte nuclear factor 1 (HNF-1), N te 90.55
KOG3623|consensus 1007 89.91
TIGR00270154 conserved hypothetical protein TIGR00270. 88.26
PRK06424144 transcription factor; Provisional 88.17
PRK0972688 antitoxin HipB; Provisional 87.53
TIGR03830127 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-he 86.73
PF1374480 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_ 86.62
cd00131128 PAX Paired Box domain 84.34
PRK09706135 transcriptional repressor DicA; Reviewed 84.22
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 83.18
PRK10856 331 cytoskeletal protein RodZ; Provisional 82.85
PF0138155 HTH_3: Helix-turn-helix; InterPro: IPR001387 This 80.71
PRK08359176 transcription factor; Validated 80.4
PF1284464 HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_ 80.08
>KOG1168|consensus Back     alignment and domain information 
Probab=100.00  E-value=8.7e-70  Score=520.68  Aligned_cols=300  Identities=61%  Similarity=0.835  Sum_probs=231.6

Q ss_pred             ccCccccccchhhhhHHHHHhhhhhccc-cCCCCCCCCCCCCCccccc--cCCCCCCC---CC-------CCCCCCCCCC
Q psy17897          5 RYALLFSGLNDGLLSRAEALAAVDIGKH-SASSTPTLPTLKHDMMYHH--GMNGTHGG---PN-------GRPHQMSHHG   71 (391)
Q Consensus         5 ~~~~~f~g~~~~~~~~~~~~a~~~~~~~-~~~~~~~~~~~~~~~~~~~--~~~~~~~~---~~-------~~~~~~~~~~   71 (391)
                      +++|||+|+||+||+||||||||||.|+ +++|.++.||||||++|||  .+.|+.+.   +.       ++||+.+|..
T Consensus        54 ~~snifa~~deslLaRaealaavdi~~~qgk~~h~~pppfk~d~tyht~~~~~~ts~ts~vP~~~~a~~~~h~hh~~h~~  133 (385)
T KOG1168|consen   54 RGSNIFAGTDESLLARAEALAAVDIPKSQGKQHHGDPPPFKPDATYHTMSVPPCTSQTSPVPLTHTASKMHHPHHHPHQM  133 (385)
T ss_pred             cCCcccccccHHHHHHHHhhhheechhhcCcccCCCCCCCCCCCcccccccCCCCCCCCCcccccchhhccCcccChhhh
Confidence            5899999999999999999999999554 4566558889999999998  55555422   22       4555555554


Q ss_pred             CCccccccccCCCCcccCCCCCCC--CCCCCCCCccccCCCccccccccccccCCCCCCcCCCCCCCCccccccccccCC
Q psy17897         72 MDGLEMLDSISSSMTTLTPMSDPT--PNPHQLHSSSMYGPSMNSMMTGHHHHHHHSGALPASHHHVATPSLLLFPQMSHH  149 (391)
Q Consensus        72 ~~~~~~~d~~~~~~~~~~p~~~~~--~~~~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  149 (391)
                      +|   +.|++++-.++|+++....  |.+..                                                 
T Consensus       134 le---~~d~~~~ispsla~~~~~g~~P~~~~-------------------------------------------------  161 (385)
T KOG1168|consen  134 LE---YGDLLSHISPSLATNIYQGSEPFHAS-------------------------------------------------  161 (385)
T ss_pred             cc---ccccccccCcchhhccccCCCCCCce-------------------------------------------------
Confidence            44   4444333335677665442  11100                                                 


Q ss_pred             CCCCccccccccCcCccCCCCCCCCCCCcCCCCCCCCCcccccccccCCCCCCCCCCCCCCCCCCCCCCCCC----CCCC
Q psy17897        150 GMDGLEMLDSISSSMTTLTPMSDPTPNPHQLHSSSMYGPSMNSMMTGHHHHHHHSGALPASHHHGATHHPVM----PPGL  225 (391)
Q Consensus       150 ~~~g~~ml~~~~~~~~~~~~m~~~~~~~h~~~~~~~~~~~m~~~~~~~~~~~~~~~~~~~h~~~~~~~~~~~----~~~~  225 (391)
                                          +...+.++             ++|+. +.|.+...++..-+||+..++|+.+    +...
T Consensus       162 --------------------~~~~~hs~-------------~hm~~-~~h~~~~~~~~~m~hphs~~~h~~~~a~~a~~~  207 (385)
T KOG1168|consen  162 --------------------VVGPTHSD-------------DHMTS-LQHVMAMQQAYGMTHPHSTTSHASSNARYAIAG  207 (385)
T ss_pred             --------------------ecccCCCc-------------ccccc-ccchhhHHHHhccCCCCCCCCcchhhhccccCC
Confidence                                01111111             11111 1111111112222344444444433    1122


Q ss_pred             CCCCCCCCHHHHHHHHHHHhhhhHhcCccchhhhhhhhcCcCCCCcccccchhhhhccCCCChhhhhhhhHHHHHHHHHH
Q psy17897        226 QHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEA  305 (391)
Q Consensus       226 ~~pd~~~d~~eLe~Fa~~fkqrRI~lGlTQ~~Vg~ALg~l~~~G~~~fSQstIcRfE~LqLS~knm~KLkPlL~kWLeea  305 (391)
                      .++|.++|.+|||.||++||||||+||+||+|||.||.+|++|||+.+||+||||||+|.||..||..|||+|+.||||+
T Consensus       208 ~~sD~dtDPReLEaFAErFKQRRIKLGVTQADVG~ALAnLKiPGVGsLSQSTICRFESLTLSHNNMiALKPILqaWLEeA  287 (385)
T KOG1168|consen  208 PTSDMDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEA  287 (385)
T ss_pred             CCcccCCCHHHHHHHHHHHHhhhhhhcccHHHHHHHHHhCcCCCcccccccceeeeeeeccccCcchhhhHHHHHHHHHH
Confidence            36799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhhcCCCCCCCCCCCCCCCCCCCcccChHHHHHHHHHhhcCCCCCHHHHHHHHHHhCCCCCccccccchhhhHHhhH
Q psy17897        306 EAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRM  385 (391)
Q Consensus       306 E~~~~~~~~~~~~~~~~~~~~kKRkRT~ft~~Ql~~LE~~F~~n~yPS~~er~~LA~qLgLs~~qVrvWFqNRR~K~KR~  385 (391)
                      |...+++...++.+.+++...||||||++...+++.||++|..+++|+.+.|..||++|+|.+++|||||||+|+|.||+
T Consensus       288 E~a~keK~~~pd~~~l~~~~ekKRKRTSIAAPEKRsLEayFavQPRPS~EkIAaIAekLDLKKNVVRVWFCNQRQKQKRm  367 (385)
T KOG1168|consen  288 EAAMKEKDTKPDINELLPGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRM  367 (385)
T ss_pred             HHHHHhhccCCchhhccCccccccccccccCcccccHHHHhccCCCCchhHHHHHHHhhhhhhceEEEEeeccHHHHHHh
Confidence            99999999999888899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             Hhhhc
Q psy17897        386 KFAAQ  390 (391)
Q Consensus       386 ~k~aq  390 (391)
                      +.++-
T Consensus       368 ~~Sa~  372 (385)
T KOG1168|consen  368 KRSAT  372 (385)
T ss_pred             hhhhc
Confidence            88763

>KOG3802|consensus Back     alignment and domain information
>PF00157 Pou: Pou domain - N-terminal to homeobox domain; InterPro: IPR000327 POU proteins are eukaryotic transcription factors containing a bipartite DNA binding domain referred to as the POU domain Back     alignment and domain information
>smart00352 POU Found in Pit-Oct-Unc transcription factors Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF13560 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>TIGR03070 couple_hipB transcriptional regulator, y4mF family Back     alignment and domain information
>PHA01976 helix-turn-helix protein Back     alignment and domain information
>PF04814 HNF-1_N: Hepatocyte nuclear factor 1 (HNF-1), N terminus; InterPro: IPR006899 This domain consists of the N terminus of homeobox-containing transcription factor HNF-1 Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>TIGR00270 conserved hypothetical protein TIGR00270 Back     alignment and domain information
>PRK06424 transcription factor; Provisional Back     alignment and domain information
>PRK09726 antitoxin HipB; Provisional Back     alignment and domain information
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family Back     alignment and domain information
>PF13744 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_A Back     alignment and domain information
>cd00131 PAX Paired Box domain Back     alignment and domain information
>PRK09706 transcriptional repressor DicA; Reviewed Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>PRK10856 cytoskeletal protein RodZ; Provisional Back     alignment and domain information
>PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) Back     alignment and domain information
>PRK08359 transcription factor; Validated Back     alignment and domain information
>PF12844 HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_A 2XIU_B 2GZU_B 2XJ3_A 1UTX_A 2XI8_B 3F6W_C 3EUS_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query391
2xsd_C164 Crystal Structure Of The Dimeric Oct-6 (Pou3f1) Pou 3e-32
1o4x_A167 Ternary Complex Of The Dna Binding Domains Of The O 3e-28
1cqt_A163 Crystal Structure Of A Ternary Complex Containing A 2e-27
1oct_C156 Crystal Structure Of The Oct-1 Pou Domain Bound To 3e-27
1au7_A146 Pit-1 MutantDNA COMPLEX Length = 146 2e-26
1hf0_A159 Crystal Structure Of The Dna-Binding Domain Of Oct- 5e-26
1e3o_C160 Crystal Structure Of Oct-1 Pou Dimer Bound To More 7e-26
3l1p_A155 Pou Protein:dna Complex Length = 155 6e-24
3d1n_I151 Structure Of Human Brn-5 Transcription Factor In Co 2e-16
1pou_A71 The Solution Structure Of The Oct-1 Pou-Specific Do 2e-12
1ocp_A67 Solution Structure Of Oct3 Pou-Homeodomain Length = 1e-11
1hdp_A63 Solution Structure Of A Pou-Specific Homeodomain: 3 1e-11
1pog_A67 Solution Structure Of The Oct-1 Pou-Homeo Domain De 4e-11
2dmq_A80 Solution Structure Of The Homeobox Domain Of LimHOM 8e-06
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 2e-04
>pdb|2XSD|C Chain C, Crystal Structure Of The Dimeric Oct-6 (Pou3f1) Pou Domain Bound To Palindromic More Dna Length = 164 Back     alignment and structure 
Iteration: 1

 Score =  135 bits (341), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 99/167 (59%), Gaps = 7/167 (4%)
Query: 224 GLQHPDTDT-DPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFE 282
           G +H D D     +LE FA++FKQRRIKLG TQADVG AL  L        SQ+TICRFE
Sbjct: 1   GGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLY---GNVFSQTTICRFE 57
Query: 283 SLTLSHNNMIALKPIXXXXXXXXXXXXKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSL 342
           +L LS  NM  LKP+             +     +   +   G K++KRTSI    K +L
Sbjct: 58  ALQLSFKNMCKLKPLLNKWLEETDSSSGSP---TNLDKIAAQGRKRKKRTSIEVGVKGAL 114
Query: 343 EAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFAA 389
           E++F   P+PS  +I  +A+ L L+K VVRVWFCN+RQK+KRM  AA
Sbjct: 115 ESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAA 161
>pdb|1O4X|A Chain A, Ternary Complex Of The Dna Binding Domains Of The Oct1 And Sox2 Transcription Factors With A 19mer Oligonucleotide From The Hoxb1 Regulatory Element Length = 167 Back     alignment and structure
>pdb|1CQT|A Chain A, Crystal Structure Of A Ternary Complex Containing An Oca-B Peptide, The Oct-1 Pou Domain, And An Octamer Element Length = 163 Back     alignment and structure
>pdb|1OCT|C Chain C, Crystal Structure Of The Oct-1 Pou Domain Bound To An Octamer Site: Dna Recognition With Tethered Dna-Binding Modules Length = 156 Back     alignment and structure
>pdb|1AU7|A Chain A, Pit-1 MutantDNA COMPLEX Length = 146 Back     alignment and structure
>pdb|1HF0|A Chain A, Crystal Structure Of The Dna-Binding Domain Of Oct-1 Bound To Dna As A Dimer Length = 159 Back     alignment and structure
>pdb|1E3O|C Chain C, Crystal Structure Of Oct-1 Pou Dimer Bound To More Length = 160 Back     alignment and structure
>pdb|3L1P|A Chain A, Pou Protein:dna Complex Length = 155 Back     alignment and structure
>pdb|3D1N|I Chain I, Structure Of Human Brn-5 Transcription Factor In Complex With Corticotrophin-Releasing Hormone Gene Promoter Length = 151 Back     alignment and structure
>pdb|1POU|A Chain A, The Solution Structure Of The Oct-1 Pou-Specific Domain Reveals A Striking Similarity To The Bacteriophage Lambda Repressor Dna-Binding Domain Length = 71 Back     alignment and structure
>pdb|1OCP|A Chain A, Solution Structure Of Oct3 Pou-Homeodomain Length = 67 Back     alignment and structure
>pdb|1HDP|A Chain A, Solution Structure Of A Pou-Specific Homeodomain: 3d-Nmr Studies Of Human B-Cell Transcription Factor Oct-2 Length = 63 Back     alignment and structure
>pdb|1POG|A Chain A, Solution Structure Of The Oct-1 Pou-Homeo Domain Determined By Nmr And Restrained Molecular Dynamics Length = 67 Back     alignment and structure
>pdb|2DMQ|A Chain A, Solution Structure Of The Homeobox Domain Of LimHOMEOBOX Protein Lhx9 Length = 80 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query391
1e3o_C160 Octamer-binding transcription factor 1; transcript 8e-67
2xsd_C164 POU domain, class 3, transcription factor 1; trans 3e-63
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 9e-62
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 4e-58
3d1n_I151 POU domain, class 6, transcription factor 1; prote 6e-58
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 8e-21
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-17
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 6e-17
2e19_A64 Transcription factor 8; homeobox domain, structura 4e-14
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-12
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 6e-12
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-10
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-10
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-09
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-09
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-09
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 6e-09
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 2e-08
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 3e-08
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 3e-08
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 4e-08
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 2e-07
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 6e-07
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 3e-06
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 3e-06
1r69_A69 Repressor protein CI; gene regulating protein; 2.0 3e-06
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 5e-06
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 5e-06
1zug_A71 Phage 434 CRO protein; gene regulating protein, tr 1e-05
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-05
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 2e-05
4ghj_A101 Probable transcriptional regulator; structural gen 3e-05
3a01_A93 Homeodomain-containing protein; homeodomain, prote 3e-05
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 4e-05
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 5e-05
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 6e-05
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 8e-05
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 1e-04
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 1e-04
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 1e-04
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 1e-04
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 1e-04
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 1e-04
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 3e-04
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 3e-04
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 3e-04
1lfb_A99 Liver transcription factor (LFB1); transcription r 4e-04
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 4e-04
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 4e-04
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA bin 7e-04
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
 Score =  208 bits (530), Expect = 8e-67
 Identities = 71/162 (43%), Positives = 99/162 (61%), Gaps = 8/162 (4%)

Query: 229 DTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSH 288
           +  +D  ELE FA+ FKQRRIKLG TQ DVG A+  L        SQ+TI RFE+L LS 
Sbjct: 1   EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGN---DFSQTTISRFEALNLSF 57

Query: 289 NNMIALKPILQAWLEEAEAQAKNKRR-----DPDAPSVLPAGEKKRKRTSIAAPEKRSLE 343
            NM  LKP+L+ WL +AEA   +          ++P +     +++KRTSI    + +LE
Sbjct: 58  KNMSKLKPLLEKWLNDAEANLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALE 117

Query: 344 AYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRM 385
             F    +P+ E I  IAE+L+++K V+RVWF N+RQK+KR+
Sbjct: 118 KSFMENQKPTSEDITLIAEQLNMEKEVIRVWFSNRRQKEKRI 159
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Length = 69 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Length = 71 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>4ghj_A Probable transcriptional regulator; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE; 1.75A {Vibrio vulnificus} Length = 101 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Length = 83 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query391
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 100.0
2xsd_C164 POU domain, class 3, transcription factor 1; trans 100.0
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 100.0
3d1n_I151 POU domain, class 6, transcription factor 1; prote 100.0
1e3o_C160 Octamer-binding transcription factor 1; transcript 100.0
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.83
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.76
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.73
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.72
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.71
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.71
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.71
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.71
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.71
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.71
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.71
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.7
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.7
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.7
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.7
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.7
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.7
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.7
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.7
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.69
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.69
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.69
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.69
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.69
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.69
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.69
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.68
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.68
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.68
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.68
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.68
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.68
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.67
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.67
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.67
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.67
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.67
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.65
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.65
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.65
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.64
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.64
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.64
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.64
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.64
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.63
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.63
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.63
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.63
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.62
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.62
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.62
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.62
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.61
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.61
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.6
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.59
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.58
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.56
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.56
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.56
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.56
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.55
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.55
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.54
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.54
2e19_A64 Transcription factor 8; homeobox domain, structura 99.51
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.49
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.42
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.37
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.24
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.12
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.31
4ich_A 311 Transcriptional regulator; structural genomics, PS 96.71
4ghj_A101 Probable transcriptional regulator; structural gen 95.3
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-t 94.58
3eus_A86 DNA-binding protein; structural genomics, PSI2,MCS 94.56
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, tra 94.13
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA bin 94.04
3kz3_A80 Repressor protein CI; five helix bundle, DNA-bindi 93.92
3s8q_A82 R-M controller protein; protein-DNA complex, helix 93.5
1zug_A71 Phage 434 CRO protein; gene regulating protein, tr 93.15
3qq6_A78 HTH-type transcriptional regulator SINR; helix-tur 92.9
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1 92.87
2wus_R112 RODZ, putative uncharacterized protein; structural 92.87
3vk0_A114 NHTF, transcriptional regulator; HTH motif, XRE tr 92.81
3g5g_A99 Regulatory protein; transcriptional regulator, hel 92.67
3mlf_A111 Transcriptional regulator; structural genomics, he 92.66
2kpj_A94 SOS-response transcriptional repressor, LEXA; NESG 92.65
2wiu_B88 HTH-type transcriptional regulator HIPB; transfera 92.42
2a6c_A83 Helix-turn-helix motif; putative transcriptional r 92.37
3b7h_A78 Prophage LP1 protein 11; structural genomics, PSI2 92.33
1r69_A69 Repressor protein CI; gene regulating protein; 2.0 91.72
3t76_A88 VANU, transcriptional regulator vanug; structural 91.55
2k9q_A77 Uncharacterized protein; all helix, helix-turn-hel 91.48
3fmy_A73 HTH-type transcriptional regulator MQSA (YGIT/B302 91.41
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 91.14
1adr_A76 P22 C2 repressor; transcription regulation; NMR {E 91.12
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-t 91.11
1x57_A91 Endothelial differentiation-related factor 1; HMBF 91.07
1lmb_392 Protein (lambda repressor); protein-DNA complex, d 91.0
2ewt_A71 BLDD, putative DNA-binding protein; the DNA-bindin 90.66
3f52_A117 CLP gene regulator (CLGR); helix-turn-helix motif, 90.56
3ivp_A126 Putative transposon-related DNA-binding protein; A 90.55
2ppx_A99 AGR_C_3184P, uncharacterized protein ATU1735; HTH- 90.24
2o38_A120 Hypothetical protein; alpha-beta, helix-turn-helix 90.0
2l1p_A83 DNA-binding protein SATB1; PSI-biology, NESG, stru 89.8
3op9_A114 PLI0006 protein; structural genomics, PSI-2, prote 89.48
3fym_A130 Putative uncharacterized protein; HTH DNA binding, 89.0
2l49_A99 C protein; P2 bacteriophage, P2 C, direct repeats, 88.38
1jhg_A101 Trp operon repressor; complex (regulatory protein- 88.31
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 88.1
2jvl_A107 TRMBF1; coactivator, helix-turn-helix, Pro binding 87.32
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 87.04
1b0n_A111 Protein (SINR protein); transcription regulator, a 86.45
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 85.58
3kxa_A141 NGO0477 protein, putative uncharacterized protein; 85.33
3lfp_A98 CSP231I C protein; transcriptional regulator, DNA 85.33
2xi8_A66 Putative transcription regulator; HTH DNA-binding 85.14
3cec_A104 Putative antidote protein of plasmid maintenance; 84.82
2eby_A113 Putative HTH-type transcriptional regulator YBAQ; 82.69
3bs3_A76 Putative DNA-binding protein; XRE-family, structur 82.62
3omt_A73 Uncharacterized protein; structural genomics, PSI- 82.05
2k27_A159 Paired box protein PAX-8; paired domain, solution 80.62
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 80.4
2ict_A94 Antitoxin HIGA; helix-turn-helix, structural genom 80.31
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
Probab=100.00  E-value=6.9e-43  Score=312.05  Aligned_cols=151  Identities=48%  Similarity=0.715  Sum_probs=132.6

Q ss_pred             CCCCCHHHHHHHHHHHhhhhHhcCccchhhhhhhhcCcCCCCcccccchhhhhccCCCChhhhhhhhHHHHHHHHHHHHH
Q psy17897        229 DTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQ  308 (391)
Q Consensus       229 d~~~d~~eLe~Fa~~fkqrRI~lGlTQ~~Vg~ALg~l~~~G~~~fSQstIcRfE~LqLS~knm~KLkPlL~kWLeeaE~~  308 (391)
                      |++++.+|||+||+.||+|||+|||||++||.||+.+|  | .+|||+||||||++++|++|||||+|+|++||+++|..
T Consensus         4 d~~~~~~~l~~fa~~fk~~ri~lg~tq~~vg~al~~l~--G-~~~Sqtti~rfE~l~ls~~nm~kLkPlL~~Wl~eae~~   80 (155)
T 3l1p_A            4 DMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLF--G-KVFSQTTISRFEALQLSLKNMSKLRPLLEKWVEEADNN   80 (155)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHH--S-CCCCHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHHTTC
T ss_pred             cchhhHHHHHHHHHHHHhhhheecccHHHHHHHHHhhc--C-cccccccccccccccCChhhHhhcchHHHHHhhhhhcc
Confidence            67788999999999999999999999999999999998  4 57999999999999999999999999999999998843


Q ss_pred             hhhcCCCCCCCCCCCCCCCCCCCcccChHHHHHHHHHhhcCCCCCHHHHHHHHHHhCCCCCccccccchhhhHHhhH
Q psy17897        309 AKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRM  385 (391)
Q Consensus       309 ~~~~~~~~~~~~~~~~~~kKRkRT~ft~~Ql~~LE~~F~~n~yPS~~er~~LA~qLgLs~~qVrvWFqNRR~K~KR~  385 (391)
                      .... .........  .++||+|+.|+..|+..||..|..++||+..++.+||.++||++++|+|||||||+|+||.
T Consensus        81 ~~~~-~~~~~~~~~--~~~rr~Rt~ft~~Q~~~Le~~F~~~~yps~~~r~~LA~~l~L~~~qV~vWFqNRR~k~Kr~  154 (155)
T 3l1p_A           81 ENLQ-EISKSETLV--QARKRKRTSIENRVRWSLETMFLKSPKPSLQQITHIANQLGLEKDVVRVWFSNRRQKGKRS  154 (155)
T ss_dssp             HHHH-HSSCC---C--CCSCCCCCCCCHHHHHHHHTTTTTCSCCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHC-
T ss_pred             cCcc-ccccccccc--cCCCCCCcccCHHHHHHHHHHHccCCCCCHHHHHHHHHHcCCChhheeeccccccccccCC
Confidence            2211 111111111  4678899999999999999999999999999999999999999999999999999999985
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>4ich_A Transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, transcription RE; 1.95A {Saccharomonospora viridis} Back     alignment and structure
>4ghj_A Probable transcriptional regulator; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE; 1.75A {Vibrio vulnificus} Back     alignment and structure
>2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Back     alignment and structure
>3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomic binding; 1.80A {Silicibacter pomeroyi} Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Back     alignment and structure
>3s8q_A R-M controller protein; protein-DNA complex, helix-turn-helix; HET: DNA; 2.10A {Enterobacter SP} SCOP: a.35.1.0 PDB: 3clc_A* 3ufd_A* Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Back     alignment and structure
>3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Back     alignment and structure
>2wus_R RODZ, putative uncharacterized protein; structural protein, cell WALL morphogenesis, bacterial cytos bacterial actin; 2.90A {Thermotoga maritima} Back     alignment and structure
>3vk0_A NHTF, transcriptional regulator; HTH motif, XRE transcription factor, DNA binding protein; 1.88A {Neisseria meningitidis} Back     alignment and structure
>3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A Back     alignment and structure
>3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} Back     alignment and structure
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, serine kinase, DNA-bindin mercury derivative, repressor; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Back     alignment and structure
>2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 Back     alignment and structure
>3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Back     alignment and structure
>2k9q_A Uncharacterized protein; all helix, helix-turn-helix, plasmid, structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L Back     alignment and structure
>1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 Back     alignment and structure
>1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* Back     alignment and structure
>2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor} Back     alignment and structure
>3f52_A CLP gene regulator (CLGR); helix-turn-helix motif, transcriptional ACTI human pathogen, transcription activator; 1.75A {Corynebacterium glutamicum} PDB: 3f51_A Back     alignment and structure
>3ivp_A Putative transposon-related DNA-binding protein; APC62618, clostridium diffic structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile} Back     alignment and structure
>2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 Back     alignment and structure
>2o38_A Hypothetical protein; alpha-beta, helix-turn-helix, structural genomics, PSI-2, PR structure initiative; 1.83A {Rhodopseudomonas palustris} SCOP: a.35.1.13 Back     alignment and structure
>2l1p_A DNA-binding protein SATB1; PSI-biology, NESG, structural genomics, protein structure in northeast structural genomics consortium; NMR {Homo sapiens} PDB: 3nzl_A* Back     alignment and structure
>3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} Back     alignment and structure
>3fym_A Putative uncharacterized protein; HTH DNA binding, DNA binding protein; 1.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>2jvl_A TRMBF1; coactivator, helix-turn-helix, Pro binding, transcription; NMR {Trichoderma reesei} Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 PDB: 2yal_A Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3lfp_A CSP231I C protein; transcriptional regulator, DNA binding protein, helix-turn-H restriction-modification, transcription; 2.00A {Citrobacter SP} PDB: 3lis_A Back     alignment and structure
>2xi8_A Putative transcription regulator; HTH DNA-binding motif; HET: GOL; 1.21A {Enterococcus faecalis} PDB: 2gzu_A 1utx_A* 2xj3_A 2xiu_A Back     alignment and structure
>3cec_A Putative antidote protein of plasmid maintenance; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.60A {Nostoc punctiforme} Back     alignment and structure
>2eby_A Putative HTH-type transcriptional regulator YBAQ; hypothetical protein, JW0472, structural genomics, NPPSFA; 2.25A {Escherichia coli} Back     alignment and structure
>3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis} Back     alignment and structure
>3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>2ict_A Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein struct initiative, northeast structural genomics consortium, NESG; 1.63A {Escherichia coli} SCOP: a.35.1.3 PDB: 2icp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 391
d1au7a272 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [ 2e-36
d1e3oc275 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [Tax 2e-33
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 4e-15
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 4e-15
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 9e-15
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 1e-14
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 3e-14
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 5e-14
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 5e-14
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-13
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 1e-13
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-13
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 6e-13
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 6e-13
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-12
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 3e-12
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 1e-11
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-11
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 2e-11
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 2e-11
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 5e-11
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 8e-11
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 1e-10
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 1e-10
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-10
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 3e-10
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 4e-10
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-09
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 2e-09
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 3e-09
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-07
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 2e-07
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 6e-07
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 3e-05
>d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 72 Back     information, alignment and structure

class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: POU-specific domain
domain: Pit-1
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  125 bits (315), Expect = 2e-36
 Identities = 42/72 (58%), Positives = 47/72 (65%), Gaps = 3/72 (4%)

Query: 235 RELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL 294
           R LE FA  FK RRIKLG TQ +VG+ALA +        SQ+TICRFE+L LS  N   L
Sbjct: 3   RALEQFANEFKVRRIKLGYTQTNVGEALAAVHGS---EFSQTTICRFENLQLSFKNACKL 59

Query: 295 KPILQAWLEEAE 306
           K IL  WLEEAE
Sbjct: 60  KAILSKWLEEAE 71
>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query391
d1e3oc275 Oct-1 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1au7a272 Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.94
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.75
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.75
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.74
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.74
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.74
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.73
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.73
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.72
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.71
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.71
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.71
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.71
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.7
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.7
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.7
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.7
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.69
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.68
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.66
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.66
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.65
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.65
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.61
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.57
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.57
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.56
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.51
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.51
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.47
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.47
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.46
d1y7ya169 Restriction-modification controller protein C.AhdI 95.72
d1lmb3_87 lambda C1 repressor, DNA-binding domain {Bacteriop 94.23
d2ppxa162 Uncharacterized protein Atu1735 {Agrobacterium tum 93.44
d2a6ca169 HTH-motif protein NE1354 {Nitrosomonas europaea [T 93.44
d2croa_65 cro 434 {Bacteriophage 434 [TaxId: 10712]} 93.36
d2b5aa177 Regulatory protein C.BclI {Bacillus caldolyticus [ 92.4
d2auwa167 Hypothetical protein NE0471 C-terminal domain {Nit 92.11
d2o38a189 Hypothetical protein RPA3824 {Rhodopseudomonas pal 91.84
d1x57a178 Endothelial differentiation-related factor 1, EDF1 91.49
d1r69a_63 434 C1 repressor, DNA-binding domain {Bacteriophag 91.44
d1hlva166 DNA-binding domain of centromere binding protein B 90.32
d1b0na268 SinR repressor, DNA-binding domain {Bacillus subti 89.86
d2r1jl166 P22 C2 repressor, DNA-binding domain {Salmonella b 89.84
d1y9qa179 Probable transcriptional regulator VC1968, N-termi 89.23
d1ic8a294 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (H 87.98
d1x2la187 Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens 87.86
d1utxa_66 Putative transcription regulator CylR2 {Enterococc 85.06
d1wh8a_111 Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens 82.51
d1s7ea280 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 81.63
d1wh6a_101 Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens 80.97
>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: POU-specific domain
domain: Oct-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=3.5e-29  Score=194.54  Aligned_cols=75  Identities=56%  Similarity=0.842  Sum_probs=70.7

Q ss_pred             CCCCCHHHHHHHHHHHhhhhHhcCccchhhhhhhhcCcCCCCcccccchhhhhccCCCChhhhhhhhHHHHHHHHHHH
Q psy17897        229 DTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAE  306 (391)
Q Consensus       229 d~~~d~~eLe~Fa~~fkqrRI~lGlTQ~~Vg~ALg~l~~~G~~~fSQstIcRfE~LqLS~knm~KLkPlL~kWLeeaE  306 (391)
                      |+..+++|||+||+.||+|||++||||++||.||+++++   ..|||+||||||++++|++|||||+|+|++||+++|
T Consensus         1 e~~~~l~Ele~Fa~~fk~rRi~LG~TQ~dVG~al~~l~g---~~~SQttIcRFE~l~LS~kn~~kLkP~L~~WL~eaE   75 (75)
T d1e3oc2           1 EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYG---NDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAE   75 (75)
T ss_dssp             CCSCCHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHS---CCCCHHHHHHHHHTCSCHHHHHHHHHHHHHHHHHHC
T ss_pred             CCCCCHHHHHHHHHHHHHHHHhccccHHHHHHHHHHHcC---cchhHHHHHHHHHhccCHHHHHHHHHHHHHHHHhcC
Confidence            356789999999999999999999999999999999994   579999999999999999999999999999999975
>d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
>d1lmb3_ a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} Back     information, alignment and structure
>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ic8a2 a.35.1.1 (A:87-180) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2la1 a.35.1.7 (A:9-95) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wh8a_ a.35.1.7 (A:) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea2 a.35.1.7 (A:6-85) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh6a_ a.35.1.7 (A:) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure