Psyllid ID: psy17899

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MSLFPMPDVYSRVLFTGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRPINGHTRA
cccccccHHHHHHHHccccHHHHHHHHHHcccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHccccccEEEcccccccc
ccccccccccHEEEEEcccccHHHHHHccEEccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHEEEEEHHcccc
mslfpmpdvySRVLFTGVTQADVGKALAnlklpgvgalsqsticRFESLTLSHNNMIALKPILQAWLEEAEAQAKnkrrdpdapsvlpagekkrkrtsiaapekrsleayfavqprpsgEKIAAIAEKLDlkknvvrpinghtra
MSLFPMPDVYSRVLFTGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQaknkrrdpdapsvlpagekkrkrtsiaapekrsleayfavqprpsgEKIAAIAekldlkknvvrpinghtra
MSLFPMPDVYSRVLFTGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPIlqawleeaeaqaKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRPINGHTRA
******PDVYSRVLFTGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLE*****************************************************************************
*******DVYSRVLFTGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLE***********************************KRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRPINGHT**
MSLFPMPDVYSRVLFTGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEA******************************APEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRPINGHTRA
*SLFPMPDVYSRVLFTGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAE*************************TSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRPINGHTR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLFPMPDVYSRVLFTGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRPINGHTRA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query145 2.2.26 [Sep-21-2011]
P24350396 Inhibitory POU protein OS yes N/A 0.868 0.318 0.968 3e-65
Q01851419 POU domain, class 4, tran yes N/A 0.848 0.293 0.809 2e-51
P17208421 POU domain, class 4, tran yes N/A 0.848 0.292 0.809 3e-51
P20266128 POU domain, class 4, tran no N/A 0.848 0.960 0.809 4e-51
Q90435331 POU domain, class 4, tran no N/A 0.813 0.356 0.818 5e-51
Q63934411 POU domain, class 4, tran no N/A 0.848 0.299 0.801 1e-50
Q12837409 POU domain, class 4, tran no N/A 0.848 0.300 0.801 1e-50
Q15319338 POU domain, class 4, tran no N/A 0.848 0.363 0.785 1e-50
Q63955338 POU domain, class 4, tran no N/A 0.848 0.363 0.785 2e-50
Q91998341 Brain-specific homeobox/P no N/A 0.813 0.346 0.809 2e-50
>sp|P24350|IPOU_DROME Inhibitory POU protein OS=Drosophila melanogaster GN=acj6 PE=1 SV=3 Back     alignment and function desciption
 Score =  246 bits (628), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 122/126 (96%), Positives = 123/126 (97%)

Query: 12  RVLFTGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAE 71
           R +  GVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAE
Sbjct: 240 RRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAE 299

Query: 72  AQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL 131
           AQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL
Sbjct: 300 AQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL 359

Query: 132 KKNVVR 137
           KKNVVR
Sbjct: 360 KKNVVR 365
Modulates gene transcription; simultaneously generates both a specific activator and an inhibitor of gene transcription, capable of modulating two distinct regulatory programs during neural development. Has a role in olfactory behavior.
Drosophila melanogaster (taxid: 7227)
>sp|Q01851|PO4F1_HUMAN POU domain, class 4, transcription factor 1 OS=Homo sapiens GN=POU4F1 PE=2 SV=4 Back     alignment and function description
>sp|P17208|PO4F1_MOUSE POU domain, class 4, transcription factor 1 OS=Mus musculus GN=Pou4f1 PE=2 SV=3 Back     alignment and function description
>sp|P20266|PO4F1_RAT POU domain, class 4, transcription factor 1 (Fragment) OS=Rattus norvegicus GN=Pou4f1 PE=2 SV=2 Back     alignment and function description
>sp|Q90435|PO4F3_DANRE POU domain, class 4, transcription factor 3 OS=Danio rerio GN=pou4f3 PE=2 SV=2 Back     alignment and function description
>sp|Q63934|PO4F2_MOUSE POU domain, class 4, transcription factor 2 OS=Mus musculus GN=Pou4f2 PE=2 SV=1 Back     alignment and function description
>sp|Q12837|PO4F2_HUMAN POU domain, class 4, transcription factor 2 OS=Homo sapiens GN=POU4F2 PE=1 SV=2 Back     alignment and function description
>sp|Q15319|PO4F3_HUMAN POU domain, class 4, transcription factor 3 OS=Homo sapiens GN=POU4F3 PE=1 SV=1 Back     alignment and function description
>sp|Q63955|PO4F3_MOUSE POU domain, class 4, transcription factor 3 OS=Mus musculus GN=Pou4f3 PE=2 SV=2 Back     alignment and function description
>sp|Q91998|BRN3_CHICK Brain-specific homeobox/POU domain protein 3 OS=Gallus gallus GN=BRN3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
328713589 424 PREDICTED: inhibitory POU protein-like [ 0.868 0.297 0.968 1e-63
195060344 320 GH17948 [Drosophila grimshawi] gi|193896 0.868 0.393 0.968 1e-63
242017557 296 Inhibitory POU protein, putative [Pedicu 0.868 0.425 0.968 1e-63
198470029 294 GA26624 [Drosophila pseudoobscura pseudo 0.862 0.425 0.976 1e-63
386764469 370 abnormal chemosensory jump 6, isoform K 0.868 0.340 0.968 1e-63
386764467 359 abnormal chemosensory jump 6, isoform J 0.868 0.350 0.968 2e-63
386764475 378 abnormal chemosensory jump 6, isoform N 0.868 0.333 0.968 2e-63
386764465 366 abnormal chemosensory jump 6, isoform I 0.868 0.344 0.968 2e-63
17864538 396 abnormal chemosensory jump 6, isoform A 0.868 0.318 0.968 2e-63
195397527 385 GJ16375 [Drosophila virilis] gi|19414714 0.868 0.327 0.968 2e-63
>gi|328713589|ref|XP_001950003.2| PREDICTED: inhibitory POU protein-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 122/126 (96%), Positives = 123/126 (97%)

Query: 12  RVLFTGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAE 71
           R +  GVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAE
Sbjct: 280 RRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAE 339

Query: 72  AQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL 131
           AQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL
Sbjct: 340 AQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL 399

Query: 132 KKNVVR 137
           KKNVVR
Sbjct: 400 KKNVVR 405

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195060344|ref|XP_001995785.1| GH17948 [Drosophila grimshawi] gi|193896571|gb|EDV95437.1| GH17948 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|242017557|ref|XP_002429254.1| Inhibitory POU protein, putative [Pediculus humanus corporis] gi|212514150|gb|EEB16516.1| Inhibitory POU protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|198470029|ref|XP_002134478.1| GA26624 [Drosophila pseudoobscura pseudoobscura] gi|198147148|gb|EDY73105.1| GA26624 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|386764469|ref|NP_001245686.1| abnormal chemosensory jump 6, isoform K [Drosophila melanogaster] gi|383293412|gb|AFH07400.1| abnormal chemosensory jump 6, isoform K [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|386764467|ref|NP_001245685.1| abnormal chemosensory jump 6, isoform J [Drosophila melanogaster] gi|383293411|gb|AFH07399.1| abnormal chemosensory jump 6, isoform J [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|386764475|ref|NP_001245689.1| abnormal chemosensory jump 6, isoform N [Drosophila melanogaster] gi|383293415|gb|AFH07403.1| abnormal chemosensory jump 6, isoform N [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|386764465|ref|NP_001245684.1| abnormal chemosensory jump 6, isoform I [Drosophila melanogaster] gi|383293410|gb|AFH07398.1| abnormal chemosensory jump 6, isoform I [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|17864538|ref|NP_524876.1| abnormal chemosensory jump 6, isoform A [Drosophila melanogaster] gi|194894619|ref|XP_001978096.1| GG19406 [Drosophila erecta] gi|97536463|sp|P24350.3|IPOU_DROME RecName: Full=Inhibitory POU protein; Short=I-POU; AltName: Full=Abnormal chemosensory jump 6 protein gi|3599515|gb|AAC35369.1| POU domain transcription factor [Drosophila melanogaster] gi|22833164|gb|AAF48447.2| abnormal chemosensory jump 6, isoform A [Drosophila melanogaster] gi|190649745|gb|EDV47023.1| GG19406 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195397527|ref|XP_002057380.1| GJ16375 [Drosophila virilis] gi|194147147|gb|EDW62866.1| GJ16375 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
FB|FBgn0000028396 acj6 "abnormal chemosensory ju 0.834 0.305 0.900 3.1e-51
UNIPROTKB|Q01851419 POU4F1 "POU domain, class 4, t 0.813 0.281 0.760 4.6e-41
UNIPROTKB|I3LTT4266 POU4F1 "Uncharacterized protei 0.813 0.443 0.760 4.6e-41
MGI|MGI:102525421 Pou4f1 "POU domain, class 4, t 0.813 0.280 0.760 4.6e-41
RGD|620074128 Pou4f1 "POU class 4 homeobox 1 0.813 0.921 0.760 4.6e-41
ZFIN|ZDB-GENE-000523-2368 pou4f1 "POU domain, class 4, t 0.813 0.320 0.760 9.6e-41
UNIPROTKB|H9L0G4302 POU4F3 "Uncharacterized protei 0.813 0.390 0.743 1.2e-40
UNIPROTKB|Q91998341 BRN3 "Brain-specific homeobox/ 0.813 0.346 0.743 1.2e-40
ZFIN|ZDB-GENE-061215-70343 zgc:158291 "zgc:158291" [Danio 0.813 0.344 0.743 1.2e-40
ZFIN|ZDB-GENE-990415-24361 pou4f3 "POU domain, class 4, t 0.813 0.326 0.735 2.6e-40
FB|FBgn0000028 acj6 "abnormal chemosensory jump 6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 532 (192.3 bits), Expect = 3.1e-51, P = 3.1e-51
 Identities = 109/121 (90%), Positives = 109/121 (90%)

Query:    17 GVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPIXXXXXXXXXXXXKN 76
             GVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPI            KN
Sbjct:   245 GVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKN 304

Query:    77 KRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVV 136
             KRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVV
Sbjct:   305 KRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVV 364

Query:   137 R 137
             R
Sbjct:   365 R 365
GO:0007636 "chemosensory jump behavior" evidence=IMP
GO:0003714 "transcription corepressor activity" evidence=IGI;IPI
GO:0005634 "nucleus" evidence=ISS;NAS
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS
GO:0008039 "synaptic target recognition" evidence=IMP
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0048813 "dendrite morphogenesis" evidence=IMP;TAS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0007411 "axon guidance" evidence=IMP
GO:0070983 "dendrite guidance" evidence=IMP
GO:0050911 "detection of chemical stimulus involved in sensory perception of smell" evidence=IDA
UNIPROTKB|Q01851 POU4F1 "POU domain, class 4, transcription factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LTT4 POU4F1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:102525 Pou4f1 "POU domain, class 4, transcription factor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620074 Pou4f1 "POU class 4 homeobox 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000523-2 pou4f1 "POU domain, class 4, transcription factor 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H9L0G4 POU4F3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q91998 BRN3 "Brain-specific homeobox/POU domain protein 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061215-70 zgc:158291 "zgc:158291" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-24 pou4f3 "POU domain, class 4, transcription factor 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P17208PO4F1_MOUSENo assigned EC number0.80950.84820.2921yesN/A
P24350IPOU_DROMENo assigned EC number0.96820.86890.3181yesN/A
Q01851PO4F1_HUMANNo assigned EC number0.80950.84820.2935yesN/A
P20266PO4F1_RATNo assigned EC number0.80950.84820.9609noN/A
P55968PO4F1_CHICKNo assigned EC number0.83190.81.0noN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
smart0035275 smart00352, POU, Found in Pit-Oct-Unc transcriptio 6e-28
pfam0015775 pfam00157, Pou, Pou domain - N-terminal to homeobo 2e-22
pfam0004657 pfam00046, Homeobox, Homeobox domain 2e-08
smart0038957 smart00389, HOX, Homeodomain 5e-07
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 9e-06
>gnl|CDD|197673 smart00352, POU, Found in Pit-Oct-Unc transcription factors Back     alignment and domain information 
 Score = 97.9 bits (244), Expect = 6e-28
 Identities = 36/55 (65%), Positives = 39/55 (70%), Gaps = 3/55 (5%)

Query: 17 GVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAE 71
          G TQADVG AL  L  P   A SQ+TICRFE+L LS  NM  LKP+LQ WLEEAE
Sbjct: 24 GFTQADVGLALGALYGP---AFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEAE 75

Length = 75
>gnl|CDD|189427 pfam00157, Pou, Pou domain - N-terminal to homeobox domain Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 145
KOG3802|consensus398 100.0
KOG1168|consensus385 100.0
PF0015775 Pou: Pou domain - N-terminal to homeobox domain; I 100.0
smart0035275 POU Found in Pit-Oct-Unc transcription factors. 99.96
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.74
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.69
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.64
KOG0843|consensus197 99.63
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.61
KOG2251|consensus 228 99.58
KOG0484|consensus125 99.58
KOG0489|consensus261 99.52
KOG0488|consensus309 99.52
KOG0485|consensus 268 99.51
KOG0842|consensus 307 99.51
KOG0487|consensus308 99.5
KOG4577|consensus 383 99.5
COG5576156 Homeodomain-containing transcription factor [Trans 99.48
KOG0492|consensus246 99.45
KOG0850|consensus245 99.44
KOG0494|consensus 332 99.42
KOG0493|consensus342 99.35
KOG0844|consensus 408 99.28
KOG0848|consensus317 99.28
KOG0486|consensus 351 99.2
KOG0490|consensus 235 99.2
KOG0491|consensus194 99.18
KOG0483|consensus198 99.17
KOG0849|consensus 354 99.04
KOG0847|consensus288 98.94
KOG2252|consensus558 98.74
KOG0775|consensus304 98.61
KOG0774|consensus334 98.48
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.44
KOG0490|consensus235 98.42
KOG1146|consensus 1406 97.84
KOG3623|consensus 1007 97.27
PF1356064 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_ 96.35
KOG0773|consensus342 96.33
COG3620187 Predicted transcriptional regulator with C-termina 96.27
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.24
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 95.93
KOG3623|consensus 1007 95.14
TIGR0307058 couple_hipB transcriptional regulator, y4mF family 94.97
PF0138155 HTH_3: Helix-turn-helix; InterPro: IPR001387 This 94.52
TIGR03830127 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-he 94.42
PHA0197667 helix-turn-helix protein 93.72
TIGR02612150 mob_myst_A mobile mystery protein A. Members of th 93.31
PHA0054282 putative Cro-like protein 93.14
PF1284464 HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_ 93.0
PRK1007296 putative transcriptional regulator; Provisional 92.81
TIGR00270154 conserved hypothetical protein TIGR00270. 92.81
PF1374480 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_ 92.41
PRK0972688 antitoxin HipB; Provisional 91.82
PRK06424144 transcription factor; Provisional 91.31
PRK09706135 transcriptional repressor DicA; Reviewed 91.07
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 89.64
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 88.26
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 87.68
TIGR0260778 antidote_HigA addiction module antidote protein, H 86.85
COG147668 Predicted transcriptional regulators [Transcriptio 86.72
PRK08359176 transcription factor; Validated 86.01
PRK10856 331 cytoskeletal protein RodZ; Provisional 83.9
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 83.66
PF0131670 Arg_repressor: Arginine repressor, DNA binding dom 83.48
cd0009358 HTH_XRE Helix-turn-helix XRE-family like proteins. 83.4
PRK04140317 hypothetical protein; Provisional 83.39
PRK13890120 conjugal transfer protein TrbA; Provisional 83.31
PRK08154 309 anaerobic benzoate catabolism transcriptional regu 82.56
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 81.11
PF1066860 Phage_terminase: Phage terminase small subunit; In 80.05
>KOG3802|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.2e-69  Score=461.53  Aligned_cols=133  Identities=43%  Similarity=0.626  Sum_probs=123.4

Q ss_pred             hhhhhhhhcccchHHHHHHHhhccCCCCccchhhhhhhhhhcCCChHHHhhhhHHHHHHHHHHHHHhhcCCCCCCCCCCC
Q psy17899          8 DVYSRVLFTGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVL   87 (145)
Q Consensus         8 ~f~~rRi~LG~TQ~dVg~alg~l~~~g~~~fSQttIcRFE~L~LS~knm~klkPlL~kWL~eae~~~~~~~~~~~~~~~~   87 (145)
                      .||+|||+|||||+|||+|||++|  | ++||||||||||||||||||||||||||+|||+|||..+..+ ..++.+.+.
T Consensus       214 ~FKqRRIkLGfTQaDVGlALG~ly--G-n~FSQTTIcRFEALqLSFKNMCKLKPLL~KWLeEAes~~~~~-~~~~~e~i~  289 (398)
T KOG3802|consen  214 TFKQRRIKLGFTQADVGLALGALY--G-NVFSQTTICRFEALQLSFKNMCKLKPLLEKWLEEAESRESTG-SPNSIEKIG  289 (398)
T ss_pred             HHHhheeccccchhHHHHHHHhhh--C-cccchhhhhHhHhhccCHHHHhhhHHHHHHHHHHHhcccccC-CCCCHHHhh
Confidence            599999999999999999999999  7 799999999999999999999999999999999999864333 234445566


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHhhhcCCCCCHHHHHHHHhhcCCCCCccccccCccC
Q psy17899         88 PAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRPINGHTR  144 (145)
Q Consensus        88 ~~~rkrR~RTs~s~~q~~~Le~~F~~np~Ps~~e~~~LA~~l~L~~~vVrVWFqNrR  144 (145)
                      ..+|||||||||+..++.+||++|++||||+++||.+||++|+|++|||||||+|||
T Consensus       290 a~~RkRKKRTSie~~vr~aLE~~F~~npKPt~qEIt~iA~~L~leKEVVRVWFCNRR  346 (398)
T KOG3802|consen  290 AQSRKRKKRTSIEVNVRGALEKHFLKNPKPTSQEITHIAESLQLEKEVVRVWFCNRR  346 (398)
T ss_pred             ccccccccccceeHHHHHHHHHHHHhCCCCCHHHHHHHHHHhccccceEEEEeeccc
Confidence            677999999999999999999999999999999999999999999999999999998

>KOG1168|consensus Back     alignment and domain information
>PF00157 Pou: Pou domain - N-terminal to homeobox domain; InterPro: IPR000327 POU proteins are eukaryotic transcription factors containing a bipartite DNA binding domain referred to as the POU domain Back     alignment and domain information
>smart00352 POU Found in Pit-Oct-Unc transcription factors Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF13560 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>TIGR03070 couple_hipB transcriptional regulator, y4mF family Back     alignment and domain information
>PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) Back     alignment and domain information
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family Back     alignment and domain information
>PHA01976 helix-turn-helix protein Back     alignment and domain information
>TIGR02612 mob_myst_A mobile mystery protein A Back     alignment and domain information
>PHA00542 putative Cro-like protein Back     alignment and domain information
>PF12844 HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_A 2XIU_B 2GZU_B 2XJ3_A 1UTX_A 2XI8_B 3F6W_C 3EUS_B Back     alignment and domain information
>PRK10072 putative transcriptional regulator; Provisional Back     alignment and domain information
>TIGR00270 conserved hypothetical protein TIGR00270 Back     alignment and domain information
>PF13744 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_A Back     alignment and domain information
>PRK09726 antitoxin HipB; Provisional Back     alignment and domain information
>PRK06424 transcription factor; Provisional Back     alignment and domain information
>PRK09706 transcriptional repressor DicA; Reviewed Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>TIGR02607 antidote_HigA addiction module antidote protein, HigA family Back     alignment and domain information
>COG1476 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PRK08359 transcription factor; Validated Back     alignment and domain information
>PRK10856 cytoskeletal protein RodZ; Provisional Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF01316 Arg_repressor: Arginine repressor, DNA binding domain; InterPro: IPR020900 The arginine dihydrolase (AD) pathway is found in many prokaryotes and some primitive eukaryotes, an example of the latter being Giardia lamblia (Giardia intestinalis) [] Back     alignment and domain information
>cd00093 HTH_XRE Helix-turn-helix XRE-family like proteins Back     alignment and domain information
>PRK04140 hypothetical protein; Provisional Back     alignment and domain information
>PRK13890 conjugal transfer protein TrbA; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
2xsd_C164 Crystal Structure Of The Dimeric Oct-6 (Pou3f1) Pou 8e-16
1au7_A146 Pit-1 MutantDNA COMPLEX Length = 146 7e-13
3l1p_A155 Pou Protein:dna Complex Length = 155 7e-13
1o4x_A167 Ternary Complex Of The Dna Binding Domains Of The O 3e-12
1oct_C156 Crystal Structure Of The Oct-1 Pou Domain Bound To 5e-12
1cqt_A163 Crystal Structure Of A Ternary Complex Containing A 6e-12
1hf0_A159 Crystal Structure Of The Dna-Binding Domain Of Oct- 7e-12
1e3o_C160 Crystal Structure Of Oct-1 Pou Dimer Bound To More 1e-11
3d1n_I151 Structure Of Human Brn-5 Transcription Factor In Co 2e-08
1pou_A71 The Solution Structure Of The Oct-1 Pou-Specific Do 1e-05
1ocp_A67 Solution Structure Of Oct3 Pou-Homeodomain Length = 5e-05
>pdb|2XSD|C Chain C, Crystal Structure Of The Dimeric Oct-6 (Pou3f1) Pou Domain Bound To Palindromic More Dna Length = 164 Back     alignment and structure 
Iteration: 1

 Score = 79.0 bits (193), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 64/121 (52%), Gaps = 6/121 (4%)
Query: 17  GVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPIXXXXXXXXXXXXKN 76
           G TQADVG AL  L        SQ+TICRFE+L LS  NM  LKP+             +
Sbjct: 30  GFTQADVGLALGTLY---GNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGS 86
Query: 77  KRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVV 136
                +   +   G K++KRTSI    K +LE++F   P+PS  +I  +A+ L L+K VV
Sbjct: 87  P---TNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVV 143
Query: 137 R 137
           R
Sbjct: 144 R 144
>pdb|1AU7|A Chain A, Pit-1 MutantDNA COMPLEX Length = 146 Back     alignment and structure
>pdb|3L1P|A Chain A, Pou Protein:dna Complex Length = 155 Back     alignment and structure
>pdb|1O4X|A Chain A, Ternary Complex Of The Dna Binding Domains Of The Oct1 And Sox2 Transcription Factors With A 19mer Oligonucleotide From The Hoxb1 Regulatory Element Length = 167 Back     alignment and structure
>pdb|1OCT|C Chain C, Crystal Structure Of The Oct-1 Pou Domain Bound To An Octamer Site: Dna Recognition With Tethered Dna-Binding Modules Length = 156 Back     alignment and structure
>pdb|1CQT|A Chain A, Crystal Structure Of A Ternary Complex Containing An Oca-B Peptide, The Oct-1 Pou Domain, And An Octamer Element Length = 163 Back     alignment and structure
>pdb|1HF0|A Chain A, Crystal Structure Of The Dna-Binding Domain Of Oct-1 Bound To Dna As A Dimer Length = 159 Back     alignment and structure
>pdb|1E3O|C Chain C, Crystal Structure Of Oct-1 Pou Dimer Bound To More Length = 160 Back     alignment and structure
>pdb|3D1N|I Chain I, Structure Of Human Brn-5 Transcription Factor In Complex With Corticotrophin-Releasing Hormone Gene Promoter Length = 151 Back     alignment and structure
>pdb|1POU|A Chain A, The Solution Structure Of The Oct-1 Pou-Specific Domain Reveals A Striking Similarity To The Bacteriophage Lambda Repressor Dna-Binding Domain Length = 71 Back     alignment and structure
>pdb|1OCP|A Chain A, Solution Structure Of Oct3 Pou-Homeodomain Length = 67 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
1e3o_C160 Octamer-binding transcription factor 1; transcript 5e-39
2xsd_C164 POU domain, class 3, transcription factor 1; trans 3e-36
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-35
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-35
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 1e-32
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-10
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-09
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-08
2e19_A64 Transcription factor 8; homeobox domain, structura 7e-06
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-04
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
 Score =  128 bits (323), Expect = 5e-39
 Identities = 48/126 (38%), Positives = 70/126 (55%), Gaps = 8/126 (6%)

Query: 17  GVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKN 76
           G TQ DVG A+  L        SQ+TI RFE+L LS  NM  LKP+L+ WL +AEA   +
Sbjct: 24  GFTQGDVGLAMGKLYGN---DFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAEANLSS 80

Query: 77  KRR-----DPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL 131
                     ++P +     +++KRTSI    + +LE  F    +P+ E I  IAE+L++
Sbjct: 81  DSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFMENQKPTSEDITLIAEQLNM 140

Query: 132 KKNVVR 137
           +K V+R
Sbjct: 141 EKEVIR 146
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 100.0
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 100.0
2xsd_C164 POU domain, class 3, transcription factor 1; trans 100.0
3d1n_I151 POU domain, class 6, transcription factor 1; prote 100.0
1e3o_C160 Octamer-binding transcription factor 1; transcript 100.0
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.88
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.81
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.81
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.81
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.81
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.81
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.81
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.8
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.8
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.8
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.8
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.8
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.8
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.8
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.8
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.79
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.79
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.79
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.79
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.79
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.79
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.79
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.79
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.79
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.78
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.78
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.78
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.78
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.78
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.78
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.78
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.78
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.78
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.78
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.77
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.77
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.77
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.77
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.77
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.76
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.75
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.74
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.74
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.74
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.73
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.73
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.73
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.73
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.73
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.72
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.72
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.72
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.71
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.71
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.71
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.71
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.7
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.7
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.7
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.7
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.69
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.68
2e19_A64 Transcription factor 8; homeobox domain, structura 99.68
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.66
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.64
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.63
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.62
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.62
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.57
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.52
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.31
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.27
4ghj_A101 Probable transcriptional regulator; structural gen 96.45
3fmy_A73 HTH-type transcriptional regulator MQSA (YGIT/B302 96.11
4ich_A 311 Transcriptional regulator; structural genomics, PS 96.1
3qq6_A78 HTH-type transcriptional regulator SINR; helix-tur 96.01
3eus_A86 DNA-binding protein; structural genomics, PSI2,MCS 95.94
3kz3_A80 Repressor protein CI; five helix bundle, DNA-bindi 95.79
3s8q_A82 R-M controller protein; protein-DNA complex, helix 95.6
2wiu_B88 HTH-type transcriptional regulator HIPB; transfera 95.56
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-t 95.41
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 95.39
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1 95.37
2o38_A120 Hypothetical protein; alpha-beta, helix-turn-helix 95.31
1zug_A71 Phage 434 CRO protein; gene regulating protein, tr 95.27
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA bin 95.2
2l49_A99 C protein; P2 bacteriophage, P2 C, direct repeats, 95.17
2k9q_A77 Uncharacterized protein; all helix, helix-turn-hel 95.02
1adr_A76 P22 C2 repressor; transcription regulation; NMR {E 94.99
1lmb_392 Protein (lambda repressor); protein-DNA complex, d 94.99
3g5g_A99 Regulatory protein; transcriptional regulator, hel 94.95
2a6c_A83 Helix-turn-helix motif; putative transcriptional r 94.94
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, tra 94.93
3b7h_A78 Prophage LP1 protein 11; structural genomics, PSI2 94.86
3bd1_A79 CRO protein; transcription factor, helix-turn-heli 94.84
1r69_A69 Repressor protein CI; gene regulating protein; 2.0 94.79
3omt_A73 Uncharacterized protein; structural genomics, PSI- 94.73
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-t 94.71
1x57_A91 Endothelial differentiation-related factor 1; HMBF 94.66
2xi8_A66 Putative transcription regulator; HTH DNA-binding 94.64
3op9_A114 PLI0006 protein; structural genomics, PSI-2, prote 94.61
2ppx_A99 AGR_C_3184P, uncharacterized protein ATU1735; HTH- 94.56
2ewt_A71 BLDD, putative DNA-binding protein; the DNA-bindin 94.53
3t76_A88 VANU, transcriptional regulator vanug; structural 94.42
3mlf_A111 Transcriptional regulator; structural genomics, he 94.36
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 94.35
3bs3_A76 Putative DNA-binding protein; XRE-family, structur 94.16
3ivp_A126 Putative transposon-related DNA-binding protein; A 94.1
3vk0_A114 NHTF, transcriptional regulator; HTH motif, XRE tr 94.09
2kpj_A94 SOS-response transcriptional repressor, LEXA; NESG 94.06
2wus_R112 RODZ, putative uncharacterized protein; structural 93.68
3f52_A117 CLP gene regulator (CLGR); helix-turn-helix motif, 93.6
1b0n_A111 Protein (SINR protein); transcription regulator, a 93.52
3cec_A104 Putative antidote protein of plasmid maintenance; 93.48
2eby_A113 Putative HTH-type transcriptional regulator YBAQ; 93.25
3kxa_A141 NGO0477 protein, putative uncharacterized protein; 93.18
3fym_A130 Putative uncharacterized protein; HTH DNA binding, 93.1
3trb_A104 Virulence-associated protein I; mobIle and extrach 92.88
3lfp_A98 CSP231I C protein; transcriptional regulator, DNA 92.78
2jvl_A107 TRMBF1; coactivator, helix-turn-helix, Pro binding 92.77
2auw_A170 Hypothetical protein NE0471; alpha-beta structure, 92.7
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 91.87
1jhg_A101 Trp operon repressor; complex (regulatory protein- 91.63
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 91.55
2ict_A94 Antitoxin HIGA; helix-turn-helix, structural genom 91.11
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 89.41
2awi_A 317 PRGX; repressor, pheromone, DNA binding, regulator 88.82
3u3w_A 293 Transcriptional activator PLCR protein; ternary co 88.02
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 87.41
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 87.24
3bdn_A236 Lambda repressor; repressor, allostery; HET: DNA; 87.24
1rzs_A61 Antirepressor, regulatory protein CRO; helix-turn- 86.51
2p5t_A158 Putative transcriptional regulator PEZA; postsegre 86.28
2l1p_A83 DNA-binding protein SATB1; PSI-biology, NESG, stru 85.49
1iuf_A144 Centromere ABP1 protein; riken structural genomics 84.85
2qfc_A 293 PLCR protein; TPR, HTH, transcription regulation; 84.34
2ofy_A86 Putative XRE-family transcriptional regulator; tra 84.02
3pxp_A 292 Helix-turn-helix domain protein; DNA-binding, basi 83.82
1xwr_A97 Regulatory protein CII; all-alpha fold, DNA bindin 83.82
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 83.67
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 82.67
2pij_A67 Prophage PFL 6 CRO; transcription factor, helix-tu 80.58
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 80.47
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
Probab=100.00  E-value=2.9e-56  Score=339.40  Aligned_cols=132  Identities=40%  Similarity=0.572  Sum_probs=116.7

Q ss_pred             hhhhhhhhcccchHHHHHHHhhccCCCCccchhhhhhhhhhcCCChHHHhhhhHHHHHHHHHHHHHhhcCCCCCCCCCCC
Q psy17899          8 DVYSRVLFTGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVL   87 (145)
Q Consensus         8 ~f~~rRi~LG~TQ~dVg~alg~l~~~g~~~fSQttIcRFE~L~LS~knm~klkPlL~kWL~eae~~~~~~~~~~~~~~~~   87 (145)
                      .||+|||+|||||+|||+|||.+|  | ++||||||||||+|||||+|||||+|+|++||+|+|+.... ....+.+...
T Consensus        18 ~fk~~ri~lg~tq~~vg~al~~l~--G-~~~Sqtti~rfE~l~ls~~nm~kLkPlL~~Wl~eae~~~~~-~~~~~~~~~~   93 (155)
T 3l1p_A           18 LLKQKRITLGYTQADVGLTLGVLF--G-KVFSQTTISRFEALQLSLKNMSKLRPLLEKWVEEADNNENL-QEISKSETLV   93 (155)
T ss_dssp             HHHHHHHHTTCCHHHHHHHHHHHH--S-CCCCHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHHTTCHHH-HHSSCC---C
T ss_pred             HHHhhhheecccHHHHHHHHHhhc--C-cccccccccccccccCChhhHhhcchHHHHHhhhhhcccCc-cccccccccc
Confidence            699999999999999999999999  7 79999999999999999999999999999999999954221 1112222222


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHhhhcCCCCCHHHHHHHHhhcCCCCCccccccCccCC
Q psy17899         88 PAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRPINGHTRA  145 (145)
Q Consensus        88 ~~~rkrR~RTs~s~~q~~~Le~~F~~np~Ps~~e~~~LA~~l~L~~~vVrVWFqNrRa  145 (145)
                        +++||+||+|+..|+..||.+|..|+||+..++.+||.++||++.+|+||||||||
T Consensus        94 --~~~rr~Rt~ft~~Q~~~Le~~F~~~~yps~~~r~~LA~~l~L~~~qV~vWFqNRR~  149 (155)
T 3l1p_A           94 --QARKRKRTSIENRVRWSLETMFLKSPKPSLQQITHIANQLGLEKDVVRVWFSNRRQ  149 (155)
T ss_dssp             --CCSCCCCCCCCHHHHHHHHTTTTTCSCCCHHHHHHHHHHTTCCHHHHHHHHHHHHH
T ss_pred             --cCCCCCCcccCHHHHHHHHHHHccCCCCCHHHHHHHHHHcCCChhheeeccccccc
Confidence              57788999999999999999999999999999999999999999999999999995
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>4ghj_A Probable transcriptional regulator; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE; 1.75A {Vibrio vulnificus} Back     alignment and structure
>3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} Back     alignment and structure
>4ich_A Transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, transcription RE; 1.95A {Saccharomonospora viridis} Back     alignment and structure
>3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} Back     alignment and structure
>3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomic binding; 1.80A {Silicibacter pomeroyi} Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Back     alignment and structure
>3s8q_A R-M controller protein; protein-DNA complex, helix-turn-helix; HET: DNA; 2.10A {Enterobacter SP} SCOP: a.35.1.0 PDB: 3clc_A* 3ufd_A* Back     alignment and structure
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, serine kinase, DNA-bindin mercury derivative, repressor; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Back     alignment and structure
>2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Back     alignment and structure
>2o38_A Hypothetical protein; alpha-beta, helix-turn-helix, structural genomics, PSI-2, PR structure initiative; 1.83A {Rhodopseudomonas palustris} SCOP: a.35.1.13 Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Back     alignment and structure
>2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A Back     alignment and structure
>2k9q_A Uncharacterized protein; all helix, helix-turn-helix, plasmid, structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* Back     alignment and structure
>3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A Back     alignment and structure
>2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Back     alignment and structure
>3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3bd1_A CRO protein; transcription factor, helix-turn-helix, prophage, structural evolution, transcription; 1.40A {Xylella fastidiosa} Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Back     alignment and structure
>3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L Back     alignment and structure
>1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 Back     alignment and structure
>2xi8_A Putative transcription regulator; HTH DNA-binding motif; HET: GOL; 1.21A {Enterococcus faecalis} PDB: 2gzu_A 1utx_A* 2xj3_A 2xiu_A Back     alignment and structure
>3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} Back     alignment and structure
>2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 Back     alignment and structure
>2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor} Back     alignment and structure
>3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis} Back     alignment and structure
>3ivp_A Putative transposon-related DNA-binding protein; APC62618, clostridium diffic structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile} Back     alignment and structure
>3vk0_A NHTF, transcriptional regulator; HTH motif, XRE transcription factor, DNA binding protein; 1.88A {Neisseria meningitidis} Back     alignment and structure
>2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} Back     alignment and structure
>2wus_R RODZ, putative uncharacterized protein; structural protein, cell WALL morphogenesis, bacterial cytos bacterial actin; 2.90A {Thermotoga maritima} Back     alignment and structure
>3f52_A CLP gene regulator (CLGR); helix-turn-helix motif, transcriptional ACTI human pathogen, transcription activator; 1.75A {Corynebacterium glutamicum} PDB: 3f51_A Back     alignment and structure
>1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 PDB: 2yal_A Back     alignment and structure
>3cec_A Putative antidote protein of plasmid maintenance; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.60A {Nostoc punctiforme} Back     alignment and structure
>2eby_A Putative HTH-type transcriptional regulator YBAQ; hypothetical protein, JW0472, structural genomics, NPPSFA; 2.25A {Escherichia coli} Back     alignment and structure
>3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3fym_A Putative uncharacterized protein; HTH DNA binding, DNA binding protein; 1.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3trb_A Virulence-associated protein I; mobIle and extrachromosomal element functions, DNA binding P; 2.00A {Coxiella burnetii} Back     alignment and structure
>3lfp_A CSP231I C protein; transcriptional regulator, DNA binding protein, helix-turn-H restriction-modification, transcription; 2.00A {Citrobacter SP} PDB: 3lis_A Back     alignment and structure
>2jvl_A TRMBF1; coactivator, helix-turn-helix, Pro binding, transcription; NMR {Trichoderma reesei} Back     alignment and structure
>2auw_A Hypothetical protein NE0471; alpha-beta structure, structural genomics, PSI, protein STRU initiative; 1.85A {Nitrosomonas europaea} SCOP: a.35.1.10 d.331.1.1 Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>2ict_A Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein struct initiative, northeast structural genomics consortium, NESG; 1.63A {Escherichia coli} SCOP: a.35.1.3 PDB: 2icp_A Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>2awi_A PRGX; repressor, pheromone, DNA binding, regulatory domain, transcription; 2.25A {Enterococcus faecalis} SCOP: a.35.1.11 a.118.8.4 PDB: 2axv_A 2axu_A 2aw6_A 2axz_A 2grl_A 2grm_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} Back     alignment and structure
>1rzs_A Antirepressor, regulatory protein CRO; helix-turn-helix, DNA-binding protein, structural evolution, transcription; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>2p5t_A Putative transcriptional regulator PEZA; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2l1p_A DNA-binding protein SATB1; PSI-biology, NESG, structural genomics, protein structure in northeast structural genomics consortium; NMR {Homo sapiens} PDB: 3nzl_A* Back     alignment and structure
>1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ofy_A Putative XRE-family transcriptional regulator; transcription regulator, structural genomics, PS protein structure initiative; 1.70A {Rhodococcus SP} SCOP: a.35.1.3 Back     alignment and structure
>3pxp_A Helix-turn-helix domain protein; DNA-binding, basic helix-loop-helix motif, BHLH motif, lambd repressor-like DNA-binding fold; HET: MSE MYR; 2.30A {Chloroflexus aurantiacus} Back     alignment and structure
>1xwr_A Regulatory protein CII; all-alpha fold, DNA binding protein; 2.56A {Bacteriophage lambda} SCOP: a.35.1.9 PDB: 1zpq_A Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>2pij_A Prophage PFL 6 CRO; transcription factor, helix-turn-helix, structural evolution, transcription; 1.70A {Pseudomonas fluorescens} Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 145
d1au7a272 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [ 1e-23
d1e3oc275 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [Tax 3e-20
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-05
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-05
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 6e-05
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-04
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-04
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-04
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 3e-04
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 5e-04
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 5e-04
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 7e-04
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 7e-04
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 8e-04
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 0.001
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 0.001
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 0.002
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 0.002
>d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 72 Back     information, alignment and structure

class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: POU-specific domain
domain: Pit-1
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 85.2 bits (211), Expect = 1e-23
 Identities = 30/55 (54%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 17 GVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAE 71
          G TQ +VG+ALA +        SQ+TICRFE+L LS  N   LK IL  WLEEAE
Sbjct: 20 GYTQTNVGEALAAVHGS---EFSQTTICRFENLQLSFKNACKLKAILSKWLEEAE 71
>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
d1e3oc275 Oct-1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1au7a272 Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} 100.0
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.86
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.86
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.85
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.84
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.83
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.83
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.83
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.83
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.83
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.83
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.83
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.83
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.82
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.82
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.82
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.81
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.81
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.8
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.8
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.8
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.8
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.79
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.77
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.76
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.69
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.67
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.67
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.65
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.63
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.63
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.61
d2ppxa162 Uncharacterized protein Atu1735 {Agrobacterium tum 97.45
d1lmb3_87 lambda C1 repressor, DNA-binding domain {Bacteriop 96.32
d2auwa167 Hypothetical protein NE0471 C-terminal domain {Nit 96.2
d1b0na268 SinR repressor, DNA-binding domain {Bacillus subti 96.18
d1y7ya169 Restriction-modification controller protein C.AhdI 95.84
d1x57a178 Endothelial differentiation-related factor 1, EDF1 95.82
d2b5aa177 Regulatory protein C.BclI {Bacillus caldolyticus [ 95.45
d2o38a189 Hypothetical protein RPA3824 {Rhodopseudomonas pal 95.29
d2croa_65 cro 434 {Bacteriophage 434 [TaxId: 10712]} 95.03
d1utxa_66 Putative transcription regulator CylR2 {Enterococc 95.01
d2a6ca169 HTH-motif protein NE1354 {Nitrosomonas europaea [T 94.95
d1r69a_63 434 C1 repressor, DNA-binding domain {Bacteriophag 94.92
d2r1jl166 P22 C2 repressor, DNA-binding domain {Salmonella b 94.38
d1hlva166 DNA-binding domain of centromere binding protein B 93.93
d1y9qa179 Probable transcriptional regulator VC1968, N-termi 93.21
d1iufa178 Ars-binding protein 1, ABP1 {Fission yeast (Schizo 93.18
d2icta187 Antitoxin HigA {Escherichia coli [TaxId: 562]} 89.8
d2p5ka163 Arginine repressor (ArgR), N-terminal DNA-binding 85.06
d1aoya_78 Arginine repressor (ArgR), N-terminal DNA-binding 84.13
d1b4aa175 Arginine repressor (ArgR), N-terminal DNA-binding 82.75
d2ofya182 Putative transcriptional regulator RHA1_ro04071 {R 81.41
d1ku3a_61 Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 27 81.24
>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: POU-specific domain
domain: Oct-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.1e-42  Score=231.61  Aligned_cols=62  Identities=48%  Similarity=0.742  Sum_probs=59.6

Q ss_pred             chhhhhhhhcccchHHHHHHHhhccCCCCccchhhhhhhhhhcCCChHHHhhhhHHHHHHHHHHH
Q psy17899          7 PDVYSRVLFTGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAE   71 (145)
Q Consensus         7 ~~f~~rRi~LG~TQ~dVg~alg~l~~~g~~~fSQttIcRFE~L~LS~knm~klkPlL~kWL~eae   71 (145)
                      ..||+|||+|||||+|||.|||.+|  | ++||||||||||+|||||||||||||+|++||+|||
T Consensus        14 ~~fk~rRi~LG~TQ~dVG~al~~l~--g-~~~SQttIcRFE~l~LS~kn~~kLkP~L~~WL~eaE   75 (75)
T d1e3oc2          14 KTFKQRRIKLGFTQGDVGLAMGKLY--G-NDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAE   75 (75)
T ss_dssp             HHHHHHHHHTTCCHHHHHHHHHHHH--S-CCCCHHHHHHHHHTCSCHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHhccccHHHHHHHHHHHc--C-cchhHHHHHHHHHhccCHHHHHHHHHHHHHHHHhcC
Confidence            3699999999999999999999999  6 689999999999999999999999999999999986
>d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lmb3_ a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
>d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2icta1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p5ka1 a.4.5.3 (A:2-64) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1aoya_ a.4.5.3 (A:) Arginine repressor (ArgR), N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b4aa1 a.4.5.3 (A:4-78) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ofya1 a.35.1.3 (A:3-84) Putative transcriptional regulator RHA1_ro04071 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure