Psyllid ID: psy17959
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 790 | ||||||
| 242021264 | 423 | conserved hypothetical protein [Pediculu | 0.330 | 0.617 | 0.506 | 7e-67 | |
| 328783862 | 390 | PREDICTED: potassium channel subfamily K | 0.360 | 0.730 | 0.442 | 1e-59 | |
| 380018794 | 391 | PREDICTED: TWiK family of potassium chan | 0.362 | 0.731 | 0.437 | 2e-59 | |
| 19921794 | 395 | CG8713 [Drosophila melanogaster] gi|7304 | 0.316 | 0.632 | 0.460 | 7e-58 | |
| 195455186 | 388 | GK23078 [Drosophila willistoni] gi|19417 | 0.308 | 0.628 | 0.471 | 1e-57 | |
| 194863596 | 395 | GG23333 [Drosophila erecta] gi|190662385 | 0.316 | 0.632 | 0.460 | 1e-57 | |
| 195120762 | 401 | GI19352 [Drosophila mojavensis] gi|19390 | 0.324 | 0.638 | 0.457 | 1e-57 | |
| 195474594 | 395 | GE19175 [Drosophila yakuba] gi|194175677 | 0.316 | 0.632 | 0.460 | 1e-57 | |
| 195332345 | 395 | GM21006 [Drosophila sechellia] gi|194124 | 0.316 | 0.632 | 0.460 | 2e-57 | |
| 332024510 | 268 | Potassium channel subfamily K member 18 | 0.306 | 0.902 | 0.5 | 2e-57 |
| >gi|242021264|ref|XP_002431065.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212516299|gb|EEB18327.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 261 bits (668), Expect = 7e-67, Method: Compositional matrix adjust.
Identities = 151/298 (50%), Positives = 186/298 (62%), Gaps = 37/298 (12%)
Query: 331 AFLFSNIGIICLVIGYTIAGYGNVAPITFLGKITTIAYAIAGMPLFLLYLSNIGDILAKS 390
AFL+S I T GYGNVAP T GK+ TI YAI GMPLFLLYLSNIGDILAKS
Sbjct: 135 AFLYSLTVI-------TTIGYGNVAPRTEWGKLATIVYAIVGMPLFLLYLSNIGDILAKS 187
Query: 391 FKWIYAKCCLCRGCP-----TRPRDLQKTIQ-----DTTGAYNRRRSSAMNHNRRWNARN 440
FKW Y K CLC+GCP R + +++ I+ + ++RRR N W
Sbjct: 188 FKWSYTKVCLCKGCPGTESFRRRKRMKQNIKMSKMIKSQKDFSRRR----NRKTSWQPNV 243
Query: 441 GDSEYEDSDFDTSDEEYDSSEEEEEEEEDEEEEEEEEEEEEEEEEEEGEEEETETASSST 500
D D+ +E+ ++EE++ +DE +ETE + SS
Sbjct: 244 HD--------DSRNEKRKKIDDEEDDSDDESSSSNSSSGSSSGGNTSDTNKETEISQSSL 295
Query: 501 AKND--PQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIV 558
+ +D PQ VTVPITLCL IMVGY+ GGA+LF++WE+W LDGSYFCFISLSTIGFGDIV
Sbjct: 296 SIDDYDPQTVTVPITLCLAIMVGYVCGGALLFARWENWGFLDGSYFCFISLSTIGFGDIV 355
Query: 559 PGDKITGKNNDIGVQTLELSFILCAMYLMLGMALIAMCFNLMQEEVVHKMRTCSEVTQ 616
PGD I I Q +++SFIL A+YLMLGMALIAMCFNLMQEEV+HK R+C + Q
Sbjct: 356 PGDSI------IQSQVIQISFILTAVYLMLGMALIAMCFNLMQEEVIHKTRSCIKCCQ 407
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328783862|ref|XP_001120767.2| PREDICTED: potassium channel subfamily K member 18-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380018794|ref|XP_003693306.1| PREDICTED: TWiK family of potassium channels protein 18-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|19921794|ref|NP_610349.1| CG8713 [Drosophila melanogaster] gi|7304100|gb|AAF59138.1| CG8713 [Drosophila melanogaster] gi|17945478|gb|AAL48792.1| RE21922p [Drosophila melanogaster] gi|220948234|gb|ACL86660.1| CG8713-PA [synthetic construct] gi|220957472|gb|ACL91279.1| CG8713-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|195455186|ref|XP_002074600.1| GK23078 [Drosophila willistoni] gi|194170685|gb|EDW85586.1| GK23078 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|194863596|ref|XP_001970518.1| GG23333 [Drosophila erecta] gi|190662385|gb|EDV59577.1| GG23333 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195120762|ref|XP_002004890.1| GI19352 [Drosophila mojavensis] gi|193909958|gb|EDW08825.1| GI19352 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|195474594|ref|XP_002089576.1| GE19175 [Drosophila yakuba] gi|194175677|gb|EDW89288.1| GE19175 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|195332345|ref|XP_002032859.1| GM21006 [Drosophila sechellia] gi|194124829|gb|EDW46872.1| GM21006 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|332024510|gb|EGI64708.1| Potassium channel subfamily K member 18 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 790 | ||||||
| FB|FBgn0033257 | 395 | CG8713 [Drosophila melanogaste | 0.124 | 0.248 | 0.656 | 2.7e-61 | |
| FB|FBgn0035192 | 729 | CG9194 [Drosophila melanogaste | 0.135 | 0.146 | 0.699 | 4.3e-54 | |
| WB|WBGene00010784 | 372 | twk-48 [Caenorhabditis elegans | 0.143 | 0.303 | 0.436 | 9.2e-34 | |
| WB|WBGene00006690 | 676 | twk-39 [Caenorhabditis elegans | 0.116 | 0.136 | 0.54 | 1.3e-33 | |
| FB|FBgn0260971 | 1009 | CG42594 [Drosophila melanogast | 0.136 | 0.107 | 0.441 | 4.4e-29 | |
| FB|FBgn0027589 | 918 | CG1688 [Drosophila melanogaste | 0.121 | 0.104 | 0.407 | 2.2e-26 | |
| FB|FBgn0038621 | 389 | CG10864 [Drosophila melanogast | 0.167 | 0.339 | 0.387 | 1.1e-23 | |
| FB|FBgn0259242 | 484 | CG42340 [Drosophila melanogast | 0.125 | 0.204 | 0.370 | 6.2e-21 | |
| WB|WBGene00006318 | 329 | sup-9 [Caenorhabditis elegans | 0.192 | 0.462 | 0.345 | 7.6e-19 | |
| UNIPROTKB|O17185 | 329 | sup-9 "Two pore potassium chan | 0.192 | 0.462 | 0.345 | 7.6e-19 |
| FB|FBgn0033257 CG8713 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 378 (138.1 bits), Expect = 2.7e-61, Sum P(3) = 2.7e-61
Identities = 67/102 (65%), Positives = 86/102 (84%)
Query: 508 VTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIVPGDKITGKN 567
+TVP+T+C+ +MVGYI GA+LF +WEDWN LDGSYFC ISLS+IGFGD+VPGD++ +
Sbjct: 283 ITVPVTVCVFVMVGYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITAD 342
Query: 568 NDIGVQTLELSFILCAMYLMLGMALIAMCFNLMQEEVVHKMR 609
D +E+SFILCA+YL+LGMA+IAMCFNLMQE+VVH +R
Sbjct: 343 RD----KVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNIR 380
|
|
| FB|FBgn0035192 CG9194 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00010784 twk-48 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00006690 twk-39 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0260971 CG42594 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0027589 CG1688 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038621 CG10864 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0259242 CG42340 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00006318 sup-9 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O17185 sup-9 "Two pore potassium channel protein sup-9" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 790 | |||
| pfam07885 | 74 | pfam07885, Ion_trans_2, Ion channel | 1e-13 | |
| pfam07885 | 74 | pfam07885, Ion_trans_2, Ion channel | 3e-11 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 4e-11 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 5e-10 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 6e-10 | |
| pfam07885 | 74 | pfam07885, Ion_trans_2, Ion channel | 2e-09 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 9e-09 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 1e-08 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 1e-08 | |
| pfam07885 | 74 | pfam07885, Ion_trans_2, Ion channel | 3e-08 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 3e-08 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 9e-08 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 1e-07 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 1e-07 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 2e-07 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 2e-07 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 3e-07 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 3e-07 | |
| pfam03247 | 106 | pfam03247, Prothymosin, Prothymosin/parathymosin f | 3e-07 | |
| pfam12253 | 76 | pfam12253, CAF1A, Chromatin assembly factor 1 subu | 3e-07 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 3e-07 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 4e-07 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 4e-07 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 5e-07 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 5e-07 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 5e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 6e-07 | |
| pfam07885 | 74 | pfam07885, Ion_trans_2, Ion channel | 7e-07 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 8e-07 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 9e-07 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-06 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 1e-06 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 1e-06 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 1e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 1e-06 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 1e-06 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 2e-06 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 2e-06 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 2e-06 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 2e-06 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 2e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 3e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 3e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 3e-06 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 3e-06 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 4e-06 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 4e-06 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 4e-06 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 4e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 4e-06 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 4e-06 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 4e-06 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 5e-06 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 5e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 6e-06 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 7e-06 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 7e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 8e-06 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 8e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 9e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 9e-06 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 9e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-05 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 1e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 1e-05 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 1e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 1e-05 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 1e-05 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 1e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 2e-05 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 2e-05 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 2e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 2e-05 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 2e-05 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 2e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 2e-05 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 2e-05 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 2e-05 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 3e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 3e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 3e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 3e-05 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 3e-05 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 3e-05 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 3e-05 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 3e-05 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 3e-05 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 3e-05 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 3e-05 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 3e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 3e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 4e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 4e-05 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 4e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 4e-05 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 4e-05 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 4e-05 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 4e-05 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 4e-05 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 4e-05 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 5e-05 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 5e-05 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 5e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 5e-05 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 5e-05 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 5e-05 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 5e-05 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 6e-05 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 6e-05 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 6e-05 | |
| pfam05432 | 291 | pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | 6e-05 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 6e-05 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 7e-05 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 7e-05 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 7e-05 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 7e-05 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 7e-05 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 7e-05 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 8e-05 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 8e-05 | |
| pfam05432 | 291 | pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | 8e-05 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 8e-05 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 8e-05 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 8e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 9e-05 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 9e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 9e-05 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 1e-04 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 1e-04 | |
| pfam03247 | 106 | pfam03247, Prothymosin, Prothymosin/parathymosin f | 1e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 1e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 1e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 1e-04 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 1e-04 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 1e-04 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 1e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 1e-04 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 1e-04 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 1e-04 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 1e-04 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 1e-04 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 1e-04 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 1e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 1e-04 | |
| pfam05432 | 291 | pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | 1e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 1e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-04 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 1e-04 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 1e-04 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-04 | |
| pfam06390 | 261 | pfam06390, NESP55, Neuroendocrine-specific golgi p | 1e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-04 | |
| pfam03247 | 106 | pfam03247, Prothymosin, Prothymosin/parathymosin f | 2e-04 | |
| pfam12253 | 76 | pfam12253, CAF1A, Chromatin assembly factor 1 subu | 2e-04 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 2e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 2e-04 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 2e-04 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 2e-04 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 2e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 2e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 2e-04 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 2e-04 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 2e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 2e-04 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 2e-04 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 2e-04 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 2e-04 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 2e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 2e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 2e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-04 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 2e-04 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-04 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-04 | |
| pfam12619 | 145 | pfam12619, MCM2_N, Mini-chromosome maintenance pro | 2e-04 | |
| pfam04774 | 106 | pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi | 2e-04 | |
| COG5414 | 392 | COG5414, COG5414, TATA-binding protein-associated | 2e-04 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 3e-04 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 3e-04 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 3e-04 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 3e-04 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 3e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 3e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 3e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 3e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 3e-04 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 3e-04 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 3e-04 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 3e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 3e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 3e-04 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 3e-04 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 3e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 3e-04 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 3e-04 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 3e-04 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 3e-04 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 3e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 3e-04 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 3e-04 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 3e-04 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 3e-04 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 3e-04 | |
| COG5414 | 392 | COG5414, COG5414, TATA-binding protein-associated | 3e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 3e-04 | |
| COG5167 | 776 | COG5167, VID27, Protein involved in vacuole import | 3e-04 | |
| COG5238 | 388 | COG5238, RNA1, Ran GTPase-activating protein (RanG | 3e-04 | |
| PLN00152 | 130 | PLN00152, PLN00152, DNA-directed RNA polymerase; P | 3e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 4e-04 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 4e-04 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 4e-04 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 4e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 4e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 4e-04 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 4e-04 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 4e-04 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 4e-04 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 4e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 4e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 4e-04 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 4e-04 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 4e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 4e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 4e-04 | |
| pfam05432 | 291 | pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | 4e-04 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 4e-04 | |
| pfam04774 | 106 | pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi | 4e-04 | |
| PRK02363 | 129 | PRK02363, PRK02363, DNA-directed RNA polymerase su | 4e-04 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 4e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 4e-04 | |
| COG3343 | 175 | COG3343, RpoE, DNA-directed RNA polymerase, delta | 4e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 5e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 5e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 5e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 5e-04 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 5e-04 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 5e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 5e-04 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 5e-04 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 5e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 5e-04 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 5e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 5e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 5e-04 | |
| pfam01056 | 329 | pfam01056, Myc_N, Myc amino-terminal region | 5e-04 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 6e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 6e-04 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 6e-04 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 6e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-04 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 6e-04 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 6e-04 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 6e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 6e-04 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 6e-04 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 6e-04 | |
| pfam09747 | 178 | pfam09747, DUF2052, Coiled-coil domain containing | 6e-04 | |
| pfam06991 | 277 | pfam06991, Prp19_bind, Splicing factor, Prp19-bind | 6e-04 | |
| pfam11708 | 236 | pfam11708, Slu7, Pre-mRNA splicing Prp18-interacti | 6e-04 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 7e-04 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 7e-04 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 7e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 7e-04 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 7e-04 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 7e-04 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 7e-04 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 7e-04 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 7e-04 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 7e-04 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 7e-04 | |
| pfam04774 | 106 | pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi | 7e-04 | |
| smart00784 | 106 | smart00784, SPT2, SPT2 chromatin protein | 7e-04 | |
| pfam11942 | 92 | pfam11942, Spt5_N, Spt5 transcription elongation f | 7e-04 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 8e-04 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 8e-04 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 8e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 8e-04 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 9e-04 | |
| pfam09747 | 178 | pfam09747, DUF2052, Coiled-coil domain containing | 9e-04 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.001 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.001 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 0.001 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 0.001 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 0.001 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 0.001 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 0.001 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 0.001 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.001 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 0.001 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 0.001 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 0.001 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 0.001 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 0.001 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 0.001 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 0.001 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 0.001 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 0.001 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.001 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 0.001 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.001 | |
| COG5414 | 392 | COG5414, COG5414, TATA-binding protein-associated | 0.001 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.001 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.001 | |
| pfam06991 | 277 | pfam06991, Prp19_bind, Splicing factor, Prp19-bind | 0.001 | |
| pfam11942 | 92 | pfam11942, Spt5_N, Spt5 transcription elongation f | 0.001 | |
| pfam11942 | 92 | pfam11942, Spt5_N, Spt5 transcription elongation f | 0.001 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 0.001 | |
| COG1614 | 470 | COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas | 0.001 | |
| pfam05178 | 99 | pfam05178, Kri1, KRI1-like family | 0.001 | |
| pfam05320 | 167 | pfam05320, Pox_RNA_Pol_19, Poxvirus DNA-directed R | 0.001 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 0.001 | |
| pfam00428 | 88 | pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro | 0.001 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 0.001 | |
| pfam03032 | 46 | pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ | 0.001 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 0.002 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.002 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 0.002 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 0.002 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 0.002 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 0.002 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 0.002 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 0.002 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.002 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.002 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 0.002 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 0.002 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.002 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 0.002 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 0.002 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 0.002 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.002 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.002 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 0.002 | |
| cd05832 | 106 | cd05832, Ribosomal_L12p, Ribosomal protein L12p | 0.002 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 0.002 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 0.002 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.002 | |
| COG2058 | 109 | COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP | 0.002 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 0.002 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 0.002 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 0.002 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 0.002 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 0.002 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 0.002 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 0.002 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.002 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.002 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.002 | |
| COG5238 | 388 | COG5238, RNA1, Ran GTPase-activating protein (RanG | 0.002 | |
| pfam09747 | 178 | pfam09747, DUF2052, Coiled-coil domain containing | 0.002 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 0.002 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 0.002 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 0.002 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 0.002 | |
| PRK05657 | 325 | PRK05657, PRK05657, RNA polymerase sigma factor Rp | 0.002 | |
| pfam07222 | 243 | pfam07222, PBP_sp32, Proacrosin binding protein sp | 0.002 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.002 | |
| pfam06524 | 314 | pfam06524, NOA36, NOA36 protein | 0.002 | |
| pfam09538 | 104 | pfam09538, FYDLN_acid, Protein of unknown function | 0.002 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.002 | |
| pfam03286 | 198 | pfam03286, Pox_Ag35, Pox virus Ag35 surface protei | 0.002 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.003 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 0.003 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 0.003 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 0.003 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 0.003 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.003 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 0.003 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 0.003 | |
| pfam04874 | 97 | pfam04874, Mak16, Mak16 protein C-terminal region | 0.003 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 0.003 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.003 | |
| pfam05432 | 291 | pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | 0.003 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.003 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 0.003 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 0.003 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 0.003 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 0.003 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 0.003 | |
| pfam06390 | 261 | pfam06390, NESP55, Neuroendocrine-specific golgi p | 0.003 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.003 | |
| pfam12619 | 145 | pfam12619, MCM2_N, Mini-chromosome maintenance pro | 0.003 | |
| COG5414 | 392 | COG5414, COG5414, TATA-binding protein-associated | 0.003 | |
| COG3343 | 175 | COG3343, RpoE, DNA-directed RNA polymerase, delta | 0.003 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 0.003 | |
| COG1614 | 470 | COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas | 0.003 | |
| pfam03032 | 46 | pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ | 0.003 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 0.003 | |
| pfam05395 | 170 | pfam05395, DARPP-32, Protein phosphatase inhibitor | 0.003 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 0.003 | |
| TIGR02907 | 338 | TIGR02907, spore_VI_D, stage VI sporulation protei | 0.003 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.003 | |
| pfam13422 | 99 | pfam13422, DUF4110, Domain of unknown function (DU | 0.003 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.004 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 0.004 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 0.004 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 0.004 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 0.004 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 0.004 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 0.004 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.004 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.004 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 0.004 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 0.004 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 0.004 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.004 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 0.004 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 0.004 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 0.004 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.004 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.004 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 0.004 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.004 | |
| pfam02029 | 431 | pfam02029, Caldesmon, Caldesmon | 0.004 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 0.004 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 0.004 | |
| COG5414 | 392 | COG5414, COG5414, TATA-binding protein-associated | 0.004 | |
| PRK02363 | 129 | PRK02363, PRK02363, DNA-directed RNA polymerase su | 0.004 | |
| COG3343 | 175 | COG3343, RpoE, DNA-directed RNA polymerase, delta | 0.004 | |
| pfam05320 | 167 | pfam05320, Pox_RNA_Pol_19, Poxvirus DNA-directed R | 0.004 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 0.004 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 0.004 | |
| pfam03032 | 46 | pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ | 0.004 | |
| pfam03032 | 46 | pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ | 0.004 | |
| PRK05657 | 325 | PRK05657, PRK05657, RNA polymerase sigma factor Rp | 0.004 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.004 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 0.004 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 0.004 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 0.004 |
| >gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel | Back alignment and domain information |
|---|
Score = 66.5 bits (163), Expect = 1e-13
Identities = 28/86 (32%), Positives = 41/86 (47%), Gaps = 15/86 (17%)
Query: 107 FLVISYIIGGAFLFSHWE---PWGFPDSAYFCFITLTTIGFGDFVPAQKSTDVQTAEETA 163
L++ +I G +S E W F D+ YF F+TLTTIG+GD VP T
Sbjct: 1 ILLLLVLIFGTVYYSLEEEGWGWDFLDALYFSFVTLTTIGYGDIVP-----------LTD 49
Query: 164 ELRIALCSLYLLFGIALLAMSFNLVQ 189
R+ +Y+L GI L + ++
Sbjct: 50 AGRL-FTIIYILIGIPLFLLFLAVLG 74
|
This family includes the two membrane helix type ion channels found in bacteria. Length = 74 |
| >gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family | Back alignment and domain information |
|---|
| >gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|115071 pfam06390, NESP55, Neuroendocrine-specific golgi protein P55 (NESP55) | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family | Back alignment and domain information |
|---|
| >gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221668 pfam12619, MCM2_N, Mini-chromosome maintenance protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family | Back alignment and domain information |
|---|
| >gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|177755 PLN00152, PLN00152, DNA-directed RNA polymerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family | Back alignment and domain information |
|---|
| >gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|225880 COG3343, RpoE, DNA-directed RNA polymerase, delta subunit [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|216269 pfam01056, Myc_N, Myc amino-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) | Back alignment and domain information |
|---|
| >gnl|CDD|219256 pfam06991, Prp19_bind, Splicing factor, Prp19-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|221177 pfam11708, Slu7, Pre-mRNA splicing Prp18-interacting factor | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family | Back alignment and domain information |
|---|
| >gnl|CDD|214818 smart00784, SPT2, SPT2 chromatin protein | Back alignment and domain information |
|---|
| >gnl|CDD|221333 pfam11942, Spt5_N, Spt5 transcription elongation factor, acidic N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|219256 pfam06991, Prp19_bind, Splicing factor, Prp19-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|221333 pfam11942, Spt5_N, Spt5 transcription elongation factor, acidic N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|221333 pfam11942, Spt5_N, Spt5 transcription elongation factor, acidic N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|218482 pfam05178, Kri1, KRI1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218555 pfam05320, Pox_RNA_Pol_19, Poxvirus DNA-directed RNA polymerase 19 kDa subunit | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|148682 pfam07222, PBP_sp32, Proacrosin binding protein sp32 | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|115196 pfam06524, NOA36, NOA36 protein | Back alignment and domain information |
|---|
| >gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|217476 pfam03286, Pox_Ag35, Pox virus Ag35 surface protein | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|115071 pfam06390, NESP55, Neuroendocrine-specific golgi protein P55 (NESP55) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221668 pfam12619, MCM2_N, Mini-chromosome maintenance protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|225880 COG3343, RpoE, DNA-directed RNA polymerase, delta subunit [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|218576 pfam05395, DARPP-32, Protein phosphatase inhibitor 1/DARPP-32 | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234055 TIGR02907, spore_VI_D, stage VI sporulation protein D | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222117 pfam13422, DUF4110, Domain of unknown function (DUF4110) | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|225880 COG3343, RpoE, DNA-directed RNA polymerase, delta subunit [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|218555 pfam05320, Pox_RNA_Pol_19, Poxvirus DNA-directed RNA polymerase 19 kDa subunit | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family | Back alignment and domain information |
|---|
| >gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family | Back alignment and domain information |
|---|
| >gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 790 | |||
| KOG4404|consensus | 350 | 100.0 | ||
| KOG4404|consensus | 350 | 100.0 | ||
| KOG1418|consensus | 433 | 99.94 | ||
| KOG1418|consensus | 433 | 99.93 | ||
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 99.47 | |
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 99.38 | |
| KOG3713|consensus | 477 | 99.21 | ||
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 99.09 | |
| KOG3713|consensus | 477 | 99.02 | ||
| KOG1419|consensus | 654 | 98.82 | ||
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 98.76 | |
| KOG1420|consensus | 1103 | 98.74 | ||
| KOG1545|consensus | 507 | 98.71 | ||
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 98.65 | |
| KOG1545|consensus | 507 | 98.62 | ||
| KOG1419|consensus | 654 | 98.59 | ||
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 98.48 | |
| KOG4390|consensus | 632 | 98.26 | ||
| KOG3193|consensus | 1087 | 98.16 | ||
| KOG1420|consensus | 1103 | 98.14 | ||
| KOG4390|consensus | 632 | 97.98 | ||
| KOG0498|consensus | 727 | 97.92 | ||
| KOG3684|consensus | 489 | 97.77 | ||
| KOG3684|consensus | 489 | 97.72 | ||
| KOG0498|consensus | 727 | 97.67 | ||
| PF01007 | 336 | IRK: Inward rectifier potassium channel; InterPro: | 97.36 | |
| KOG0501|consensus | 971 | 97.09 | ||
| KOG3193|consensus | 1087 | 96.55 | ||
| KOG0501|consensus | 971 | 96.5 | ||
| PF01007 | 336 | IRK: Inward rectifier potassium channel; InterPro: | 95.95 | |
| TIGR00933 | 390 | 2a38 potassium uptake protein, TrkH family. The pr | 91.8 | |
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 91.61 | |
| KOG0500|consensus | 536 | 91.49 | ||
| KOG0500|consensus | 536 | 89.8 | ||
| KOG3827|consensus | 400 | 89.47 | ||
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 88.51 | |
| PRK10750 | 483 | potassium transporter; Provisional | 84.44 | |
| KOG0499|consensus | 815 | 82.31 | ||
| KOG3827|consensus | 400 | 81.62 |
| >KOG4404|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.9e-37 Score=315.55 Aligned_cols=239 Identities=27% Similarity=0.437 Sum_probs=175.6
Q ss_pred HHHHHHHHHHHhhccceeeeccccccccCCCCCccccchhhc-----hhchHHHHHHHHHhh-----hhhhccccceeee
Q psy17959 273 TLCLMIMVGYIYGGAVLFSKWEDWNILDGSRSSSRSRSRQQT-----ERSFTEKCKDYLRQF-----LAFLFSNIGIICL 342 (790)
Q Consensus 273 ~~~~~~~v~y~~~Ga~iF~~~E~~~~~~~~~~~~~~~~~~~~-----~~~~~e~~~~~~~~~-----~~~~f~~~~~~~~ 342 (790)
..+++..+.|+++||+||.++|.++|.++++.-..+..+... +.++.+..--+.+.- ..|.|..+++|..
T Consensus 10 l~Livct~tYLLvGAaVFdaLEse~E~~~r~~l~~~~~~~~~kyn~s~~d~r~~er~i~~s~ph~ag~qWkF~GaFYFa~ 89 (350)
T KOG4404|consen 10 LLLIVCTFTYLLVGAAVFDALESENEARERERLERRLANLKRKYNLSEEDYRELERVILKSEPHKAGPQWKFAGAFYFAT 89 (350)
T ss_pred HHHHHHHHHHHHHHHHHHHHhcCcchHHHHHHHHHHHHHHHHhhCCCHHHHHHHHHHHHhcCccccccccccCcceEEEE
Confidence 344455677999999999999999888875433333332222 222222211111111 2399998887765
Q ss_pred EEEEEeecccccccccCCcceehhhHHHHhHHHHHHHHHHhhHHHHHHhHHHHhhccccccCCCCCccccchhccccccc
Q psy17959 343 VIGYTIAGYGNVAPITFLGKITTIAYAIAGMPLFLLYLSNIGDILAKSFKWIYAKCCLCRGCPTRPRDLQKTIQDTTGAY 422 (790)
Q Consensus 343 ~~~~ttiGyg~~~p~t~~g~~~~i~y~~~gipl~~~~~~~~g~~l~~~~~~~~~~~~~~~~~~~~~~~~~k~i~~~~~~~ 422 (790)
|++||||||+.+|.|.+||+|||+||++|||+.++.+..+|+.+...+..+.+++.++.+
T Consensus 90 -TVItTIGyGhstP~T~~GK~Fcm~Yal~Gipl~lvmFqs~gERlnt~~ayil~~~r~~~~------------------- 149 (350)
T KOG4404|consen 90 -TVITTIGYGHSTPSTDGGKAFCMFYALVGIPLTLVMFQSIGERLNTFVAYILRRCRRRLG------------------- 149 (350)
T ss_pred -EEEeeeccCCCCCCCcCceehhhhHHHhcCchHHHHHHHHHHHHHHHHHHHHHHHHHHhc-------------------
Confidence 777999999999999999999999999999999999999999999999887655332211
Q ss_pred cccccccccccccccccCCCCCccCCCCCCCccccCCchhhhhhhchhhhhhhhhhhhhhHhhhhcccccccccCCCCCC
Q psy17959 423 NRRRSSAMNHNRRWNARNGDSEYEDSDFDTSDEEYDSSEEEEEEEEDEEEEEEEEEEEEEEEEEEGEEEETETASSSTAK 502 (790)
Q Consensus 423 ~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~ee~~~~~e~e~e~~~e~ee~~e~e~e~~ee~~~~~~~s~~~~ 502 (790)
.+.+.. +
T Consensus 150 ----------~r~~~~----S----------------------------------------------------------- 156 (350)
T KOG4404|consen 150 ----------RRRWDV----S----------------------------------------------------------- 156 (350)
T ss_pred ----------cccCCC----c-----------------------------------------------------------
Confidence 000100 0
Q ss_pred CCCceeeehHHHHHHHHHHhhhhhceeeecccccCcccceeEEEEeecccccCCCccCCCcCCCCCCcccchhhhHHHHH
Q psy17959 503 NDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIVPGDKITGKNNDIGVQTLELSFILC 582 (790)
Q Consensus 503 ~~~~~~~~~~~~~l~~~~~~i~~ga~~f~~~e~w~~~da~Yf~~itltTIGfGD~~P~~~~~~~~~~~~~~~~~~~~~~~ 582 (790)
..-.+.+.+...++.++.||++|+..|+|+|+||+||||||+|||||||+|+.++... -+..+.|..+.
T Consensus 157 -----~~~l~~i~~~~~~~~i~~gaa~fs~~E~Wsyfds~YyCFITltTIGFGDyValQ~~~a------lq~qplYv~~s 225 (350)
T KOG4404|consen 157 -----VYNLVLILFTACILLICCGAAMFSSVEGWSYFDSYYYCFITLTTIGFGDYVALQQDAA------LQSQPLYVFFS 225 (350)
T ss_pred -----HHHHHHHHHHHHHHHHHhhHHHhhcccCcchhhhhheeeeeeeeccccchhhhcchhh------hhCCCceehHh
Confidence 0013455556667789999999999999999999999999999999999999866322 24556788999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHH
Q psy17959 583 AMYLMLGMALIAMCFNLMQEEVVHKMRTCSEVT 615 (790)
Q Consensus 583 ~~~il~Gl~~~~~~~~~~~~~~~~~~~~~~~~~ 615 (790)
++||++|+++++.++|++.-.+.....+..++.
T Consensus 226 f~fIL~Gl~vi~a~~NllvLrf~t~~~~~~rr~ 258 (350)
T KOG4404|consen 226 FVFILLGLCVIYALLNLLVLRFMTMNAEDERRD 258 (350)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHH
Confidence 999999999999999998877666544444433
|
|
| >KOG4404|consensus | Back alignment and domain information |
|---|
| >KOG1418|consensus | Back alignment and domain information |
|---|
| >KOG1418|consensus | Back alignment and domain information |
|---|
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
| >KOG3713|consensus | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG3713|consensus | Back alignment and domain information |
|---|
| >KOG1419|consensus | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG1420|consensus | Back alignment and domain information |
|---|
| >KOG1545|consensus | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG1545|consensus | Back alignment and domain information |
|---|
| >KOG1419|consensus | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG4390|consensus | Back alignment and domain information |
|---|
| >KOG3193|consensus | Back alignment and domain information |
|---|
| >KOG1420|consensus | Back alignment and domain information |
|---|
| >KOG4390|consensus | Back alignment and domain information |
|---|
| >KOG0498|consensus | Back alignment and domain information |
|---|
| >KOG3684|consensus | Back alignment and domain information |
|---|
| >KOG3684|consensus | Back alignment and domain information |
|---|
| >KOG0498|consensus | Back alignment and domain information |
|---|
| >PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG0501|consensus | Back alignment and domain information |
|---|
| >KOG3193|consensus | Back alignment and domain information |
|---|
| >KOG0501|consensus | Back alignment and domain information |
|---|
| >PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >TIGR00933 2a38 potassium uptake protein, TrkH family | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >KOG0500|consensus | Back alignment and domain information |
|---|
| >KOG0500|consensus | Back alignment and domain information |
|---|
| >KOG3827|consensus | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >PRK10750 potassium transporter; Provisional | Back alignment and domain information |
|---|
| >KOG0499|consensus | Back alignment and domain information |
|---|
| >KOG3827|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 790 | ||||
| 3um7_A | 309 | Crystal Structure Of The Human Two Pore Domain K+ I | 1e-11 | ||
| 3ukm_A | 280 | Crystal Structure Of The Human Two Pore Domain Pota | 6e-10 | ||
| 3ukm_A | 280 | Crystal Structure Of The Human Two Pore Domain Pota | 3e-07 | ||
| 3ukm_A | 280 | Crystal Structure Of The Human Two Pore Domain Pota | 5e-05 | ||
| 4h33_A | 137 | Crystal Structure Of A Voltage-gated K+ Channel Por | 7e-04 |
| >pdb|3UM7|A Chain A, Crystal Structure Of The Human Two Pore Domain K+ Ion Channel Traak (K2p4.1) Length = 309 | Back alignment and structure |
|
| >pdb|3UKM|A Chain A, Crystal Structure Of The Human Two Pore Domain Potassium Ion Channel K2p1 (Twik-1) Length = 280 | Back alignment and structure |
| >pdb|3UKM|A Chain A, Crystal Structure Of The Human Two Pore Domain Potassium Ion Channel K2p1 (Twik-1) Length = 280 | Back alignment and structure |
| >pdb|3UKM|A Chain A, Crystal Structure Of The Human Two Pore Domain Potassium Ion Channel K2p1 (Twik-1) Length = 280 | Back alignment and structure |
| >pdb|4H33|A Chain A, Crystal Structure Of A Voltage-gated K+ Channel Pore Module In A Closed State In Lipid Membranes, Tetragonal Crystal Form Length = 137 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 790 | |||
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.97 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 99.97 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.96 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 99.96 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 99.67 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 99.66 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 99.63 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 99.62 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 99.61 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 99.57 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 99.57 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 99.56 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 99.56 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 99.55 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 99.55 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 99.53 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 99.53 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 99.51 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 99.5 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 99.47 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 99.45 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 99.43 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 99.42 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 99.33 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 99.33 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 99.25 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 99.23 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 99.17 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.17 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 99.13 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 99.07 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 99.05 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 99.04 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 98.93 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 98.91 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 98.91 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 98.87 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 98.85 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 98.83 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 98.8 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 98.69 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 98.6 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 98.3 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 98.07 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 97.95 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 97.68 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 91.62 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 86.91 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 80.94 |
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.97 E-value=8.2e-33 Score=293.20 Aligned_cols=229 Identities=23% Similarity=0.323 Sum_probs=164.7
Q ss_pred HHHHHHHHHHhhccceeeeccccccccCCCCCccc------cchhhchhchHHHHHHHHHh----------------hhh
Q psy17959 274 LCLMIMVGYIYGGAVLFSKWEDWNILDGSRSSSRS------RSRQQTERSFTEKCKDYLRQ----------------FLA 331 (790)
Q Consensus 274 ~~~~~~v~y~~~Ga~iF~~~E~~~~~~~~~~~~~~------~~~~~~~~~~~e~~~~~~~~----------------~~~ 331 (790)
.+++.+++|+++||++|+++|+++|.+.+++-... +..+.++.++.+-.+..... ...
T Consensus 34 ~Ll~~~~~YL~~GA~vF~~LE~~~E~~~~~~l~~~~~~fl~~~~~~~~~~l~~l~~~v~~A~~~Gv~~~~~~~~~~~~~~ 113 (309)
T 3um7_A 34 ALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETQSTSQSSHSA 113 (309)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHTTTCCCHHHHHHHHHGGGTSSCCCSCSHHHHHHHHHHHHHHHTTCCCSSCCCC-----C
T ss_pred HHHHHHHHHHHHHHHHHHHHhCCcHHHHHHHHHHHHHHHHHhcccccHHHHHHHHHHHHHHHhcCCCccccccCCCCCCC
Confidence 35666788999999999999999987764221111 11112233333222222211 134
Q ss_pred hhccccceeeeEEEEEeecccccccccCCcceehhhHHHHhHHHHHHHHHHhhHHHHHHhHHHHhhccccccCCCCCccc
Q psy17959 332 FLFSNIGIICLVIGYTIAGYGNVAPITFLGKITTIAYAIAGMPLFLLYLSNIGDILAKSFKWIYAKCCLCRGCPTRPRDL 411 (790)
Q Consensus 332 ~~f~~~~~~~~~~~~ttiGyg~~~p~t~~g~~~~i~y~~~gipl~~~~~~~~g~~l~~~~~~~~~~~~~~~~~~~~~~~~ 411 (790)
|+|.++++|+.+ .+|||||||++|.|..||+||++|+++|||++.++++.+++.+.+.+++...+...+..
T Consensus 114 w~~~~a~yf~~~-t~tTvGYGdi~P~T~~gk~~~i~~~l~Gi~~~~~~~~~i~~~l~~~~~~~i~~le~~~~-------- 184 (309)
T 3um7_A 114 WDLGSAFFFSGT-IITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFL-------- 184 (309)
T ss_dssp CSHHHHHHHHHH-HHTSCCCCSSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHT--------
T ss_pred CChhhhhHhhhe-eeeecccCCCCCCCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHh--------
Confidence 999999988775 45999999999999999999999999999999999999999998877655433211100
Q ss_pred cchhccccccccccccccccccccccccCCCCCccCCCCCCCccccCCchhhhhhhchhhhhhhhhhhhhhHhhhhcccc
Q psy17959 412 QKTIQDTTGAYNRRRSSAMNHNRRWNARNGDSEYEDSDFDTSDEEYDSSEEEEEEEEDEEEEEEEEEEEEEEEEEEGEEE 491 (790)
Q Consensus 412 ~k~i~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~ee~~~~~e~e~e~~~e~ee~~e~e~e~~ee~ 491 (790)
+++..
T Consensus 185 ------------~~~~~--------------------------------------------------------------- 189 (309)
T 3um7_A 185 ------------KWHVP--------------------------------------------------------------- 189 (309)
T ss_dssp ------------TTC-----------------------------------------------------------------
T ss_pred ------------ccccc---------------------------------------------------------------
Confidence 00000
Q ss_pred cccccCCCCCCCCCceeeehHHHHHHHHHHhhhhhceeeecccccCcccceeEEEEeecccccCCCccCCCcCCCCCCcc
Q psy17959 492 ETETASSSTAKNDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIVPGDKITGKNNDIG 571 (790)
Q Consensus 492 ~~~~~~s~~~~~~~~~~~~~~~~~l~~~~~~i~~ga~~f~~~e~w~~~da~Yf~~itltTIGfGD~~P~~~~~~~~~~~~ 571 (790)
.........+.+.++.+++++++|+++|+..|+|+|.||+|||++|+|||||||++|.++.++
T Consensus 190 -----------~~~~~~~~~~l~~~~~~~~~l~~ga~~~~~~E~~~~~da~y~~~vTltTvGyGd~~p~t~~g~------ 252 (309)
T 3um7_A 190 -----------PELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQ------ 252 (309)
T ss_dssp -----------CCHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHCCCHHHHHHHHHHHHTTCCCSSCCTTCCTTC------
T ss_pred -----------hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHhheeccccCCCCCCCcccc------
Confidence 000001112334455667889999999999999999999999999999999999999988776
Q ss_pred cchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy17959 572 VQTLELSFILCAMYLMLGMALIAMCFNLMQEEVV 605 (790)
Q Consensus 572 ~~~~~~~~~~~~~~il~Gl~~~~~~~~~~~~~~~ 605 (790)
..+.|++++++|+++|+++++++++.+.+.+.
T Consensus 253 --~~~~y~~~~~~~il~Gl~~~a~~~~~i~~~~~ 284 (309)
T 3um7_A 253 --DSPAYQPLVWFWILLGLAYFASVLTTIGNWLR 284 (309)
T ss_dssp --CCSTHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred --ccchHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 23468899999999999999999998766544
|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 790 | ||||
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 5e-18 | |
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 2e-16 | |
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 2e-14 | |
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 1e-10 | |
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 2e-06 | |
| d1p7ba2 | 116 | f.14.1.1 (A:36-151) Inward rectifier potassium cha | 2e-07 | |
| d1p7ba2 | 116 | f.14.1.1 (A:36-151) Inward rectifier potassium cha | 8e-04 | |
| d1xl4a2 | 116 | f.14.1.1 (A:23-138) Inward rectifier potassium cha | 3e-06 | |
| d1xl4a2 | 116 | f.14.1.1 (A:23-138) Inward rectifier potassium cha | 5e-04 | |
| d1r3jc_ | 103 | f.14.1.1 (C:) Potassium channel protein {Streptomy | 1e-05 | |
| d1r3jc_ | 103 | f.14.1.1 (C:) Potassium channel protein {Streptomy | 1e-04 | |
| d1qkla_ | 127 | a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: | 3e-04 | |
| d1qkla_ | 127 | a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: | 4e-04 | |
| d2ayua1 | 301 | d.305.1.1 (A:70-370) Nucleosome assembly protein, | 4e-04 | |
| d1ofcx3 | 102 | a.187.1.1 (X:697-798) HAND domain of the nucleosom | 7e-04 |
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel-related protein MthK species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]
Score = 77.1 bits (190), Expect = 5e-18
Identities = 22/90 (24%), Positives = 37/90 (41%), Gaps = 12/90 (13%)
Query: 101 PIWLCVFLVISYIIGGAFLFSHWEPWGFPDSAYFCFITLTTIGFGDFVPAQKSTDVQTAE 160
P + LV++ II G F E + S Y+ F+T+ T+G+GD+ P
Sbjct: 1 PATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSP----------- 49
Query: 161 ETAELRIALCSLYLLFGIALLAMSFNLVQE 190
T ++ GI A++ + E
Sbjct: 50 STPLGMY-FTVTLIVLGIGTFAVAVERLLE 78
|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 | Back information, alignment and structure |
|---|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 | Back information, alignment and structure |
|---|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 102 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 790 | |||
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 99.62 | |
| d1lnqa2 | 80 | Potassium channel-related protein MthK {Archaeon M | 99.54 | |
| d1lnqa2 | 80 | Potassium channel-related protein MthK {Archaeon M | 99.46 | |
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 99.46 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 99.3 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 99.27 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 99.08 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 99.03 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 98.25 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 97.22 |
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel protein species: Streptomyces coelicolor [TaxId: 1902]
Probab=99.62 E-value=2.1e-16 Score=139.64 Aligned_cols=88 Identities=15% Similarity=0.290 Sum_probs=77.5
Q ss_pred HHHHHHHHHHHHHHHHHHHHhhhhhcC-------CCccchhhheeeeeeccccCCcccCCCcccccccccchhhHHHHHH
Q psy17959 670 RVPIAVSFLIIISFILLGSLIFNKLEN-------WTFLDGTFFCFTSLGTIGFGELIPGESYDRTLRGNKNISVLVSSSY 742 (790)
Q Consensus 670 ~~~~~~~~~~~~~~~~~g~~~~~~~e~-------~s~~da~Y~~~vt~tTVGyGD~~p~t~~gr~~~~~~~~~~~~~~~~ 742 (790)
++.+..+++++++++++++..++..|+ .++.||+||+++|+|||||||++|.|+.|| ++++++
T Consensus 5 ~r~~~~~~~~~~~~~~~~s~~~~~~e~~~~~~~~~s~~~aly~~~vT~tTvGYGDi~P~t~~gr----------~~~~~~ 74 (103)
T d1r3jc_ 5 WRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGR----------CVAVVV 74 (103)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHTTSTTCCCCSHHHHHHHHHHHHTTCCCSSSCCCSHHHH----------HHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhccCCCcccCchhhhhhhheeeecccccCccccCChhHH----------HHHHHH
Confidence 445556666777778889999999885 489999999999999999999999999999 899999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHH
Q psy17959 743 ILVGMAVISMCFNLIQEEIIFMIKK 767 (790)
Q Consensus 743 ~~~g~~~~~~~~~~i~~~~~~~~~~ 767 (790)
++.|++++++.++.+++.+..+.++
T Consensus 75 ~~~Gi~~~~~~~~~i~~~~~~~~~~ 99 (103)
T d1r3jc_ 75 MVAGITSFGLVTAALATWFVGREQE 99 (103)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999998876554
|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|