Psyllid ID: psy17959


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790
LWSYRAEDYLREGSHDRGSPFKEILSSVPGYGHIAPKTTLGKVATIFYAIVGIPLMLLCLSNIGDIMAHSFRFLYWKDFDFFTEYYDTKGVGNAEQIKPVPIWLCVFLVISYIIGGAFLFSHWEPWGFPDSAYFCFITLTTIGFGDFVPAQKSTDVQTAEETAELRIALCSLYLLFGIALLAMSFNLVQEEVISNVKAIAKHLGIIKSSNGDSEYEDSDFDTSDEEYDSSEEEEEEEDEEEEEEEEEGEEEETETASSSTAKNDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSRSSSRSRSRQQTERSFTEKCKDYLRQFLAFLFSNIGIICLVIGYTIAGYGNVAPITFLGKITTIAYAIAGMPLFLLYLSNIGDILAKSFKWIYAKCCLCRGCPTRPRDLQKTIQDTTGAYNRRRSSAMNHNRRWNARNGDSEYEDSDFDTSDEEYDSSEEEEEEEEDEEEEEEEEEEEEEEEEEEGEEEETETASSSTAKNDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIVPGDKITGKNNDIGVQTLELSFILCAMYLMLGMALIAMCFNLMQEEVVHKMRTCSEVTQRKSKQQQQQQNSLPNIYSQFNHISTGKYDGKTTPYRGGYCTHASDFEPKAFRFRVPIAVSFLIIISFILLGSLIFNKLENWTFLDGTFFCFTSLGTIGFGELIPGESYDRTLRGNKNISVLVSSSYILVGMAVISMCFNLIQEEIIFMIKKFTLKLNKSGGSSGGVCDKNCDIS
ccccccccccccccccccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc
ccccccccccccccHHHHEEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEEEEHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccccccHHHccccccccHcHcHHccccccccccccccccccccccccEHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHHHHHcccccccccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHcHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHEEEEHEEHHHcccccccccccccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHEEEEEEEEEHHHcccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
lwsyraedylregshdrgspfkeilssvpgyghiapkttlgKVATIFYAIVGIPLMLLCLSnigdimahSFRFLYWKDFDFFTeyydtkgvgnaeqikpvPIWLCVFLVISYIIGGAflfshwepwgfpdsayfcfitlttigfgdfvpaqkstdvQTAEETAELRIALCSLYLLFGIALLAMSFNLVQEEVISNVKAIAKHLGIikssngdseyedsdfdtsdeeydsseeeeeeedeeeeeeeeegeeeetetassstakndpqmvtVPITLCLMIMVGYIYGGAVLFskwedwnildgsrsssrsrsrqQTERSFTEKCKDYLRQFLAFLFSNIGIICLVIGYtiagygnvapitfLGKITTIAYAIAGMPLFLLYLSNIGDILAKSFKWIYAKcclcrgcptrprdlqKTIQDTTGAYNRRRSSamnhnrrwnarngdseyedsdfdtsdeeydsseeeeeeeedeeeeeeeeeeeeeeeeeegeeeetetassstakndpqmvtVPITLCLMIMVGYIYGGAVLFskwedwnildgsyfcfislstigfgdivpgdkitgknndigVQTLELSFILCAMYLMLGMALIAMCFNLMQEEVVHKMRTCSEVTQRKSKQQQQQQnslpniysqfnhistgkydgkttpyrggycthasdfepkafrfrvPIAVSFLIIISFILLGSLIfnklenwtfldgtffcftslgtigfgelipgesydrtlrgnknISVLVSSSYILVGMAVISMCFNLIQEEIIFMIKKFTLKLnksggssggvcdkncdis
lwsyraedylregshdrgspfKEILSSVPGYGHIAPKTTLGKVATIFYAIVGIPLMLLCLSNIGDIMAHSFRFLYWKDFDFFTEYYDTKGVGNAEQIKPVPIWLCVFLVISYIIGGAFLFSHWEPWGFPDSAYFCFITLTTIGFGDFVPAQKSTDVQTAEETAELRIALCSLYLLFGIALLAMSFNLVQEEVISNVKAIAKHLGiikssngdseyedsdfdtsdeeydsseeeeeeedeeeeeeeeegeeeetetassstakndpqmVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILdgsrsssrsrsrqqtersfTEKCKDYLRQFLAFLFSNIGIICLVIGYTIAGYGNVAPITFLGKITTIAYAIAGMPLFLLYLSNIGDILAKSFKWIYAKCCLCRgcptrprdlqktiqdttgaynrrrssamnhnrrwnarngdseyedsdfdtsdeeydsseeeeeeeedeeeeeeeeeeeeeeeeeegeeeetetassstakndpqmVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIVPGDKITGKNNDIGVQTLELSFILCAMYLMLGMALIAMCFNLMQEEVVHKMRTCSEVTQRKSKQQQQQQNSLPNIYSQFNHISTGKYDGKTTPYRGGYCTHASDFEPKAFRFRVPIAVSFLIIISFILLGSLIFNKLENWTFLDGTFFCFTSLGTIGFGELIPGESYDRTLRGNKNISVLVSSSYILVGMAVISMCFNLIQEEIIFMIKKFTLKLnksggssggvcdkncdis
LWSYRAEDYLREGSHDRGSPFKEILSSVPGYGHIAPKTTLGKVATIFYAIVGIPLMLLCLSNIGDIMAHSFRFLYWKDFDFFTEYYDTKGVGNAEQIKPVPIWLCVFLVISYIIGGAFLFSHWEPWGFPDSAYFCFITLTTIGFGDFVPAQKSTDVQTAEETAELRIALCSLYLLFGIALLAMSFNLVQEEVISNVKAIAKHLGIIKSSNGdseyedsdfdtsdeeydsseeeeeeedeeeeeeeeegeeeetetassstAKNDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGsrsssrsrsrQQTERSFTEKCKDYLRQFLAFLFSNIGIICLVIGYTIAGYGNVAPITFLGKITTIAYAIAGMPLFLLYLSNIGDILAKSFKWIYAKCCLCRGCPTRPRDLQKTIQDTTGAYNRRRSSAMNHNRRWNARNGdseyedsdfdtsdeeydsseeeeeeeedeeeeeeeeeeeeeeeeeegeeeeteTASSSTAKNDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIVPGDKITGKNNDIGVQTLELSFILCAMYLMLGMALIAMCFNLMQEEVVHKMRTCSEVTQRKSKqqqqqqNSLPNIYSQFNHISTGKYDGKTTPYRGGYCTHASDFEPKAFRFRVPIAVsfliiisfillgslifNKLENWTFLDGTFFCFTSLGTIGFGELIPGESYDRTLRGNKNisvlvsssyilvGMAVISMCFNLIQEEIIFMIKKFTLKLNKsggssggVCDKNCDIS
***********************ILSSVPGYGHIAPKTTLGKVATIFYAIVGIPLMLLCLSNIGDIMAHSFRFLYWKDFDFFTEYYDTKGVGNAEQIKPVPIWLCVFLVISYIIGGAFLFSHWEPWGFPDSAYFCFITLTTIGFGDFVPAQKSTDVQTAEETAELRIALCSLYLLFGIALLAMSFNLVQEEVISNVKAIAKHLGII************************************************************MVTVPITLCLMIMVGYIYGGAVLFSKWEDWNIL********************EKCKDYLRQFLAFLFSNIGIICLVIGYTIAGYGNVAPITFLGKITTIAYAIAGMPLFLLYLSNIGDILAKSFKWIYAKCCLCRGCPTR***************************************************************************************************MVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIVPGDKITGKNNDIGVQTLELSFILCAMYLMLGMALIAMCFNLMQEEVVHKMRT*********************IYSQFNHISTGKYDGKTTPYRGGYCTHASDFEPKAFRFRVPIAVSFLIIISFILLGSLIFNKLENWTFLDGTFFCFTSLGTIGFGELIPGESYDRTLRGNKNISVLVSSSYILVGMAVISMCFNLIQEEIIFMIKKFTLKLN*****************
********YLREGSHDRGSPFKEILSSVPGYGHIAPKTTLGKVATIFYAIVGIPLMLLCLSNIGDIMAHSFRFLYWKDFDFFTEYYDTKGVGNAEQIKPVPIWLCVFLVISYIIGGAFLFSHWEPWGFPDSAYFCFITLTTIGFGDFVPAQKSTDVQTAEETAELRIALCSLYLLFGIALLAMSFNLVQEEVISNVKAIAKHLGIIKSSNGDSEYEDSDFD**DE**DSSEEEEEEEDEEEEEEEEEGEEEETETASSSTAKNDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSRSSSRSRSRQQTERSFTEKCKDYLRQFLAFLFSNIGIICLVIGYTIAGYGNVAPITFLGKITTIAYAIAGMPLFLLYLSNIGDILAKSFKWIYAKCCLCRGCPTRPRDLQKTIQ******************************************************************************TASSSTAKNDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIVPGDKITGKNNDIGVQTLELSFILCAMYLMLGMALIAMCFNLMQEEVVHKMRTCSEVTQRKSKQQQQQQNSLPNIYSQF*******************CTHASDFEPKAFRFRVPIAVSFLIIISFILLGSLIFNKLENWTFLDGTFFCFTSLGTIGFGELIPGESYDRTLRGNKNISVLVSSSYILVGMAVISMCFNLIQEEIIFMIKKFTLKLNKSGGSSGGVCDKNCD**
LWSYRAEDYLREGSHDRGSPFKEILSSVPGYGHIAPKTTLGKVATIFYAIVGIPLMLLCLSNIGDIMAHSFRFLYWKDFDFFTEYYDTKGVGNAEQIKPVPIWLCVFLVISYIIGGAFLFSHWEPWGFPDSAYFCFITLTTIGFGDFVPAQKSTDVQTAEETAELRIALCSLYLLFGIALLAMSFNLVQEEVISNVKAIAKHLGIIKSSN****************************************************NDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILD******************TEKCKDYLRQFLAFLFSNIGIICLVIGYTIAGYGNVAPITFLGKITTIAYAIAGMPLFLLYLSNIGDILAKSFKWIYAKCCLCRGCPTRPRDLQKTIQDTTGAYNRRRSSAMNHNRRWNARN**************************************************************NDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIVPGDKITGKNNDIGVQTLELSFILCAMYLMLGMALIAMCFNLMQEEVVHKMR*******************LPNIYSQFNHISTGKYDGKTTPYRGGYCTHASDFEPKAFRFRVPIAVSFLIIISFILLGSLIFNKLENWTFLDGTFFCFTSLGTIGFGELIPGESYDRTLRGNKNISVLVSSSYILVGMAVISMCFNLIQEEIIFMIKKFTLKLNKSGGSSGGVCDKNCDIS
*WSYRAEDYLREGSHDRGSPFKEILSSVPGYGHIAPKTTLGKVATIFYAIVGIPLMLLCLSNIGDIMAHSFRFLYWKDFDFFTEYYDTKGVGNAEQIKPVPIWLCVFLVISYIIGGAFLFSHWEPWGFPDSAYFCFITLTTIGFGDFVPAQKSTDVQTAEETAELRIALCSLYLLFGIALLAMSFNLVQEEVISNVKAIAKHLGIIKSSN***********************************************SSTAKNDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSRSSSRSRSRQQTERSFTEKCKDYLRQFLAFLFSNIGIICLVIGYTIAGYGNVAPITFLGKITTIAYAIAGMPLFLLYLSNIGDILAKSFKWIYAKCCLCRGCPTRPRDLQKTIQDTTGAYNRRRSSAMNHNRRWNA*******************************************************************QMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIVPGDKITGKNNDIGVQTLELSFILCAMYLMLGMALIAMCFNLMQEEVVHKMRTCSEVTQRKSKQQQQ***************************************PKAFRFRVPIAVSFLIIISFILLGSLIFNKLENWTFLDGTFFCFTSLGTIGFGELIPGESYDRTLRGNKNISVLVSSSYILVGMAVISMCFNLIQEEIIFMIKKFTLKLNKS***************
ooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooRRRRRRRRRRRRRRRRRRRooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooRRRRRRRRRRRRRRRRRRRRooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooRRRRRRRRRRRRRRRRRRRRooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LWSYRAEDYLREGSHDRGSPFKEILSSVPGYGHIAPKTTLGKVATIFYAIVGIPLMLLCLSNIGDIMAHSFRFLYWKDFDFFTEYYDTKGVGNAEQIKPVPIWLCVFLVISYIIGGAFLFSHWEPWGFPDSAYFCFITLTTIGFGDFVPAQKSTDVQTAEETAELRIALCSLYLLFGIALLAMSFNLVQEEVISNVKAIAKHLGIIKSSNGDSEYEDSDFDTSDEExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSSSTAKNDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSRSSSRSRSRQQTERSFTEKCKDYLRQFLAFLFSNIGIICLVIGYTIAGYGNVAPITFLGKITTIAYAIAGMPLFLLYLSNIGDILAKSFKWIYAKCCLCRGCPTRPRDLQKTIQDTTGAYNRRRSSAMNHNRRWNARNGDSEYEDSDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSSSTAKNDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIVPGDKITGKNNDIGVQTLELSFILCAMYLMLGMALIAMCFNLMQEEVVHKMRTCSEVTQRKSKQQQQQQNSLPNIYSQFNHISTGKYDGKTTPYRGGYCTHASDFEPKAFRFRVPIAVSFLIIISFILLGSLIFNKLENWTFLDGTFFCFTSLGTIGFGELIPGESYDRTLRGNKNISVLVSSSYILVGMAVISMCFNLIQEEIIFMIKKFTLKLNKSGGSSGGVCDKNCDIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query790 2.2.26 [Sep-21-2011]
O14649394 Potassium channel subfami yes N/A 0.184 0.370 0.378 1e-20
O17185329 Two pore potassium channe no N/A 0.296 0.711 0.274 3e-19
O54912411 Potassium channel subfami yes N/A 0.184 0.355 0.366 5e-19
O35111409 Potassium channel subfami yes N/A 0.184 0.356 0.366 5e-19
Q63ZI0374 Potassium channel subfami N/A N/A 0.187 0.395 0.345 7e-19
Q6Q1P3405 Potassium channel subfami no N/A 0.369 0.720 0.248 3e-18
Q9NPC2374 Potassium channel subfami no N/A 0.187 0.395 0.345 2e-17
Q3LS21402 Potassium channel subfami no N/A 0.187 0.368 0.352 3e-17
Q9ES08396 Potassium channel subfami no N/A 0.187 0.373 0.352 4e-17
Q9JL58365 Potassium channel subfami no N/A 0.187 0.405 0.345 5e-17
>sp|O14649|KCNK3_HUMAN Potassium channel subfamily K member 3 OS=Homo sapiens GN=KCNK3 PE=1 SV=1 Back     alignment and function desciption
 Score =  102 bits (254), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 88/161 (54%), Gaps = 15/161 (9%)

Query: 30  GYGHIAPKTTLGKVATIFYAIVGIPLMLLCLSNIGDIMAHSFRFLYWKDFDFFTEYYDTK 89
           GYGH AP T  GKV  +FYA++GIPL L+   ++G+ +    R+L  +           K
Sbjct: 95  GYGHAAPSTDGGKVFCMFYALLGIPLTLVMFQSLGERINTLVRYLLHRA---------KK 145

Query: 90  GVG--NAEQIKPVPIWLCVFLVISYIIGGAFLFSHWEPWGFPDSAYFCFITLTTIGFGDF 147
           G+G   A+      + +  F  IS +  GA  FSH+E W F  + Y+CFITLTTIGFGD+
Sbjct: 146 GLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSHYEHWTFFQAYYYCFITLTTIGFGDY 205

Query: 148 VPAQKSTDVQTAEETAELRIALCSLYLLFGIALLAMSFNLV 188
           V  QK   +QT  +     +A   +Y+L G+ ++    NLV
Sbjct: 206 VALQKDQALQTQPQY----VAFSFVYILTGLTVIGAFLNLV 242




pH-dependent, voltage-insensitive, background potassium channel protein. Rectification direction results from potassium ion concentration on either side of the membrane. Acts as an outward rectifier when external potassium concentration is low. When external potassium concentration is high, current is inward.
Homo sapiens (taxid: 9606)
>sp|O17185|SUP9_CAEEL Two pore potassium channel protein sup-9 OS=Caenorhabditis elegans GN=sup-9 PE=1 SV=2 Back     alignment and function description
>sp|O54912|KCNK3_RAT Potassium channel subfamily K member 3 OS=Rattus norvegicus GN=Kcnk3 PE=2 SV=1 Back     alignment and function description
>sp|O35111|KCNK3_MOUSE Potassium channel subfamily K member 3 OS=Mus musculus GN=Kcnk3 PE=2 SV=2 Back     alignment and function description
>sp|Q63ZI0|KCNK9_XENLA Potassium channel subfamily K member 9 OS=Xenopus laevis GN=kcnk9 PE=2 SV=1 Back     alignment and function description
>sp|Q6Q1P3|KCNKI_RAT Potassium channel subfamily K member 18 OS=Rattus norvegicus GN=Kcnk18 PE=2 SV=1 Back     alignment and function description
>sp|Q9NPC2|KCNK9_HUMAN Potassium channel subfamily K member 9 OS=Homo sapiens GN=KCNK9 PE=1 SV=1 Back     alignment and function description
>sp|Q3LS21|KCNK9_MOUSE Potassium channel subfamily K member 9 OS=Mus musculus GN=Kcnk9 PE=2 SV=1 Back     alignment and function description
>sp|Q9ES08|KCNK9_RAT Potassium channel subfamily K member 9 OS=Rattus norvegicus GN=Kcnk9 PE=1 SV=2 Back     alignment and function description
>sp|Q9JL58|KCNK9_CAVPO Potassium channel subfamily K member 9 OS=Cavia porcellus GN=KCNK9 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query790
242021264423 conserved hypothetical protein [Pediculu 0.330 0.617 0.506 7e-67
328783862390 PREDICTED: potassium channel subfamily K 0.360 0.730 0.442 1e-59
380018794391 PREDICTED: TWiK family of potassium chan 0.362 0.731 0.437 2e-59
19921794395 CG8713 [Drosophila melanogaster] gi|7304 0.316 0.632 0.460 7e-58
195455186388 GK23078 [Drosophila willistoni] gi|19417 0.308 0.628 0.471 1e-57
194863596395 GG23333 [Drosophila erecta] gi|190662385 0.316 0.632 0.460 1e-57
195120762401 GI19352 [Drosophila mojavensis] gi|19390 0.324 0.638 0.457 1e-57
195474594395 GE19175 [Drosophila yakuba] gi|194175677 0.316 0.632 0.460 1e-57
195332345395 GM21006 [Drosophila sechellia] gi|194124 0.316 0.632 0.460 2e-57
332024510268 Potassium channel subfamily K member 18 0.306 0.902 0.5 2e-57
>gi|242021264|ref|XP_002431065.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212516299|gb|EEB18327.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  261 bits (668), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 151/298 (50%), Positives = 186/298 (62%), Gaps = 37/298 (12%)

Query: 331 AFLFSNIGIICLVIGYTIAGYGNVAPITFLGKITTIAYAIAGMPLFLLYLSNIGDILAKS 390
           AFL+S   I       T  GYGNVAP T  GK+ TI YAI GMPLFLLYLSNIGDILAKS
Sbjct: 135 AFLYSLTVI-------TTIGYGNVAPRTEWGKLATIVYAIVGMPLFLLYLSNIGDILAKS 187

Query: 391 FKWIYAKCCLCRGCP-----TRPRDLQKTIQ-----DTTGAYNRRRSSAMNHNRRWNARN 440
           FKW Y K CLC+GCP      R + +++ I+      +   ++RRR    N    W    
Sbjct: 188 FKWSYTKVCLCKGCPGTESFRRRKRMKQNIKMSKMIKSQKDFSRRR----NRKTSWQPNV 243

Query: 441 GDSEYEDSDFDTSDEEYDSSEEEEEEEEDEEEEEEEEEEEEEEEEEEGEEEETETASSST 500
            D        D+ +E+    ++EE++ +DE                    +ETE + SS 
Sbjct: 244 HD--------DSRNEKRKKIDDEEDDSDDESSSSNSSSGSSSGGNTSDTNKETEISQSSL 295

Query: 501 AKND--PQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIV 558
           + +D  PQ VTVPITLCL IMVGY+ GGA+LF++WE+W  LDGSYFCFISLSTIGFGDIV
Sbjct: 296 SIDDYDPQTVTVPITLCLAIMVGYVCGGALLFARWENWGFLDGSYFCFISLSTIGFGDIV 355

Query: 559 PGDKITGKNNDIGVQTLELSFILCAMYLMLGMALIAMCFNLMQEEVVHKMRTCSEVTQ 616
           PGD I      I  Q +++SFIL A+YLMLGMALIAMCFNLMQEEV+HK R+C +  Q
Sbjct: 356 PGDSI------IQSQVIQISFILTAVYLMLGMALIAMCFNLMQEEVIHKTRSCIKCCQ 407




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328783862|ref|XP_001120767.2| PREDICTED: potassium channel subfamily K member 18-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380018794|ref|XP_003693306.1| PREDICTED: TWiK family of potassium channels protein 18-like [Apis florea] Back     alignment and taxonomy information
>gi|19921794|ref|NP_610349.1| CG8713 [Drosophila melanogaster] gi|7304100|gb|AAF59138.1| CG8713 [Drosophila melanogaster] gi|17945478|gb|AAL48792.1| RE21922p [Drosophila melanogaster] gi|220948234|gb|ACL86660.1| CG8713-PA [synthetic construct] gi|220957472|gb|ACL91279.1| CG8713-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195455186|ref|XP_002074600.1| GK23078 [Drosophila willistoni] gi|194170685|gb|EDW85586.1| GK23078 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194863596|ref|XP_001970518.1| GG23333 [Drosophila erecta] gi|190662385|gb|EDV59577.1| GG23333 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195120762|ref|XP_002004890.1| GI19352 [Drosophila mojavensis] gi|193909958|gb|EDW08825.1| GI19352 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195474594|ref|XP_002089576.1| GE19175 [Drosophila yakuba] gi|194175677|gb|EDW89288.1| GE19175 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195332345|ref|XP_002032859.1| GM21006 [Drosophila sechellia] gi|194124829|gb|EDW46872.1| GM21006 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|332024510|gb|EGI64708.1| Potassium channel subfamily K member 18 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query790
FB|FBgn0033257395 CG8713 [Drosophila melanogaste 0.124 0.248 0.656 2.7e-61
FB|FBgn0035192729 CG9194 [Drosophila melanogaste 0.135 0.146 0.699 4.3e-54
WB|WBGene00010784372 twk-48 [Caenorhabditis elegans 0.143 0.303 0.436 9.2e-34
WB|WBGene00006690676 twk-39 [Caenorhabditis elegans 0.116 0.136 0.54 1.3e-33
FB|FBgn02609711009 CG42594 [Drosophila melanogast 0.136 0.107 0.441 4.4e-29
FB|FBgn0027589918 CG1688 [Drosophila melanogaste 0.121 0.104 0.407 2.2e-26
FB|FBgn0038621389 CG10864 [Drosophila melanogast 0.167 0.339 0.387 1.1e-23
FB|FBgn0259242484 CG42340 [Drosophila melanogast 0.125 0.204 0.370 6.2e-21
WB|WBGene00006318329 sup-9 [Caenorhabditis elegans 0.192 0.462 0.345 7.6e-19
UNIPROTKB|O17185329 sup-9 "Two pore potassium chan 0.192 0.462 0.345 7.6e-19
FB|FBgn0033257 CG8713 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 378 (138.1 bits), Expect = 2.7e-61, Sum P(3) = 2.7e-61
 Identities = 67/102 (65%), Positives = 86/102 (84%)

Query:   508 VTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIVPGDKITGKN 567
             +TVP+T+C+ +MVGYI  GA+LF +WEDWN LDGSYFC ISLS+IGFGD+VPGD++   +
Sbjct:   283 ITVPVTVCVFVMVGYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITAD 342

Query:   568 NDIGVQTLELSFILCAMYLMLGMALIAMCFNLMQEEVVHKMR 609
              D     +E+SFILCA+YL+LGMA+IAMCFNLMQE+VVH +R
Sbjct:   343 RD----KVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNIR 380


GO:0005250 "A-type (transient outward) potassium channel activity" evidence=ISS
GO:0071805 "potassium ion transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
FB|FBgn0035192 CG9194 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00010784 twk-48 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00006690 twk-39 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0260971 CG42594 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0027589 CG1688 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038621 CG10864 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0259242 CG42340 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00006318 sup-9 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O17185 sup-9 "Two pore potassium channel protein sup-9" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.23LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query790
pfam0788574 pfam07885, Ion_trans_2, Ion channel 1e-13
pfam0788574 pfam07885, Ion_trans_2, Ion channel 3e-11
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-11
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 5e-10
pfam04147 809 pfam04147, Nop14, Nop14-like family 6e-10
pfam0788574 pfam07885, Ion_trans_2, Ion channel 2e-09
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 9e-09
pfam05285317 pfam05285, SDA1, SDA1 1e-08
pfam03344715 pfam03344, Daxx, Daxx Family 1e-08
pfam0788574 pfam07885, Ion_trans_2, Ion channel 3e-08
pfam03344715 pfam03344, Daxx, Daxx Family 3e-08
pfam07133164 pfam07133, Merozoite_SPAM, Merozoite surface prote 9e-08
pfam11081172 pfam11081, DUF2890, Protein of unknown function (D 1e-07
pfam04889241 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont 1e-07
pfam03985431 pfam03985, Paf1, Paf1 2e-07
PHA00435306 PHA00435, PHA00435, capsid assembly protein 2e-07
pfam04147 809 pfam04147, Nop14, Nop14-like family 3e-07
pfam11081172 pfam11081, DUF2890, Protein of unknown function (D 3e-07
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 3e-07
pfam1225376 pfam12253, CAF1A, Chromatin assembly factor 1 subu 3e-07
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 3e-07
pfam05285317 pfam05285, SDA1, SDA1 4e-07
pfam05764238 pfam05764, YL1, YL1 nuclear protein 4e-07
pfam04147 809 pfam04147, Nop14, Nop14-like family 5e-07
pfam05285317 pfam05285, SDA1, SDA1 5e-07
pfam03344715 pfam03344, Daxx, Daxx Family 5e-07
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 6e-07
pfam0788574 pfam07885, Ion_trans_2, Ion channel 7e-07
pfam08553794 pfam08553, VID27, VID27 cytoplasmic protein 8e-07
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 9e-07
pfam04147809 pfam04147, Nop14, Nop14-like family 1e-06
pfam05285317 pfam05285, SDA1, SDA1 1e-06
pfam11081172 pfam11081, DUF2890, Protein of unknown function (D 1e-06
pfam04889241 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont 1e-06
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 1e-06
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 1e-06
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-06
pfam04147809 pfam04147, Nop14, Nop14-like family 2e-06
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 2e-06
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 2e-06
pfam06213282 pfam06213, CobT, Cobalamin biosynthesis protein Co 2e-06
PRK14160211 PRK14160, PRK14160, heat shock protein GrpE; Provi 2e-06
pfam04050171 pfam04050, Upf2, Up-frameshift suppressor 2 2e-06
pfam04147 809 pfam04147, Nop14, Nop14-like family 3e-06
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 3e-06
COG54061001 COG5406, COG5406, Nucleosome binding factor SPN, S 3e-06
PRK14891131 PRK14891, PRK14891, 50S ribosomal protein L24e/unk 3e-06
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-06
pfam06213282 pfam06213, CobT, Cobalamin biosynthesis protein Co 4e-06
pfam04050171 pfam04050, Upf2, Up-frameshift suppressor 2 4e-06
pfam04050171 pfam04050, Upf2, Up-frameshift suppressor 2 4e-06
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 4e-06
COG4547620 COG4547, CobT, Cobalamin biosynthesis protein CobT 4e-06
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 4e-06
pfam03344715 pfam03344, Daxx, Daxx Family 5e-06
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 5e-06
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 6e-06
PRK14891131 PRK14891, PRK14891, 50S ribosomal protein L24e/unk 7e-06
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 7e-06
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 8e-06
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 8e-06
pfam04147 809 pfam04147, Nop14, Nop14-like family 9e-06
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 9e-06
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 9e-06
pfam04147 809 pfam04147, Nop14, Nop14-like family 1e-05
pfam04147 809 pfam04147, Nop14, Nop14-like family 1e-05
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 1e-05
PTZ00248319 PTZ00248, PTZ00248, eukaryotic translation initiat 1e-05
PRK12329449 PRK12329, nusA, transcription elongation factor Nu 1e-05
pfam00183 529 pfam00183, HSP90, Hsp90 protein 1e-05
pfam04546211 pfam04546, Sigma70_ner, Sigma-70, non-essential re 1e-05
pfam09805134 pfam09805, Nop25, Nucleolar protein 12 (25kDa) 1e-05
pfam04147809 pfam04147, Nop14, Nop14-like family 2e-05
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 2e-05
pfam08553794 pfam08553, VID27, VID27 cytoplasmic protein 2e-05
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 2e-05
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 2e-05
COG4547620 COG4547, CobT, Cobalamin biosynthesis protein CobT 2e-05
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 2e-05
PTZ00248319 PTZ00248, PTZ00248, eukaryotic translation initiat 2e-05
pfam09026101 pfam09026, Cenp-B_dimeris, Centromere protein B di 2e-05
pfam09756189 pfam09756, DDRGK, DDRGK domain 2e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-05
pfam04147809 pfam04147, Nop14, Nop14-like family 3e-05
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 3e-05
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 3e-05
PTZ00248319 PTZ00248, PTZ00248, eukaryotic translation initiat 3e-05
pfam09026101 pfam09026, Cenp-B_dimeris, Centromere protein B di 3e-05
pfam09026101 pfam09026, Cenp-B_dimeris, Centromere protein B di 3e-05
pfam09184285 pfam09184, PPP4R2, PPP4R2 3e-05
pfam09184285 pfam09184, PPP4R2, PPP4R2 3e-05
pfam04931784 pfam04931, DNA_pol_phi, DNA polymerase phi 3e-05
pfam0487497 pfam04874, Mak16, Mak16 protein C-terminal region 3e-05
pfam0487497 pfam04874, Mak16, Mak16 protein C-terminal region 3e-05
pfam09073424 pfam09073, BUD22, BUD22 3e-05
pfam02459548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 3e-05
pfam04147809 pfam04147, Nop14, Nop14-like family 4e-05
pfam03344715 pfam03344, Daxx, Daxx Family 4e-05
pfam07133164 pfam07133, Merozoite_SPAM, Merozoite surface prote 4e-05
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 4e-05
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 4e-05
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 4e-05
pfam02724 583 pfam02724, CDC45, CDC45-like protein 4e-05
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 4e-05
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 4e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 5e-05
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 5e-05
pfam09026101 pfam09026, Cenp-B_dimeris, Centromere protein B di 5e-05
pfam02459548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 5e-05
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 5e-05
pfam05887145 pfam05887, Trypan_PARP, Procyclic acidic repetitiv 5e-05
COG5137279 COG5137, COG5137, Histone chaperone involved in ge 5e-05
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 6e-05
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 6e-05
pfam0487497 pfam04874, Mak16, Mak16 protein C-terminal region 6e-05
pfam05432291 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) 6e-05
pfam04006 613 pfam04006, Mpp10, Mpp10 protein 6e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 7e-05
pfam07133164 pfam07133, Merozoite_SPAM, Merozoite surface prote 7e-05
COG4547620 COG4547, CobT, Cobalamin biosynthesis protein CobT 7e-05
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 7e-05
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 7e-05
pfam04546211 pfam04546, Sigma70_ner, Sigma-70, non-essential re 7e-05
PHA00435306 PHA00435, PHA00435, capsid assembly protein 8e-05
pfam08553794 pfam08553, VID27, VID27 cytoplasmic protein 8e-05
pfam05432291 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) 8e-05
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 8e-05
COG2058109 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP 8e-05
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 8e-05
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 9e-05
TIGR01651600 TIGR01651, CobT, cobaltochelatase, CobT subunit 9e-05
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 9e-05
pfam05285317 pfam05285, SDA1, SDA1 1e-04
pfam03985431 pfam03985, Paf1, Paf1 1e-04
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 1e-04
pfam05764238 pfam05764, YL1, YL1 nuclear protein 1e-04
pfam05764238 pfam05764, YL1, YL1 nuclear protein 1e-04
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 1e-04
pfam06213282 pfam06213, CobT, Cobalamin biosynthesis protein Co 1e-04
pfam06213282 pfam06213, CobT, Cobalamin biosynthesis protein Co 1e-04
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 1e-04
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 1e-04
pfam04546211 pfam04546, Sigma70_ner, Sigma-70, non-essential re 1e-04
pfam04546211 pfam04546, Sigma70_ner, Sigma-70, non-essential re 1e-04
pfam04546211 pfam04546, Sigma70_ner, Sigma-70, non-essential re 1e-04
pfam04931784 pfam04931, DNA_pol_phi, DNA polymerase phi 1e-04
pfam02459548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 1e-04
pfam02724583 pfam02724, CDC45, CDC45-like protein 1e-04
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 1e-04
pfam05432291 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) 1e-04
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 1e-04
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 1e-04
pfam02029431 pfam02029, Caldesmon, Caldesmon 1e-04
PRK05658 619 PRK05658, PRK05658, RNA polymerase sigma factor Rp 1e-04
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 1e-04
pfam06390261 pfam06390, NESP55, Neuroendocrine-specific golgi p 1e-04
pfam03344715 pfam03344, Daxx, Daxx Family 2e-04
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 2e-04
pfam1225376 pfam12253, CAF1A, Chromatin assembly factor 1 subu 2e-04
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 2e-04
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 2e-04
pfam06213282 pfam06213, CobT, Cobalamin biosynthesis protein Co 2e-04
pfam04050171 pfam04050, Upf2, Up-frameshift suppressor 2 2e-04
pfam04050171 pfam04050, Upf2, Up-frameshift suppressor 2 2e-04
PTZ00248319 PTZ00248, PTZ00248, eukaryotic translation initiat 2e-04
PTZ00248319 PTZ00248, PTZ00248, eukaryotic translation initiat 2e-04
pfam00183 529 pfam00183, HSP90, Hsp90 protein 2e-04
pfam04546211 pfam04546, Sigma70_ner, Sigma-70, non-essential re 2e-04
pfam09026101 pfam09026, Cenp-B_dimeris, Centromere protein B di 2e-04
pfam0487497 pfam04874, Mak16, Mak16 protein C-terminal region 2e-04
pfam0487497 pfam04874, Mak16, Mak16 protein C-terminal region 2e-04
pfam0487497 pfam04874, Mak16, Mak16 protein C-terminal region 2e-04
pfam09073424 pfam09073, BUD22, BUD22 2e-04
pfam04006 613 pfam04006, Mpp10, Mpp10 protein 2e-04
COG2058109 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP 2e-04
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 2e-04
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 2e-04
pfam02029431 pfam02029, Caldesmon, Caldesmon 2e-04
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 2e-04
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 2e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-04
pfam12619145 pfam12619, MCM2_N, Mini-chromosome maintenance pro 2e-04
pfam04774106 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi 2e-04
COG5414392 COG5414, COG5414, TATA-binding protein-associated 2e-04
pfam05285317 pfam05285, SDA1, SDA1 3e-04
pfam07133164 pfam07133, Merozoite_SPAM, Merozoite surface prote 3e-04
pfam11081172 pfam11081, DUF2890, Protein of unknown function (D 3e-04
pfam03985431 pfam03985, Paf1, Paf1 3e-04
PHA00435306 PHA00435, PHA00435, capsid assembly protein 3e-04
pfam08553794 pfam08553, VID27, VID27 cytoplasmic protein 3e-04
PRK14160211 PRK14160, PRK14160, heat shock protein GrpE; Provi 3e-04
PRK14160211 PRK14160, PRK14160, heat shock protein GrpE; Provi 3e-04
PRK14160211 PRK14160, PRK14160, heat shock protein GrpE; Provi 3e-04
pfam04050171 pfam04050, Upf2, Up-frameshift suppressor 2 3e-04
PRK14891131 PRK14891, PRK14891, 50S ribosomal protein L24e/unk 3e-04
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 3e-04
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 3e-04
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 3e-04
PRK12329449 PRK12329, nusA, transcription elongation factor Nu 3e-04
PRK12329449 PRK12329, nusA, transcription elongation factor Nu 3e-04
pfam09026101 pfam09026, Cenp-B_dimeris, Centromere protein B di 3e-04
pfam09184285 pfam09184, PPP4R2, PPP4R2 3e-04
pfam04931784 pfam04931, DNA_pol_phi, DNA polymerase phi 3e-04
pfam0487497 pfam04874, Mak16, Mak16 protein C-terminal region 3e-04
pfam09073424 pfam09073, BUD22, BUD22 3e-04
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 3e-04
pfam05887145 pfam05887, Trypan_PARP, Procyclic acidic repetitiv 3e-04
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 3e-04
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 3e-04
TIGR01651600 TIGR01651, CobT, cobaltochelatase, CobT subunit 3e-04
COG5414392 COG5414, COG5414, TATA-binding protein-associated 3e-04
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 3e-04
COG5167776 COG5167, VID27, Protein involved in vacuole import 3e-04
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 3e-04
PLN00152130 PLN00152, PLN00152, DNA-directed RNA polymerase; P 3e-04
pfam04147809 pfam04147, Nop14, Nop14-like family 4e-04
pfam05285317 pfam05285, SDA1, SDA1 4e-04
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 4e-04
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 4e-04
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 4e-04
PRK14160211 PRK14160, PRK14160, heat shock protein GrpE; Provi 4e-04
pfam04050171 pfam04050, Upf2, Up-frameshift suppressor 2 4e-04
pfam04050171 pfam04050, Upf2, Up-frameshift suppressor 2 4e-04
COG4547620 COG4547, CobT, Cobalamin biosynthesis protein CobT 4e-04
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 4e-04
PTZ00248319 PTZ00248, PTZ00248, eukaryotic translation initiat 4e-04
pfam09026101 pfam09026, Cenp-B_dimeris, Centromere protein B di 4e-04
pfam0487497 pfam04874, Mak16, Mak16 protein C-terminal region 4e-04
pfam09073424 pfam09073, BUD22, BUD22 4e-04
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 4e-04
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 4e-04
pfam05432291 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) 4e-04
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 4e-04
pfam04774106 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi 4e-04
PRK02363129 PRK02363, PRK02363, DNA-directed RNA polymerase su 4e-04
pfam10446449 pfam10446, DUF2457, Protein of unknown function (D 4e-04
pfam03896281 pfam03896, TRAP_alpha, Translocon-associated prote 4e-04
COG3343175 COG3343, RpoE, DNA-directed RNA polymerase, delta 4e-04
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 5e-04
pfam03344715 pfam03344, Daxx, Daxx Family 5e-04
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 5e-04
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 5e-04
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 5e-04
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 5e-04
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 5e-04
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 5e-04
pfam0487497 pfam04874, Mak16, Mak16 protein C-terminal region 5e-04
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 5e-04
COG5137279 COG5137, COG5137, Histone chaperone involved in ge 5e-04
pfam04006 613 pfam04006, Mpp10, Mpp10 protein 5e-04
COG2058109 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP 5e-04
pfam01056329 pfam01056, Myc_N, Myc amino-terminal region 5e-04
pfam05285317 pfam05285, SDA1, SDA1 6e-04
pfam03344715 pfam03344, Daxx, Daxx Family 6e-04
pfam04889241 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont 6e-04
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 6e-04
PTZ00248319 PTZ00248, PTZ00248, eukaryotic translation initiat 6e-04
pfam00183 529 pfam00183, HSP90, Hsp90 protein 6e-04
pfam04546211 pfam04546, Sigma70_ner, Sigma-70, non-essential re 6e-04
pfam09805134 pfam09805, Nop25, Nucleolar protein 12 (25kDa) 6e-04
pfam09026101 pfam09026, Cenp-B_dimeris, Centromere protein B di 6e-04
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 6e-04
COG2058109 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP 6e-04
pfam09747178 pfam09747, DUF2052, Coiled-coil domain containing 6e-04
pfam06991277 pfam06991, Prp19_bind, Splicing factor, Prp19-bind 6e-04
pfam11708236 pfam11708, Slu7, Pre-mRNA splicing Prp18-interacti 6e-04
pfam05285317 pfam05285, SDA1, SDA1 7e-04
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 7e-04
pfam06213282 pfam06213, CobT, Cobalamin biosynthesis protein Co 7e-04
PRK14160211 PRK14160, PRK14160, heat shock protein GrpE; Provi 7e-04
pfam04050171 pfam04050, Upf2, Up-frameshift suppressor 2 7e-04
PRK14891131 PRK14891, PRK14891, 50S ribosomal protein L24e/unk 7e-04
pfam0487497 pfam04874, Mak16, Mak16 protein C-terminal region 7e-04
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 7e-04
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 7e-04
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 7e-04
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 7e-04
pfam04774106 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA bindi 7e-04
smart00784106 smart00784, SPT2, SPT2 chromatin protein 7e-04
pfam1194292 pfam11942, Spt5_N, Spt5 transcription elongation f 7e-04
pfam04050171 pfam04050, Upf2, Up-frameshift suppressor 2 8e-04
PRK12329449 PRK12329, nusA, transcription elongation factor Nu 8e-04
pfam04006 613 pfam04006, Mpp10, Mpp10 protein 8e-04
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 8e-04
pfam09026101 pfam09026, Cenp-B_dimeris, Centromere protein B di 9e-04
pfam09747178 pfam09747, DUF2052, Coiled-coil domain containing 9e-04
pfam05285317 pfam05285, SDA1, SDA1 0.001
pfam05285317 pfam05285, SDA1, SDA1 0.001
pfam03344715 pfam03344, Daxx, Daxx Family 0.001
pfam07133164 pfam07133, Merozoite_SPAM, Merozoite surface prote 0.001
pfam04889241 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont 0.001
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 0.001
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 0.001
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 0.001
pfam05764238 pfam05764, YL1, YL1 nuclear protein 0.001
pfam06213282 pfam06213, CobT, Cobalamin biosynthesis protein Co 0.001
COG54061001 COG5406, COG5406, Nucleosome binding factor SPN, S 0.001
COG54061001 COG5406, COG5406, Nucleosome binding factor SPN, S 0.001
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 0.001
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 0.001
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 0.001
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 0.001
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 0.001
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 0.001
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 0.001
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 0.001
COG2058109 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP 0.001
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.001
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
COG5414392 COG5414, COG5414, TATA-binding protein-associated 0.001
pfam03896281 pfam03896, TRAP_alpha, Translocon-associated prote 0.001
pfam03896281 pfam03896, TRAP_alpha, Translocon-associated prote 0.001
pfam06991277 pfam06991, Prp19_bind, Splicing factor, Prp19-bind 0.001
pfam1194292 pfam11942, Spt5_N, Spt5 transcription elongation f 0.001
pfam1194292 pfam11942, Spt5_N, Spt5 transcription elongation f 0.001
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 0.001
COG1614470 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas 0.001
pfam0517899 pfam05178, Kri1, KRI1-like family 0.001
pfam05320167 pfam05320, Pox_RNA_Pol_19, Poxvirus DNA-directed R 0.001
PRK13108460 PRK13108, PRK13108, prolipoprotein diacylglyceryl 0.001
pfam0042888 pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro 0.001
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 0.001
pfam0303246 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ 0.001
pfam07133164 pfam07133, Merozoite_SPAM, Merozoite surface prote 0.002
pfam11081172 pfam11081, DUF2890, Protein of unknown function (D 0.002
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 0.002
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 0.002
pfam04050171 pfam04050, Upf2, Up-frameshift suppressor 2 0.002
COG54061001 COG5406, COG5406, Nucleosome binding factor SPN, S 0.002
PRK14891131 PRK14891, PRK14891, 50S ribosomal protein L24e/unk 0.002
PTZ00248319 PTZ00248, PTZ00248, eukaryotic translation initiat 0.002
PRK12329449 PRK12329, nusA, transcription elongation factor Nu 0.002
PRK12329449 PRK12329, nusA, transcription elongation factor Nu 0.002
pfam00183529 pfam00183, HSP90, Hsp90 protein 0.002
pfam00183 529 pfam00183, HSP90, Hsp90 protein 0.002
pfam04546211 pfam04546, Sigma70_ner, Sigma-70, non-essential re 0.002
pfam09805134 pfam09805, Nop25, Nucleolar protein 12 (25kDa) 0.002
pfam09026101 pfam09026, Cenp-B_dimeris, Centromere protein B di 0.002
pfam09026101 pfam09026, Cenp-B_dimeris, Centromere protein B di 0.002
pfam02459548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 0.002
pfam02459548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 0.002
pfam02724 583 pfam02724, CDC45, CDC45-like protein 0.002
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 0.002
pfam05887145 pfam05887, Trypan_PARP, Procyclic acidic repetitiv 0.002
pfam04006 613 pfam04006, Mpp10, Mpp10 protein 0.002
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 0.002
COG2058109 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP 0.002
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 0.002
TIGR01651600 TIGR01651, CobT, cobaltochelatase, CobT subunit 0.002
pfam02029431 pfam02029, Caldesmon, Caldesmon 0.002
PRK05658 619 PRK05658, PRK05658, RNA polymerase sigma factor Rp 0.002
PRK05658 619 PRK05658, PRK05658, RNA polymerase sigma factor Rp 0.002
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 0.002
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 0.002
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 0.002
pfam09747178 pfam09747, DUF2052, Coiled-coil domain containing 0.002
PRK13108460 PRK13108, PRK13108, prolipoprotein diacylglyceryl 0.002
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.002
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.002
pfam09507427 pfam09507, CDC27, DNA polymerase subunit Cdc27 0.002
PRK05657325 PRK05657, PRK05657, RNA polymerase sigma factor Rp 0.002
pfam07222243 pfam07222, PBP_sp32, Proacrosin binding protein sp 0.002
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.002
pfam06524314 pfam06524, NOA36, NOA36 protein 0.002
pfam09538104 pfam09538, FYDLN_acid, Protein of unknown function 0.002
pfam11748115 pfam11748, DUF3306, Protein of unknown function (D 0.002
pfam03286198 pfam03286, Pox_Ag35, Pox virus Ag35 surface protei 0.002
pfam05285317 pfam05285, SDA1, SDA1 0.003
pfam04889241 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont 0.003
pfam08553794 pfam08553, VID27, VID27 cytoplasmic protein 0.003
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 0.003
COG4547620 COG4547, CobT, Cobalamin biosynthesis protein CobT 0.003
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.003
pfam09805134 pfam09805, Nop25, Nucleolar protein 12 (25kDa) 0.003
pfam04931784 pfam04931, DNA_pol_phi, DNA polymerase phi 0.003
pfam0487497 pfam04874, Mak16, Mak16 protein C-terminal region 0.003
pfam09073424 pfam09073, BUD22, BUD22 0.003
pfam02459548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 0.003
pfam05432291 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) 0.003
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 0.003
TIGR01651600 TIGR01651, CobT, cobaltochelatase, CobT subunit 0.003
PRK05658 619 PRK05658, PRK05658, RNA polymerase sigma factor Rp 0.003
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 0.003
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 0.003
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 0.003
pfam06390261 pfam06390, NESP55, Neuroendocrine-specific golgi p 0.003
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.003
pfam12619145 pfam12619, MCM2_N, Mini-chromosome maintenance pro 0.003
COG5414392 COG5414, COG5414, TATA-binding protein-associated 0.003
COG3343175 COG3343, RpoE, DNA-directed RNA polymerase, delta 0.003
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 0.003
COG1614470 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas 0.003
pfam0303246 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ 0.003
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.003
pfam05395170 pfam05395, DARPP-32, Protein phosphatase inhibitor 0.003
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 0.003
TIGR02907338 TIGR02907, spore_VI_D, stage VI sporulation protei 0.003
PRK05299258 PRK05299, rpsB, 30S ribosomal protein S2; Provisio 0.003
pfam1342299 pfam13422, DUF4110, Domain of unknown function (DU 0.003
pfam05285317 pfam05285, SDA1, SDA1 0.004
pfam04889241 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont 0.004
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 0.004
pfam06213282 pfam06213, CobT, Cobalamin biosynthesis protein Co 0.004
PRK14160211 PRK14160, PRK14160, heat shock protein GrpE; Provi 0.004
PRK14891131 PRK14891, PRK14891, 50S ribosomal protein L24e/unk 0.004
PRK14891131 PRK14891, PRK14891, 50S ribosomal protein L24e/unk 0.004
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.004
PRK12329449 PRK12329, nusA, transcription elongation factor Nu 0.004
pfam09805134 pfam09805, Nop25, Nucleolar protein 12 (25kDa) 0.004
pfam09805134 pfam09805, Nop25, Nucleolar protein 12 (25kDa) 0.004
pfam04931784 pfam04931, DNA_pol_phi, DNA polymerase phi 0.004
pfam02459548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 0.004
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 0.004
pfam05887145 pfam05887, Trypan_PARP, Procyclic acidic repetitiv 0.004
COG5137279 COG5137, COG5137, Histone chaperone involved in ge 0.004
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 0.004
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 0.004
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 0.004
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.004
pfam02029431 pfam02029, Caldesmon, Caldesmon 0.004
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 0.004
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 0.004
COG5414392 COG5414, COG5414, TATA-binding protein-associated 0.004
PRK02363129 PRK02363, PRK02363, DNA-directed RNA polymerase su 0.004
COG3343175 COG3343, RpoE, DNA-directed RNA polymerase, delta 0.004
pfam05320167 pfam05320, Pox_RNA_Pol_19, Poxvirus DNA-directed R 0.004
PRK13108460 PRK13108, PRK13108, prolipoprotein diacylglyceryl 0.004
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 0.004
pfam0303246 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ 0.004
pfam0303246 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ 0.004
PRK05657325 PRK05657, PRK05657, RNA polymerase sigma factor Rp 0.004
PRK05299258 PRK05299, rpsB, 30S ribosomal protein S2; Provisio 0.004
COG0576193 COG0576, GrpE, Molecular chaperone GrpE (heat shoc 0.004
pfam08597242 pfam08597, eIF3_subunit, Translation initiation fa 0.004
pfam14153185 pfam14153, Spore_coat_CotO, Spore coat protein Cot 0.004
>gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel Back     alignment and domain information
 Score = 66.5 bits (163), Expect = 1e-13
 Identities = 28/86 (32%), Positives = 41/86 (47%), Gaps = 15/86 (17%)

Query: 107 FLVISYIIGGAFLFSHWE---PWGFPDSAYFCFITLTTIGFGDFVPAQKSTDVQTAEETA 163
            L++  +I G   +S  E    W F D+ YF F+TLTTIG+GD VP            T 
Sbjct: 1   ILLLLVLIFGTVYYSLEEEGWGWDFLDALYFSFVTLTTIGYGDIVP-----------LTD 49

Query: 164 ELRIALCSLYLLFGIALLAMSFNLVQ 189
             R+    +Y+L GI L  +   ++ 
Sbjct: 50  AGRL-FTIIYILIGIPLFLLFLAVLG 74


This family includes the two membrane helix type ion channels found in bacteria. Length = 74

>gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) Back     alignment and domain information
>gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) Back     alignment and domain information
>gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein Back     alignment and domain information
>gnl|CDD|217829 pfam03985, Paf1, Paf1 Back     alignment and domain information
>gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel Back     alignment and domain information
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) Back     alignment and domain information
>gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT Back     alignment and domain information
>gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 Back     alignment and domain information
>gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region Back     alignment and domain information
>gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain Back     alignment and domain information
>gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain Back     alignment and domain information
>gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 Back     alignment and domain information
>gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 Back     alignment and domain information
>gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi Back     alignment and domain information
>gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region Back     alignment and domain information
>gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region Back     alignment and domain information
>gnl|CDD|220102 pfam09073, BUD22, BUD22 Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) Back     alignment and domain information
>gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region Back     alignment and domain information
>gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) Back     alignment and domain information
>gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) Back     alignment and domain information
>gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region Back     alignment and domain information
>gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein Back     alignment and domain information
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein Back     alignment and domain information
>gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|217829 pfam03985, Paf1, Paf1 Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein Back     alignment and domain information
>gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT Back     alignment and domain information
>gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region Back     alignment and domain information
>gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region Back     alignment and domain information
>gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region Back     alignment and domain information
>gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon Back     alignment and domain information
>gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|115071 pfam06390, NESP55, Neuroendocrine-specific golgi protein P55 (NESP55) Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT Back     alignment and domain information
>gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 Back     alignment and domain information
>gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 Back     alignment and domain information
>gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region Back     alignment and domain information
>gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain Back     alignment and domain information
>gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region Back     alignment and domain information
>gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region Back     alignment and domain information
>gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region Back     alignment and domain information
>gnl|CDD|220102 pfam09073, BUD22, BUD22 Back     alignment and domain information
>gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein Back     alignment and domain information
>gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|221668 pfam12619, MCM2_N, Mini-chromosome maintenance protein 2 Back     alignment and domain information
>gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family Back     alignment and domain information
>gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) Back     alignment and domain information
>gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) Back     alignment and domain information
>gnl|CDD|217829 pfam03985, Paf1, Paf1 Back     alignment and domain information
>gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein Back     alignment and domain information
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 Back     alignment and domain information
>gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional Back     alignment and domain information
>gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional Back     alignment and domain information
>gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain Back     alignment and domain information
>gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 Back     alignment and domain information
>gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi Back     alignment and domain information
>gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region Back     alignment and domain information
>gnl|CDD|220102 pfam09073, BUD22, BUD22 Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit Back     alignment and domain information
>gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|177755 PLN00152, PLN00152, DNA-directed RNA polymerase; Provisional Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 Back     alignment and domain information
>gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 Back     alignment and domain information
>gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain Back     alignment and domain information
>gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region Back     alignment and domain information
>gnl|CDD|220102 pfam09073, BUD22, BUD22 Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family Back     alignment and domain information
>gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed Back     alignment and domain information
>gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) Back     alignment and domain information
>gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit Back     alignment and domain information
>gnl|CDD|225880 COG3343, RpoE, DNA-directed RNA polymerase, delta subunit [Transcription] Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein Back     alignment and domain information
>gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|216269 pfam01056, Myc_N, Myc amino-terminal region Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region Back     alignment and domain information
>gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) Back     alignment and domain information
>gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) Back     alignment and domain information
>gnl|CDD|219256 pfam06991, Prp19_bind, Splicing factor, Prp19-binding domain Back     alignment and domain information
>gnl|CDD|221177 pfam11708, Slu7, Pre-mRNA splicing Prp18-interacting factor Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 Back     alignment and domain information
>gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|218258 pfam04774, HABP4_PAI-RBP1, Hyaluronan / mRNA binding family Back     alignment and domain information
>gnl|CDD|214818 smart00784, SPT2, SPT2 chromatin protein Back     alignment and domain information
>gnl|CDD|221333 pfam11942, Spt5_N, Spt5 transcription elongation factor, acidic N-terminal Back     alignment and domain information
>gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 Back     alignment and domain information
>gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional Back     alignment and domain information
>gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain Back     alignment and domain information
>gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) Back     alignment and domain information
>gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein Back     alignment and domain information
>gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT Back     alignment and domain information
>gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] Back     alignment and domain information
>gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit Back     alignment and domain information
>gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit Back     alignment and domain information
>gnl|CDD|219256 pfam06991, Prp19_bind, Splicing factor, Prp19-binding domain Back     alignment and domain information
>gnl|CDD|221333 pfam11942, Spt5_N, Spt5 transcription elongation factor, acidic N-terminal Back     alignment and domain information
>gnl|CDD|221333 pfam11942, Spt5_N, Spt5 transcription elongation factor, acidic N-terminal Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|218482 pfam05178, Kri1, KRI1-like family Back     alignment and domain information
>gnl|CDD|218555 pfam05320, Pox_RNA_Pol_19, Poxvirus DNA-directed RNA polymerase 19 kDa subunit Back     alignment and domain information
>gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family Back     alignment and domain information
>gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) Back     alignment and domain information
>gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 Back     alignment and domain information
>gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional Back     alignment and domain information
>gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region Back     alignment and domain information
>gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) Back     alignment and domain information
>gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain Back     alignment and domain information
>gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) Back     alignment and domain information
>gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit Back     alignment and domain information
>gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon Back     alignment and domain information
>gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) Back     alignment and domain information
>gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 Back     alignment and domain information
>gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>gnl|CDD|148682 pfam07222, PBP_sp32, Proacrosin binding protein sp32 Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|115196 pfam06524, NOA36, NOA36 protein Back     alignment and domain information
>gnl|CDD|220284 pfam09538, FYDLN_acid, Protein of unknown function (FYDLN_acid) Back     alignment and domain information
>gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) Back     alignment and domain information
>gnl|CDD|217476 pfam03286, Pox_Ag35, Pox virus Ag35 surface protein Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein Back     alignment and domain information
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) Back     alignment and domain information
>gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi Back     alignment and domain information
>gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region Back     alignment and domain information
>gnl|CDD|220102 pfam09073, BUD22, BUD22 Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit Back     alignment and domain information
>gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|115071 pfam06390, NESP55, Neuroendocrine-specific golgi protein P55 (NESP55) Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|221668 pfam12619, MCM2_N, Mini-chromosome maintenance protein 2 Back     alignment and domain information
>gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] Back     alignment and domain information
>gnl|CDD|225880 COG3343, RpoE, DNA-directed RNA polymerase, delta subunit [Transcription] Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|218576 pfam05395, DARPP-32, Protein phosphatase inhibitor 1/DARPP-32 Back     alignment and domain information
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|234055 TIGR02907, spore_VI_D, stage VI sporulation protein D Back     alignment and domain information
>gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional Back     alignment and domain information
>gnl|CDD|222117 pfam13422, DUF4110, Domain of unknown function (DUF4110) Back     alignment and domain information
>gnl|CDD|218538 pfam05285, SDA1, SDA1 Back     alignment and domain information
>gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional Back     alignment and domain information
>gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) Back     alignment and domain information
>gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) Back     alignment and domain information
>gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) Back     alignment and domain information
>gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] Back     alignment and domain information
>gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed Back     alignment and domain information
>gnl|CDD|225880 COG3343, RpoE, DNA-directed RNA polymerase, delta subunit [Transcription] Back     alignment and domain information
>gnl|CDD|218555 pfam05320, Pox_RNA_Pol_19, Poxvirus DNA-directed RNA polymerase 19 kDa subunit Back     alignment and domain information
>gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family Back     alignment and domain information
>gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family Back     alignment and domain information
>gnl|CDD|235548 PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional Back     alignment and domain information
>gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 790
KOG4404|consensus350 100.0
KOG4404|consensus350 100.0
KOG1418|consensus433 99.94
KOG1418|consensus433 99.93
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 99.47
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 99.38
KOG3713|consensus477 99.21
PRK10537 393 voltage-gated potassium channel; Provisional 99.09
KOG3713|consensus477 99.02
KOG1419|consensus 654 98.82
PRK10537393 voltage-gated potassium channel; Provisional 98.76
KOG1420|consensus 1103 98.74
KOG1545|consensus507 98.71
PLN03192 823 Voltage-dependent potassium channel; Provisional 98.65
KOG1545|consensus507 98.62
KOG1419|consensus654 98.59
PLN03192823 Voltage-dependent potassium channel; Provisional 98.48
KOG4390|consensus 632 98.26
KOG3193|consensus 1087 98.16
KOG1420|consensus 1103 98.14
KOG4390|consensus632 97.98
KOG0498|consensus 727 97.92
KOG3684|consensus489 97.77
KOG3684|consensus 489 97.72
KOG0498|consensus 727 97.67
PF01007 336 IRK: Inward rectifier potassium channel; InterPro: 97.36
KOG0501|consensus 971 97.09
KOG3193|consensus 1087 96.55
KOG0501|consensus971 96.5
PF01007336 IRK: Inward rectifier potassium channel; InterPro: 95.95
TIGR00933390 2a38 potassium uptake protein, TrkH family. The pr 91.8
PF00520200 Ion_trans: Ion transport protein calcium channel s 91.61
KOG0500|consensus 536 91.49
KOG0500|consensus536 89.8
KOG3827|consensus 400 89.47
PF00520200 Ion_trans: Ion transport protein calcium channel s 88.51
PRK10750483 potassium transporter; Provisional 84.44
KOG0499|consensus 815 82.31
KOG3827|consensus400 81.62
>KOG4404|consensus Back     alignment and domain information
Probab=100.00  E-value=2.9e-37  Score=315.55  Aligned_cols=239  Identities=27%  Similarity=0.437  Sum_probs=175.6

Q ss_pred             HHHHHHHHHHHhhccceeeeccccccccCCCCCccccchhhc-----hhchHHHHHHHHHhh-----hhhhccccceeee
Q psy17959        273 TLCLMIMVGYIYGGAVLFSKWEDWNILDGSRSSSRSRSRQQT-----ERSFTEKCKDYLRQF-----LAFLFSNIGIICL  342 (790)
Q Consensus       273 ~~~~~~~v~y~~~Ga~iF~~~E~~~~~~~~~~~~~~~~~~~~-----~~~~~e~~~~~~~~~-----~~~~f~~~~~~~~  342 (790)
                      ..+++..+.|+++||+||.++|.++|.++++.-..+..+...     +.++.+..--+.+.-     ..|.|..+++|..
T Consensus        10 l~Livct~tYLLvGAaVFdaLEse~E~~~r~~l~~~~~~~~~kyn~s~~d~r~~er~i~~s~ph~ag~qWkF~GaFYFa~   89 (350)
T KOG4404|consen   10 LLLIVCTFTYLLVGAAVFDALESENEARERERLERRLANLKRKYNLSEEDYRELERVILKSEPHKAGPQWKFAGAFYFAT   89 (350)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcCcchHHHHHHHHHHHHHHHHhhCCCHHHHHHHHHHHHhcCccccccccccCcceEEEE
Confidence            344455677999999999999999888875433333332222     222222211111111     2399998887765


Q ss_pred             EEEEEeecccccccccCCcceehhhHHHHhHHHHHHHHHHhhHHHHHHhHHHHhhccccccCCCCCccccchhccccccc
Q psy17959        343 VIGYTIAGYGNVAPITFLGKITTIAYAIAGMPLFLLYLSNIGDILAKSFKWIYAKCCLCRGCPTRPRDLQKTIQDTTGAY  422 (790)
Q Consensus       343 ~~~~ttiGyg~~~p~t~~g~~~~i~y~~~gipl~~~~~~~~g~~l~~~~~~~~~~~~~~~~~~~~~~~~~k~i~~~~~~~  422 (790)
                       |++||||||+.+|.|.+||+|||+||++|||+.++.+..+|+.+...+..+.+++.++.+                   
T Consensus        90 -TVItTIGyGhstP~T~~GK~Fcm~Yal~Gipl~lvmFqs~gERlnt~~ayil~~~r~~~~-------------------  149 (350)
T KOG4404|consen   90 -TVITTIGYGHSTPSTDGGKAFCMFYALVGIPLTLVMFQSIGERLNTFVAYILRRCRRRLG-------------------  149 (350)
T ss_pred             -EEEeeeccCCCCCCCcCceehhhhHHHhcCchHHHHHHHHHHHHHHHHHHHHHHHHHHhc-------------------
Confidence             777999999999999999999999999999999999999999999999887655332211                   


Q ss_pred             cccccccccccccccccCCCCCccCCCCCCCccccCCchhhhhhhchhhhhhhhhhhhhhHhhhhcccccccccCCCCCC
Q psy17959        423 NRRRSSAMNHNRRWNARNGDSEYEDSDFDTSDEEYDSSEEEEEEEEDEEEEEEEEEEEEEEEEEEGEEEETETASSSTAK  502 (790)
Q Consensus       423 ~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~ee~~~~~e~e~e~~~e~ee~~e~e~e~~ee~~~~~~~s~~~~  502 (790)
                                .+.+..    +                                                           
T Consensus       150 ----------~r~~~~----S-----------------------------------------------------------  156 (350)
T KOG4404|consen  150 ----------RRRWDV----S-----------------------------------------------------------  156 (350)
T ss_pred             ----------cccCCC----c-----------------------------------------------------------
Confidence                      000100    0                                                           


Q ss_pred             CCCceeeehHHHHHHHHHHhhhhhceeeecccccCcccceeEEEEeecccccCCCccCCCcCCCCCCcccchhhhHHHHH
Q psy17959        503 NDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIVPGDKITGKNNDIGVQTLELSFILC  582 (790)
Q Consensus       503 ~~~~~~~~~~~~~l~~~~~~i~~ga~~f~~~e~w~~~da~Yf~~itltTIGfGD~~P~~~~~~~~~~~~~~~~~~~~~~~  582 (790)
                           ..-.+.+.+...++.++.||++|+..|+|+|+||+||||||+|||||||+|+.++...      -+..+.|..+.
T Consensus       157 -----~~~l~~i~~~~~~~~i~~gaa~fs~~E~Wsyfds~YyCFITltTIGFGDyValQ~~~a------lq~qplYv~~s  225 (350)
T KOG4404|consen  157 -----VYNLVLILFTACILLICCGAAMFSSVEGWSYFDSYYYCFITLTTIGFGDYVALQQDAA------LQSQPLYVFFS  225 (350)
T ss_pred             -----HHHHHHHHHHHHHHHHHhhHHHhhcccCcchhhhhheeeeeeeeccccchhhhcchhh------hhCCCceehHh
Confidence                 0013455556667789999999999999999999999999999999999999866322      24556788999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHH
Q psy17959        583 AMYLMLGMALIAMCFNLMQEEVVHKMRTCSEVT  615 (790)
Q Consensus       583 ~~~il~Gl~~~~~~~~~~~~~~~~~~~~~~~~~  615 (790)
                      ++||++|+++++.++|++.-.+.....+..++.
T Consensus       226 f~fIL~Gl~vi~a~~NllvLrf~t~~~~~~rr~  258 (350)
T KOG4404|consen  226 FVFILLGLCVIYALLNLLVLRFMTMNAEDERRD  258 (350)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHH
Confidence            999999999999999998877666544444433



>KOG4404|consensus Back     alignment and domain information
>KOG1418|consensus Back     alignment and domain information
>KOG1418|consensus Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>KOG3713|consensus Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>KOG3713|consensus Back     alignment and domain information
>KOG1419|consensus Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>KOG1420|consensus Back     alignment and domain information
>KOG1545|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG1545|consensus Back     alignment and domain information
>KOG1419|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4390|consensus Back     alignment and domain information
>KOG3193|consensus Back     alignment and domain information
>KOG1420|consensus Back     alignment and domain information
>KOG4390|consensus Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>KOG3684|consensus Back     alignment and domain information
>KOG3684|consensus Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>KOG3193|consensus Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>TIGR00933 2a38 potassium uptake protein, TrkH family Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>KOG3827|consensus Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>PRK10750 potassium transporter; Provisional Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>KOG3827|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query790
3um7_A309 Crystal Structure Of The Human Two Pore Domain K+ I 1e-11
3ukm_A280 Crystal Structure Of The Human Two Pore Domain Pota 6e-10
3ukm_A280 Crystal Structure Of The Human Two Pore Domain Pota 3e-07
3ukm_A280 Crystal Structure Of The Human Two Pore Domain Pota 5e-05
4h33_A137 Crystal Structure Of A Voltage-gated K+ Channel Por 7e-04
>pdb|3UM7|A Chain A, Crystal Structure Of The Human Two Pore Domain K+ Ion Channel Traak (K2p4.1) Length = 309 Back     alignment and structure

Iteration: 1

Score = 68.6 bits (166), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 65/216 (30%), Positives = 101/216 (46%), Gaps = 49/216 (22%) Query: 16 DRGSPF---KEILSSVPGYGHIAPKTTLGKVATIFYAIVGIPLMLLCLSNIGDIMAHSFR 72 D GS F I++++ GYG++A +T G++ IFYA+VGIPL + L+ +GD + S R Sbjct: 115 DLGSAFFFSGTIITTI-GYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLR 173 Query: 73 FLYWKDFDFFTEYYDTKGVGNAEQI---KPVPIWLC------VFLVIS---YIIGGAFLF 120 G+G+ E I VP L +FL+I +++ F+F Sbjct: 174 ----------------HGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVF 217 Query: 121 SHWEPWGFPDSAYFCFITLTTIGFGDFV----PAQKSTDVQTAEETAELRIALCSLYLLF 176 + E W ++ YF +TLTT+GFGD+V P Q S Q L ++L Sbjct: 218 CYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQP----------LVWFWILL 267 Query: 177 GIALLAMSFNLVQE--EVISNVKAIAKHLGIIKSSN 210 G+A A + V+S + A+ G+ SN Sbjct: 268 GLAYFASVLTTIGNWLRVVSR-RTRAEMGGLTAQSN 302
>pdb|3UKM|A Chain A, Crystal Structure Of The Human Two Pore Domain Potassium Ion Channel K2p1 (Twik-1) Length = 280 Back     alignment and structure
>pdb|3UKM|A Chain A, Crystal Structure Of The Human Two Pore Domain Potassium Ion Channel K2p1 (Twik-1) Length = 280 Back     alignment and structure
>pdb|3UKM|A Chain A, Crystal Structure Of The Human Two Pore Domain Potassium Ion Channel K2p1 (Twik-1) Length = 280 Back     alignment and structure
>pdb|4H33|A Chain A, Crystal Structure Of A Voltage-gated K+ Channel Pore Module In A Closed State In Lipid Membranes, Tetragonal Crystal Form Length = 137 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query790
3um7_A309 Potassium channel subfamily K member 4; potassium 99.97
3ukm_A280 Potassium channel subfamily K member 1; membrane p 99.97
3um7_A309 Potassium channel subfamily K member 4; potassium 99.96
3ukm_A280 Potassium channel subfamily K member 1; membrane p 99.96
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 99.67
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 99.66
3ouf_A97 Potassium channel protein; ION channel, membrane, 99.63
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 99.62
2q67_A114 Potassium channel protein; inverted teepee, helix 99.61
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 99.57
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 99.57
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 99.56
3ouf_A97 Potassium channel protein; ION channel, membrane, 99.56
2a9h_A155 Voltage-gated potassium channel; potassium channel 99.55
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 99.55
2q67_A114 Potassium channel protein; inverted teepee, helix 99.53
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 99.53
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 99.51
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 99.5
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 99.47
2a9h_A155 Voltage-gated potassium channel; potassium channel 99.45
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 99.43
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 99.42
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 99.33
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 99.33
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 99.25
1lnq_A 336 MTHK channels, potassium channel related protein; 99.23
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 99.17
3beh_A 355 MLL3241 protein; transmembrane protein, membrane p 99.17
1xl4_A 301 Inward rectifier potassium channel; integral membr 99.13
1lnq_A336 MTHK channels, potassium channel related protein; 99.07
1p7b_A 333 Integral membrane channel and cytosolic domains; t 99.05
2qks_A 321 KIR3.1-prokaryotic KIR channel chimera; G-protein 99.04
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 98.93
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 98.91
4gx0_A565 TRKA domain protein; membrane protein, ION channel 98.91
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 98.87
1xl4_A301 Inward rectifier potassium channel; integral membr 98.85
1p7b_A333 Integral membrane channel and cytosolic domains; t 98.83
2qks_A321 KIR3.1-prokaryotic KIR channel chimera; G-protein 98.8
3sya_A 340 G protein-activated inward rectifier potassium CH; 98.69
3spc_A 343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 98.6
3sya_A340 G protein-activated inward rectifier potassium CH; 98.3
3spc_A343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 98.07
3rvy_A285 ION transport protein; tetrameric ION channel, vol 97.95
3rvy_A285 ION transport protein; tetrameric ION channel, vol 97.68
4dxw_A229 Navrh, ION transport protein; tetrameric, voltage- 91.62
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 86.91
4dxw_A229 Navrh, ION transport protein; tetrameric, voltage- 80.94
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
Probab=99.97  E-value=8.2e-33  Score=293.20  Aligned_cols=229  Identities=23%  Similarity=0.323  Sum_probs=164.7

Q ss_pred             HHHHHHHHHHhhccceeeeccccccccCCCCCccc------cchhhchhchHHHHHHHHHh----------------hhh
Q psy17959        274 LCLMIMVGYIYGGAVLFSKWEDWNILDGSRSSSRS------RSRQQTERSFTEKCKDYLRQ----------------FLA  331 (790)
Q Consensus       274 ~~~~~~v~y~~~Ga~iF~~~E~~~~~~~~~~~~~~------~~~~~~~~~~~e~~~~~~~~----------------~~~  331 (790)
                      .+++.+++|+++||++|+++|+++|.+.+++-...      +..+.++.++.+-.+.....                ...
T Consensus        34 ~Ll~~~~~YL~~GA~vF~~LE~~~E~~~~~~l~~~~~~fl~~~~~~~~~~l~~l~~~v~~A~~~Gv~~~~~~~~~~~~~~  113 (309)
T 3um7_A           34 ALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETQSTSQSSHSA  113 (309)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTTTCCCHHHHHHHHHGGGTSSCCCSCSHHHHHHHHHHHHHHHTTCCCSSCCCC-----C
T ss_pred             HHHHHHHHHHHHHHHHHHHHhCCcHHHHHHHHHHHHHHHHHhcccccHHHHHHHHHHHHHHHhcCCCccccccCCCCCCC
Confidence            35666788999999999999999987764221111      11112233333222222211                134


Q ss_pred             hhccccceeeeEEEEEeecccccccccCCcceehhhHHHHhHHHHHHHHHHhhHHHHHHhHHHHhhccccccCCCCCccc
Q psy17959        332 FLFSNIGIICLVIGYTIAGYGNVAPITFLGKITTIAYAIAGMPLFLLYLSNIGDILAKSFKWIYAKCCLCRGCPTRPRDL  411 (790)
Q Consensus       332 ~~f~~~~~~~~~~~~ttiGyg~~~p~t~~g~~~~i~y~~~gipl~~~~~~~~g~~l~~~~~~~~~~~~~~~~~~~~~~~~  411 (790)
                      |+|.++++|+.+ .+|||||||++|.|..||+||++|+++|||++.++++.+++.+.+.+++...+...+..        
T Consensus       114 w~~~~a~yf~~~-t~tTvGYGdi~P~T~~gk~~~i~~~l~Gi~~~~~~~~~i~~~l~~~~~~~i~~le~~~~--------  184 (309)
T 3um7_A          114 WDLGSAFFFSGT-IITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFL--------  184 (309)
T ss_dssp             CSHHHHHHHHHH-HHTSCCCCSSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHT--------
T ss_pred             CChhhhhHhhhe-eeeecccCCCCCCCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHh--------
Confidence            999999988775 45999999999999999999999999999999999999999998877655433211100        


Q ss_pred             cchhccccccccccccccccccccccccCCCCCccCCCCCCCccccCCchhhhhhhchhhhhhhhhhhhhhHhhhhcccc
Q psy17959        412 QKTIQDTTGAYNRRRSSAMNHNRRWNARNGDSEYEDSDFDTSDEEYDSSEEEEEEEEDEEEEEEEEEEEEEEEEEEGEEE  491 (790)
Q Consensus       412 ~k~i~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~ee~~~~~e~e~e~~~e~ee~~e~e~e~~ee~  491 (790)
                                  +++..                                                               
T Consensus       185 ------------~~~~~---------------------------------------------------------------  189 (309)
T 3um7_A          185 ------------KWHVP---------------------------------------------------------------  189 (309)
T ss_dssp             ------------TTC-----------------------------------------------------------------
T ss_pred             ------------ccccc---------------------------------------------------------------
Confidence                        00000                                                               


Q ss_pred             cccccCCCCCCCCCceeeehHHHHHHHHHHhhhhhceeeecccccCcccceeEEEEeecccccCCCccCCCcCCCCCCcc
Q psy17959        492 ETETASSSTAKNDPQMVTVPITLCLMIMVGYIYGGAVLFSKWEDWNILDGSYFCFISLSTIGFGDIVPGDKITGKNNDIG  571 (790)
Q Consensus       492 ~~~~~~s~~~~~~~~~~~~~~~~~l~~~~~~i~~ga~~f~~~e~w~~~da~Yf~~itltTIGfGD~~P~~~~~~~~~~~~  571 (790)
                                 .........+.+.++.+++++++|+++|+..|+|+|.||+|||++|+|||||||++|.++.++      
T Consensus       190 -----------~~~~~~~~~~l~~~~~~~~~l~~ga~~~~~~E~~~~~da~y~~~vTltTvGyGd~~p~t~~g~------  252 (309)
T 3um7_A          190 -----------PELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQ------  252 (309)
T ss_dssp             -----------CCHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHCCCHHHHHHHHHHHHTTCCCSSCCTTCCTTC------
T ss_pred             -----------hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHhheeccccCCCCCCCcccc------
Confidence                       000001112334455667889999999999999999999999999999999999999988776      


Q ss_pred             cchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy17959        572 VQTLELSFILCAMYLMLGMALIAMCFNLMQEEVV  605 (790)
Q Consensus       572 ~~~~~~~~~~~~~~il~Gl~~~~~~~~~~~~~~~  605 (790)
                        ..+.|++++++|+++|+++++++++.+.+.+.
T Consensus       253 --~~~~y~~~~~~~il~Gl~~~a~~~~~i~~~~~  284 (309)
T 3um7_A          253 --DSPAYQPLVWFWILLGLAYFASVLTTIGNWLR  284 (309)
T ss_dssp             --CCSTHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             --ccchHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence              23468899999999999999999998766544



>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Back     alignment and structure
>3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* Back     alignment and structure
>3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* Back     alignment and structure
>4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 790
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 5e-18
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 2e-16
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 2e-14
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 1e-10
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 2e-06
d1p7ba2116 f.14.1.1 (A:36-151) Inward rectifier potassium cha 2e-07
d1p7ba2116 f.14.1.1 (A:36-151) Inward rectifier potassium cha 8e-04
d1xl4a2116 f.14.1.1 (A:23-138) Inward rectifier potassium cha 3e-06
d1xl4a2116 f.14.1.1 (A:23-138) Inward rectifier potassium cha 5e-04
d1r3jc_103 f.14.1.1 (C:) Potassium channel protein {Streptomy 1e-05
d1r3jc_103 f.14.1.1 (C:) Potassium channel protein {Streptomy 1e-04
d1qkla_127 a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 3e-04
d1qkla_127 a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 4e-04
d2ayua1301 d.305.1.1 (A:70-370) Nucleosome assembly protein, 4e-04
d1ofcx3102 a.187.1.1 (X:697-798) HAND domain of the nucleosom 7e-04
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Voltage-gated potassium channels
superfamily: Voltage-gated potassium channels
family: Voltage-gated potassium channels
domain: Potassium channel-related protein MthK
species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]
 Score = 77.1 bits (190), Expect = 5e-18
 Identities = 22/90 (24%), Positives = 37/90 (41%), Gaps = 12/90 (13%)

Query: 101 PIWLCVFLVISYIIGGAFLFSHWEPWGFPDSAYFCFITLTTIGFGDFVPAQKSTDVQTAE 160
           P    + LV++ II G   F   E   +  S Y+ F+T+ T+G+GD+ P           
Sbjct: 1   PATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSP----------- 49

Query: 161 ETAELRIALCSLYLLFGIALLAMSFNLVQE 190
            T           ++ GI   A++   + E
Sbjct: 50  STPLGMY-FTVTLIVLGIGTFAVAVERLLE 78


>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 Back     information, alignment and structure
>d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d2ayua1 d.305.1.1 (A:70-370) Nucleosome assembly protein, NAP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 102 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query790
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 99.62
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 99.54
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 99.46
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 99.46
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 99.3
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 99.27
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 99.08
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 99.03
d2h8pc157 Potassium channel protein {Streptomyces coelicolor 98.25
d2h8pc157 Potassium channel protein {Streptomyces coelicolor 97.22
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Voltage-gated potassium channels
superfamily: Voltage-gated potassium channels
family: Voltage-gated potassium channels
domain: Potassium channel protein
species: Streptomyces coelicolor [TaxId: 1902]
Probab=99.62  E-value=2.1e-16  Score=139.64  Aligned_cols=88  Identities=15%  Similarity=0.290  Sum_probs=77.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhhcC-------CCccchhhheeeeeeccccCCcccCCCcccccccccchhhHHHHHH
Q psy17959        670 RVPIAVSFLIIISFILLGSLIFNKLEN-------WTFLDGTFFCFTSLGTIGFGELIPGESYDRTLRGNKNISVLVSSSY  742 (790)
Q Consensus       670 ~~~~~~~~~~~~~~~~~g~~~~~~~e~-------~s~~da~Y~~~vt~tTVGyGD~~p~t~~gr~~~~~~~~~~~~~~~~  742 (790)
                      ++.+..+++++++++++++..++..|+       .++.||+||+++|+|||||||++|.|+.||          ++++++
T Consensus         5 ~r~~~~~~~~~~~~~~~~s~~~~~~e~~~~~~~~~s~~~aly~~~vT~tTvGYGDi~P~t~~gr----------~~~~~~   74 (103)
T d1r3jc_           5 WRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGR----------CVAVVV   74 (103)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHTTSTTCCCCSHHHHHHHHHHHHTTCCCSSSCCCSHHHH----------HHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhccCCCcccCchhhhhhhheeeecccccCccccCChhHH----------HHHHHH
Confidence            445556666777778889999999885       489999999999999999999999999999          899999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q psy17959        743 ILVGMAVISMCFNLIQEEIIFMIKK  767 (790)
Q Consensus       743 ~~~g~~~~~~~~~~i~~~~~~~~~~  767 (790)
                      ++.|++++++.++.+++.+..+.++
T Consensus        75 ~~~Gi~~~~~~~~~i~~~~~~~~~~   99 (103)
T d1r3jc_          75 MVAGITSFGLVTAALATWFVGREQE   99 (103)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999998876554



>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure