Psyllid ID: psy1795


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
GDFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRRLIFHGTSKKCLAISTNKLKLTMQDCDEERSNQRWDFENYEADKISLLSDLL
cccccHHHHHHHHHHccccccccHHHHHccccccccccccccccEEEcccccccccccccccccEEEEccccccccEEEEcccccHHHHHHHHccc
cccccHHHHHHHHHHccccccHEEEccccccccccccccccEEEEEccccccccEccccccccEEEEEccccccccEEEEEEccccEHEccccccc
GDFGDVTSRKELRRNLGCKSFKWyldniypelfipgdavasgdrrlifhgtskkCLAISTNKLKLTMQdcdeersnqrwdfenyeADKISLLSDLL
gdfgdvtsrkelrrnlgcksfKWYLDNIYPELFIPGDAVASGDRRLIFHGtskkclaistnklkltmqDCDEErsnqrwdfenyeadkisllsdll
GDFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRRLIFHGTSKKCLAISTNKLKLTMQDCDEERSNQRWDFENYEADKISLLSDLL
*************RNLGCKSFKWYLDNIYPELFIPGDAVASGDRRLIFHGTSKKCLAISTNKLKLTMQ************F***************
*DFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRRLIFHGTSKKCLAISTNKLKLTMQDCDEERSNQRWDFENYEADKISLLSDLL
GDFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRRLIFHGTSKKCLAISTNKLKLTMQDCDEERSNQRWDFENYEADKISLLSDLL
*DFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRRLIFHGTSKKCLAISTNKLKLTMQDCDEERSNQRWDFENYEADKISL*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GDFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRRLIFHGTSKKCLAISTNKLKLTMQDCDEERSNQRWDFENYEADKISLLSDLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
Q95ZJ1626 Polypeptide N-acetylgalac yes N/A 0.447 0.068 0.755 8e-16
Q8MRC9650 Putative polypeptide N-ac yes N/A 0.812 0.12 0.493 1e-15
Q921L8608 Polypeptide N-acetylgalac yes N/A 0.947 0.149 0.371 9e-11
Q7K755605 Putative polypeptide N-ac no N/A 0.833 0.132 0.365 1e-10
Q8NCW6608 Polypeptide N-acetylgalac yes N/A 0.937 0.148 0.354 1e-10
Q8C102930 Polypeptide N-acetylgalac no N/A 0.770 0.079 0.387 6e-10
P34678612 Polypeptide N-acetylgalac no N/A 0.760 0.119 0.426 2e-09
Q7Z7M9940 Polypeptide N-acetylgalac no N/A 0.770 0.078 0.362 5e-09
Q6P6V1608 Polypeptide N-acetylgalac yes N/A 0.822 0.129 0.346 6e-09
O88422930 Polypeptide N-acetylgalac no N/A 0.770 0.079 0.362 1e-08
>sp|Q95ZJ1|GALT5_CAEEL Polypeptide N-acetylgalactosaminyltransferase 5 OS=Caenorhabditis elegans GN=gly-5 PE=2 SV=2 Back     alignment and function desciption
 Score = 82.4 bits (202), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 34/45 (75%), Positives = 42/45 (93%)

Query: 1   GDFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRR 45
           GDFGD++SRK+LR +LGCKSFKWYLDNIYPELF+PG++VA G+ R
Sbjct: 449 GDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGEVR 493




Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.
Caenorhabditis elegans (taxid: 6239)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 4EC: 1
>sp|Q8MRC9|GALT9_DROME Putative polypeptide N-acetylgalactosaminyltransferase 9 OS=Drosophila melanogaster GN=pgant9 PE=2 SV=2 Back     alignment and function description
>sp|Q921L8|GLT11_MOUSE Polypeptide N-acetylgalactosaminyltransferase 11 OS=Mus musculus GN=Galnt11 PE=2 SV=1 Back     alignment and function description
>sp|Q7K755|GLT11_CAEEL Putative polypeptide N-acetylgalactosaminyltransferase 11 OS=Caenorhabditis elegans GN=gly-11 PE=3 SV=2 Back     alignment and function description
>sp|Q8NCW6|GLT11_HUMAN Polypeptide N-acetylgalactosaminyltransferase 11 OS=Homo sapiens GN=GALNT11 PE=2 SV=2 Back     alignment and function description
>sp|Q8C102|GALT5_MOUSE Polypeptide N-acetylgalactosaminyltransferase 5 OS=Mus musculus GN=Galnt5 PE=2 SV=2 Back     alignment and function description
>sp|P34678|GALT3_CAEEL Polypeptide N-acetylgalactosaminyltransferase 3 OS=Caenorhabditis elegans GN=gly-3 PE=2 SV=2 Back     alignment and function description
>sp|Q7Z7M9|GALT5_HUMAN Polypeptide N-acetylgalactosaminyltransferase 5 OS=Homo sapiens GN=GALNT5 PE=1 SV=1 Back     alignment and function description
>sp|Q6P6V1|GLT11_RAT Polypeptide N-acetylgalactosaminyltransferase 11 OS=Rattus norvegicus GN=Galnt11 PE=2 SV=1 Back     alignment and function description
>sp|O88422|GALT5_RAT Polypeptide N-acetylgalactosaminyltransferase 5 OS=Rattus norvegicus GN=Galnt5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
91089275 586 PREDICTED: similar to n-acetylgalactosam 0.833 0.136 0.552 2e-16
195124241 670 GI18492 [Drosophila mojavensis] gi|19391 0.833 0.119 0.529 2e-16
3047191 623 GLY5a [Caenorhabditis elegans] 0.812 0.125 0.525 2e-16
345484986 610 PREDICTED: putative polypeptide N-acetyl 0.791 0.124 0.542 2e-16
71993513 623 Protein GLY-5, isoform b [Caenorhabditis 0.812 0.125 0.525 2e-16
341889853 597 hypothetical protein CAEBREN_10062 [Caen 0.916 0.147 0.381 3e-16
312379012 671 hypothetical protein AND_09241 [Anophele 0.812 0.116 0.530 3e-16
3047195 624 GLY5c [Caenorhabditis elegans] 0.791 0.121 0.506 3e-16
71993517 624 Protein GLY-5, isoform c [Caenorhabditis 0.791 0.121 0.506 3e-16
157114750 647 n-acetylgalactosaminyltransferase [Aedes 0.812 0.120 0.518 4e-16
>gi|91089275|ref|XP_970398.1| PREDICTED: similar to n-acetylgalactosaminyltransferase [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 55/85 (64%), Gaps = 5/85 (5%)

Query: 1   GDFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRRLIFHGTSKKCLAIST 60
           GDFGD+TSRK LR  LGCKSFKWYLDNIYPELFIPG+AVASG+ R +  G  K CL    
Sbjct: 418 GDFGDITSRKALREKLGCKSFKWYLDNIYPELFIPGEAVASGEIRNLGIG-GKTCLDSPA 476

Query: 61  NKLKLT----MQDCDEERSNQRWDF 81
            +  L     +  C  +  NQ W +
Sbjct: 477 RRSDLHKPVGLYPCHRQGGNQFWMY 501




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195124241|ref|XP_002006602.1| GI18492 [Drosophila mojavensis] gi|193911670|gb|EDW10537.1| GI18492 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|3047191|gb|AAC13671.1| GLY5a [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|345484986|ref|XP_003425168.1| PREDICTED: putative polypeptide N-acetylgalactosaminyltransferase 9-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|71993513|ref|NP_001022851.1| Protein GLY-5, isoform b [Caenorhabditis elegans] gi|14530626|emb|CAC42368.1| Protein GLY-5, isoform b [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|341889853|gb|EGT45788.1| hypothetical protein CAEBREN_10062 [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|312379012|gb|EFR25425.1| hypothetical protein AND_09241 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|3047195|gb|AAC13673.1| GLY5c [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|71993517|ref|NP_001022852.1| Protein GLY-5, isoform c [Caenorhabditis elegans] gi|14530627|emb|CAC42369.1| Protein GLY-5, isoform c [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|157114750|ref|XP_001652403.1| n-acetylgalactosaminyltransferase [Aedes aegypti] gi|108883556|gb|EAT47781.1| AAEL001121-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
WB|WBGene00001630626 gly-5 [Caenorhabditis elegans 0.822 0.126 0.487 1.5e-15
FB|FBgn0050463650 CG30463 [Drosophila melanogast 0.812 0.12 0.493 2.5e-15
UNIPROTKB|F1PSA3578 GALNT12 "Uncharacterized prote 0.364 0.060 0.628 1.6e-11
UNIPROTKB|E1BYU3608 GALNT11 "Uncharacterized prote 0.364 0.057 0.628 6.1e-11
UNIPROTKB|B7Z5G5527 GALNT11 "cDNA FLJ58212, highly 0.354 0.064 0.647 1e-10
RGD|1562001576 Galnt12 "UDP-N-acetyl-alpha-D- 0.364 0.060 0.657 1.1e-10
UNIPROTKB|Q8NCW6608 GALNT11 "Polypeptide N-acetylg 0.354 0.055 0.647 1.6e-10
MGI|MGI:2137594598 Wbscr17 "Williams-Beuren syndr 0.458 0.073 0.5 3.2e-10
UNIPROTKB|A6QLD9557 GALNTL1 "GALNTL1 protein" [Bos 0.510 0.087 0.5 3.2e-10
UNIPROTKB|Q6IS24598 WBSCR17 "Putative polypeptide 0.458 0.073 0.5 5.2e-10
WB|WBGene00001630 gly-5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 205 (77.2 bits), Expect = 1.5e-15, P = 1.5e-15
 Identities = 40/82 (48%), Positives = 53/82 (64%)

Query:     1 GDFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRR--LIFHGTSKKCLAI 58
             GDFGD++SRK+LR +LGCKSFKWYLDNIYPELF+PG++VA G+ R   +       C+  
Sbjct:   449 GDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGEVRNSAVQPARCLDCMVG 508

Query:    59 STNKLK-LTMQDCDEERSNQRW 79
                K + +    C  +  NQ W
Sbjct:   509 RHEKNRPVGTYQCHGQGGNQYW 530




GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=IEA
GO:0046854 "phosphatidylinositol phosphorylation" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0018243 "protein O-linked glycosylation via threonine" evidence=IDA
GO:0004653 "polypeptide N-acetylgalactosaminyltransferase activity" evidence=IDA
FB|FBgn0050463 CG30463 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1PSA3 GALNT12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYU3 GALNT11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z5G5 GALNT11 "cDNA FLJ58212, highly similar to PolypeptideN-acetylgalactosaminyltransferase 11 (EC 2.4.1.41)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1562001 Galnt12 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 12 (GalNAc-T12)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NCW6 GALNT11 "Polypeptide N-acetylgalactosaminyltransferase 11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2137594 Wbscr17 "Williams-Beuren syndrome chromosome region 17 homolog (human)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLD9 GALNTL1 "GALNTL1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q6IS24 WBSCR17 "Putative polypeptide N-acetylgalactosaminyltransferase-like protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q95ZJ1GALT5_CAEEL2, ., 4, ., 1, ., 4, 10.75550.44790.0686yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
cd02510299 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the fo 1e-11
pfam00652124 pfam00652, Ricin_B_lectin, Ricin-type beta-trefoil 3e-05
smart00458118 smart00458, RICIN, Ricin-type beta-trefoil 3e-04
cd00161124 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydr 4e-04
smart00458118 smart00458, RICIN, Ricin-type beta-trefoil 0.001
cd00161124 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydr 0.004
>gnl|CDD|133004 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
 Score = 58.8 bits (143), Expect = 1e-11
 Identities = 18/28 (64%), Positives = 23/28 (82%)

Query: 2   DFGDVTSRKELRRNLGCKSFKWYLDNIY 29
           D+GD++ RK LR  L CKSFKWYL+N+Y
Sbjct: 272 DYGDLSERKALRERLKCKSFKWYLENVY 299


UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferases (pp-GalNAc-T) initiate the formation of mucin-type, O-linked glycans by catalyzing the transfer of alpha-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to hydroxyl groups of Ser or Thr residues of core proteins to form the Tn antigen (GalNAc-a-1-O-Ser/Thr). These enzymes are type II membrane proteins with a GT-A type catalytic domain and a lectin domain located on the lumen side of the Golgi apparatus. In human, there are 15 isozymes of pp-GalNAc-Ts, representing the largest of all glycosyltransferase families. Each isozyme has unique but partially redundant substrate specificity for glycosylation sites on acceptor proteins. Length = 299

>gnl|CDD|216044 pfam00652, Ricin_B_lectin, Ricin-type beta-trefoil lectin domain Back     alignment and domain information
>gnl|CDD|214672 smart00458, RICIN, Ricin-type beta-trefoil Back     alignment and domain information
>gnl|CDD|238092 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>gnl|CDD|214672 smart00458, RICIN, Ricin-type beta-trefoil Back     alignment and domain information
>gnl|CDD|238092 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 96
KOG3736|consensus578 99.88
KOG3737|consensus603 99.8
KOG3738|consensus559 99.79
PF00652124 Ricin_B_lectin: Ricin-type beta-trefoil lectin dom 97.48
PF00652124 Ricin_B_lectin: Ricin-type beta-trefoil lectin dom 96.98
cd00161124 RICIN Ricin-type beta-trefoil; Carbohydrate-bindin 96.9
cd00161124 RICIN Ricin-type beta-trefoil; Carbohydrate-bindin 96.84
KOG3736|consensus578 96.63
smart00458117 RICIN Ricin-type beta-trefoil. Carbohydrate-bindin 96.56
smart00458117 RICIN Ricin-type beta-trefoil. Carbohydrate-bindin 96.47
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 95.85
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 95.23
KOG3737|consensus603 91.79
KOG3738|consensus559 84.87
PF03498150 CDtoxinA: Cytolethal distending toxin A/C family; 81.25
>KOG3736|consensus Back     alignment and domain information
Probab=99.88  E-value=3.5e-23  Score=166.93  Aligned_cols=82  Identities=39%  Similarity=0.754  Sum_probs=71.6

Q ss_pred             CCCCCchHHHHHHHHcCCcCchhchhccCcCCCCCCCC-cccceeEEEeecCCCceeeeeC----CCCeEEEEcCCCCCC
Q psy1795           1 GDFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDA-VASGDRRLIFHGTSKKCLAIST----NKLKLTMQDCDEERS   75 (96)
Q Consensus         1 ~~~Gdis~r~~LR~~L~CKsF~WyL~nVyPe~~~p~~~-~~~G~i~~i~~~~~~~CL~~~~----~~~~v~l~~C~~~~~   75 (96)
                      .++||||+|++||++|+||||+|||+|||||+++|.+. .++|+|   ++..++.|+|...    .|..+++++||+.+.
T Consensus       414 ~d~GDvseR~~LR~~L~CKsFkWyL~nVyPel~~~~~~~~~~G~i---~~~~~~~cld~~~~~~~~~~~~~~~~Ch~~~~  490 (578)
T KOG3736|consen  414 IDEGDLTERKALRERLNCKSFKWYLENVYPELYLPTPHVYASGEI---RNGNPNLCLDTERAPAGQGMAVGLYPCHGPGG  490 (578)
T ss_pred             cCCCCchhHHHHHHhcCCccccchHhhcCccccCCCCccccccee---ccCCcchhhhhhchhccCCCcceEecCCCccc
Confidence            47999999999999999999999999999999999766 678887   3367899999753    246899999999999


Q ss_pred             CcceEeeecC
Q psy1795          76 NQRWDFENYE   85 (96)
Q Consensus        76 ~Q~W~~~~~~   85 (96)
                      +|.|.++..+
T Consensus       491 ~Q~~~yT~~~  500 (578)
T KOG3736|consen  491 NQYFPYTKQG  500 (578)
T ss_pred             cccccccCCc
Confidence            9999988754



>KOG3737|consensus Back     alignment and domain information
>KOG3738|consensus Back     alignment and domain information
>PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis Back     alignment and domain information
>PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis Back     alignment and domain information
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>KOG3736|consensus Back     alignment and domain information
>smart00458 RICIN Ricin-type beta-trefoil Back     alignment and domain information
>smart00458 RICIN Ricin-type beta-trefoil Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>KOG3737|consensus Back     alignment and domain information
>KOG3738|consensus Back     alignment and domain information
>PF03498 CDtoxinA: Cytolethal distending toxin A/C family; InterPro: IPR003558 Escherichia coli, Haemophilus spp and Campylobacter spp Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
1xhb_A472 The Crystal Structure Of Udp-Galnac: Polypeptide Al 1e-08
2ffu_A501 Crystal Structure Of Human Ppgalnact-2 Complexed Wi 2e-08
>pdb|1XHB|A Chain A, The Crystal Structure Of Udp-Galnac: Polypeptide Alpha-N- Acetylgalactosaminyltransferase-T1 Length = 472 Back     alignment and structure

Iteration: 1

Score = 54.7 bits (130), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 35/118 (29%), Positives = 50/118 (42%), Gaps = 37/118 (31%) Query: 2 DFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRR---------------- 45 D+GD++SR LRR L CK F WYL+NIYP+ IP + G+ R Sbjct: 305 DYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKEN 364 Query: 46 --------------LIFHGTSKK-------CLAISTNKLKLTMQDCDEERSNQRWDFE 82 +F T+ K CL +S +TM C + NQ W+++ Sbjct: 365 EKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYD 422
>pdb|2FFU|A Chain A, Crystal Structure Of Human Ppgalnact-2 Complexed With Udp And Ea2 Length = 501 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 1e-17
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 2e-07
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 6e-16
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 8e-06
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 2e-10
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 5e-10
1dqg_A135 Mannose receptor; beta trefoil, multilectin recept 3e-04
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 Back     alignment and structure
 Score = 75.2 bits (184), Expect = 1e-17
 Identities = 34/117 (29%), Positives = 47/117 (40%), Gaps = 37/117 (31%)

Query: 2   DFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRRLIF------------- 48
           D+GD++SR  LRR L CK F WYL+NIYP+  IP    + G+ R +              
Sbjct: 305 DYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKEN 364

Query: 49  --------HGTSK----------------KCLAISTNKLKLTMQDCDEERSNQRWDF 81
                   HG                    CL +S     +TM  C   + NQ W++
Sbjct: 365 EKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEY 421


>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 Back     alignment and structure
>1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* Length = 135 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 99.86
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 99.86
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 99.81
3a21_A614 Putative secreted alpha-galactosidase; beta-alpha- 99.56
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 98.09
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 97.32
3a07_A118 Actinohivin; carbohydrate-binding module family 13 97.23
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 97.16
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 97.15
3a07_A118 Actinohivin; carbohydrate-binding module family 13 97.06
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 96.99
2ao3_A130 29-kDa galactose-binding lectin; earthworm lumbric 96.86
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 96.77
2aai_B262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 96.65
1ggp_B254 TKL-1, protein (lectin 1 B chain); sugar binding p 96.53
2ao3_A130 29-kDa galactose-binding lectin; earthworm lumbric 96.52
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 96.45
2dry_A130 29-kDa galactose-binding lectin; earthworm lumbric 96.44
2dry_A130 29-kDa galactose-binding lectin; earthworm lumbric 96.41
2aai_B262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 96.4
1m2t_B263 Mistletoe lectin I B chain; ribosome inactivation, 96.39
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 96.39
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 96.09
3c9z_A258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 96.02
1ggp_B 254 TKL-1, protein (lectin 1 B chain); sugar binding p 95.95
1abr_B267 Abrin-A; glycosidase/carbohydrate complex, lectin, 95.92
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 95.78
1abr_B 267 Abrin-A; glycosidase/carbohydrate complex, lectin, 95.75
1m2t_B263 Mistletoe lectin I B chain; ribosome inactivation, 95.65
3a21_A614 Putative secreted alpha-galactosidase; beta-alpha- 95.54
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 95.52
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 95.32
3c9z_A 258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 95.31
3phz_A 286 Ricin B-related lectin; beta trefoil, saccharide b 95.13
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 95.1
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 95.0
1dqg_A135 Mannose receptor; beta trefoil, multilectin recept 94.3
3ef2_A 293 Agglutinin, lectin; beta-trefoil, calcium-binding, 94.29
1dqg_A135 Mannose receptor; beta trefoil, multilectin recept 94.14
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 94.13
2vlc_A 570 Cinnamomin, type 2 ribosome-inactivating protein c 94.06
2vlc_A570 Cinnamomin, type 2 ribosome-inactivating protein c 94.03
3phz_A 286 Ricin B-related lectin; beta trefoil, saccharide b 93.75
3ef2_A 293 Agglutinin, lectin; beta-trefoil, calcium-binding, 93.58
1sr4_A206 CDT A, cytolethal distending toxin subunit A; bact 93.27
1ybi_A288 HA33A, HA33/A, non-toxin haemagglutinin HA34; beta 92.27
3aj6_A286 Main hemagglutinin component; toxin, beta-trefoil; 91.8
3aj6_A286 Main hemagglutinin component; toxin, beta-trefoil; 90.64
1xez_A 721 Hemolysin, cytolysin; pore-forming toxin, Pro-toxi 85.52
1sr4_A206 CDT A, cytolethal distending toxin subunit A; bact 82.78
2vse_A841 MTX holotoxin, mosquitocidal toxin; ADP-ribosyltra 81.61
1ybi_A288 HA33A, HA33/A, non-toxin haemagglutinin HA34; beta 80.99
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
Probab=99.86  E-value=2.6e-22  Score=153.98  Aligned_cols=81  Identities=35%  Similarity=0.701  Sum_probs=71.6

Q ss_pred             CCCCchHHHHHHHHcCCcCchhchhccCcCCCCCCCCcccceeEEEeecCCCceeeeeC--CCCeEEEEcCCCCCCCcce
Q psy1795           2 DFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRRLIFHGTSKKCLAIST--NKLKLTMQDCDEERSNQRW   79 (96)
Q Consensus         2 ~~Gdis~r~~LR~~L~CKsF~WyL~nVyPe~~~p~~~~~~G~i~~i~~~~~~~CL~~~~--~~~~v~l~~C~~~~~~Q~W   79 (96)
                      ++|||++|++||++|+||+|+|||+|||||+.+|.+..++|+|   ++..+++|||+..  .|..|.+.+||+.+++|+|
T Consensus       305 ~~g~~~~~~~lr~~l~~~~f~w~l~~v~p~~~~p~~~~~~g~i---~~~~~~~Cld~~~~~~g~~v~l~~C~~~~~nQ~w  381 (472)
T 1xhb_A          305 DYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEI---RNVETNQCLDNMARKENEKVGIFNCHGMGGNQVF  381 (472)
T ss_dssp             CCCCCHHHHHHHHHTTCCCHHHHHHHTCTTCSSCSSEEEEECE---EETTTCEEEECTTCCTTEECEEEECCSCCGGGCE
T ss_pred             CCCCHHHHHHHHHhcCCCCccchhhhhhhhhcccccccccceE---EECCCCccccccCCCCCCeEEEEeCCCCCcceeE
Confidence            6899999999999999999999999999999999887888876   6667899999753  5678999999998889999


Q ss_pred             EeeecC
Q psy1795          80 DFENYE   85 (96)
Q Consensus        80 ~~~~~~   85 (96)
                      .++..+
T Consensus       382 ~~~~~g  387 (472)
T 1xhb_A          382 SYTANK  387 (472)
T ss_dssp             EEETTS
T ss_pred             EEcccc
Confidence            997643



>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* Back     alignment and structure
>2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Back     alignment and structure
>3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* Back     alignment and structure
>3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* Back     alignment and structure
>1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Back     alignment and structure
>3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} Back     alignment and structure
>3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* Back     alignment and structure
>1sr4_A CDT A, cytolethal distending toxin subunit A; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: b.42.2.1 PDB: 2f2f_A Back     alignment and structure
>1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Back     alignment and structure
>3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Back     alignment and structure
>3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Back     alignment and structure
>1xez_A Hemolysin, cytolysin; pore-forming toxin, Pro-toxin, water- soluble monomer, beta-prism, beta-trefoil; HET: BOG; 2.30A {Vibrio cholerae} PDB: 3o44_A Back     alignment and structure
>1sr4_A CDT A, cytolethal distending toxin subunit A; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: b.42.2.1 PDB: 2f2f_A Back     alignment and structure
>2vse_A MTX holotoxin, mosquitocidal toxin; ADP-ribosyltransferase, lectin, ricin-B-like domain; 2.5A {Lysinibacillus sphaericus} PDB: 2vsa_A Back     alignment and structure
>1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 96
d1xhba2328 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosa 2e-13
d1xhba1131 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosa 2e-04
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 328 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 61.9 bits (149), Expect = 2e-13
 Identities = 19/30 (63%), Positives = 24/30 (80%)

Query: 2   DFGDVTSRKELRRNLGCKSFKWYLDNIYPE 31
           D+GD++SR  LRR L CK F WYL+NIYP+
Sbjct: 298 DYGDISSRLGLRRKLQCKPFSWYLENIYPD 327


>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 131 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d1xhba2328 Polypeptide N-acetylgalactosaminyltransferase 1, N 99.27
d1xhba1131 Polypeptide N-acetylgalactosaminyltransferase 1, C 98.27
d1dqga_134 Mannose receptor {Mouse (Mus musculus) [TaxId: 100 97.77
d1vcla2133 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 97.63
d1hwmb2131 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 97.59
d1dqga_134 Mannose receptor {Mouse (Mus musculus) [TaxId: 100 97.58
d1vcla1150 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 97.55
d2aaib2127 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 97.53
d1ggpb2128 Plant cytotoxin B-chain (lectin) {Mongolian snake- 97.52
d1xhba1131 Polypeptide N-acetylgalactosaminyltransferase 1, C 97.35
d1vcla1150 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 97.29
d1abrb2127 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 97.28
d1m2tb2126 Plant cytotoxin B-chain (lectin) {European mistlet 97.28
d1hwmb2131 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 97.26
d1hwmb1133 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 97.23
d1knma_129 Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas 97.19
d1ggpb1126 Plant cytotoxin B-chain (lectin) {Mongolian snake- 97.15
d1knma_129 Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas 97.06
d1sr4a_167 Cytolethal distending toxin subunit A {Haemophilus 96.97
d1rzob1135 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 96.86
d1abrb2127 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 96.82
d1m2tb2126 Plant cytotoxin B-chain (lectin) {European mistlet 96.81
d1vcla2133 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 96.8
d1abrb1140 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 96.64
d1ggpb1126 Plant cytotoxin B-chain (lectin) {Mongolian snake- 96.62
d1hwmb1133 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 96.58
d1m2tb1136 Plant cytotoxin B-chain (lectin) {European mistlet 96.57
d2aaib2127 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 96.55
d1ggpb2128 Plant cytotoxin B-chain (lectin) {Mongolian snake- 96.37
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 96.34
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 96.07
d2zqna1130 29-kDa galactose-binding lectin {Lumbricus terrest 96.01
d1rzob1135 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 95.67
d1abrb1140 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 95.51
d1qxma2138 Hemagglutinin component Ha1 {Clostridium botulinum 95.39
d1m2tb1136 Plant cytotoxin B-chain (lectin) {European mistlet 95.33
d2zqna1130 29-kDa galactose-binding lectin {Lumbricus terrest 95.08
d1sr4a_167 Cytolethal distending toxin subunit A {Haemophilus 94.71
d1qxma2138 Hemagglutinin component Ha1 {Clostridium botulinum 94.59
d1qxma1145 Hemagglutinin component Ha1 {Clostridium botulinum 94.44
d1qxma1145 Hemagglutinin component Ha1 {Clostridium botulinum 91.91
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 87.71
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 80.98
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.27  E-value=5.5e-13  Score=95.47  Aligned_cols=30  Identities=63%  Similarity=1.372  Sum_probs=29.0

Q ss_pred             CCCCchHHHHHHHHcCCcCchhchhccCcC
Q psy1795           2 DFGDVTSRKELRRNLGCKSFKWYLDNIYPE   31 (96)
Q Consensus         2 ~~Gdis~r~~LR~~L~CKsF~WyL~nVyPe   31 (96)
                      ++|||++|++||++|+||||+|||+|||||
T Consensus       298 ~~~~i~~r~~Lr~~l~ck~f~w~~~~~~~~  327 (328)
T d1xhba2         298 DYGDISSRLGLRRKLQCKPFSWYLENIYPD  327 (328)
T ss_dssp             CCCCCHHHHHHHHHTTCCCHHHHHHHTCTT
T ss_pred             CcccHHHHHHHHHHhCCCChHHHHhhCCCC
Confidence            579999999999999999999999999998



>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} Back     information, alignment and structure
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure