Psyllid ID: psy1795
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 96 | ||||||
| 91089275 | 586 | PREDICTED: similar to n-acetylgalactosam | 0.833 | 0.136 | 0.552 | 2e-16 | |
| 195124241 | 670 | GI18492 [Drosophila mojavensis] gi|19391 | 0.833 | 0.119 | 0.529 | 2e-16 | |
| 3047191 | 623 | GLY5a [Caenorhabditis elegans] | 0.812 | 0.125 | 0.525 | 2e-16 | |
| 345484986 | 610 | PREDICTED: putative polypeptide N-acetyl | 0.791 | 0.124 | 0.542 | 2e-16 | |
| 71993513 | 623 | Protein GLY-5, isoform b [Caenorhabditis | 0.812 | 0.125 | 0.525 | 2e-16 | |
| 341889853 | 597 | hypothetical protein CAEBREN_10062 [Caen | 0.916 | 0.147 | 0.381 | 3e-16 | |
| 312379012 | 671 | hypothetical protein AND_09241 [Anophele | 0.812 | 0.116 | 0.530 | 3e-16 | |
| 3047195 | 624 | GLY5c [Caenorhabditis elegans] | 0.791 | 0.121 | 0.506 | 3e-16 | |
| 71993517 | 624 | Protein GLY-5, isoform c [Caenorhabditis | 0.791 | 0.121 | 0.506 | 3e-16 | |
| 157114750 | 647 | n-acetylgalactosaminyltransferase [Aedes | 0.812 | 0.120 | 0.518 | 4e-16 |
| >gi|91089275|ref|XP_970398.1| PREDICTED: similar to n-acetylgalactosaminyltransferase [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 90.1 bits (222), Expect = 2e-16, Method: Compositional matrix adjust.
Identities = 47/85 (55%), Positives = 55/85 (64%), Gaps = 5/85 (5%)
Query: 1 GDFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRRLIFHGTSKKCLAIST 60
GDFGD+TSRK LR LGCKSFKWYLDNIYPELFIPG+AVASG+ R + G K CL
Sbjct: 418 GDFGDITSRKALREKLGCKSFKWYLDNIYPELFIPGEAVASGEIRNLGIG-GKTCLDSPA 476
Query: 61 NKLKLT----MQDCDEERSNQRWDF 81
+ L + C + NQ W +
Sbjct: 477 RRSDLHKPVGLYPCHRQGGNQFWMY 501
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195124241|ref|XP_002006602.1| GI18492 [Drosophila mojavensis] gi|193911670|gb|EDW10537.1| GI18492 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|3047191|gb|AAC13671.1| GLY5a [Caenorhabditis elegans] | Back alignment and taxonomy information |
|---|
| >gi|345484986|ref|XP_003425168.1| PREDICTED: putative polypeptide N-acetylgalactosaminyltransferase 9-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|71993513|ref|NP_001022851.1| Protein GLY-5, isoform b [Caenorhabditis elegans] gi|14530626|emb|CAC42368.1| Protein GLY-5, isoform b [Caenorhabditis elegans] | Back alignment and taxonomy information |
|---|
| >gi|341889853|gb|EGT45788.1| hypothetical protein CAEBREN_10062 [Caenorhabditis brenneri] | Back alignment and taxonomy information |
|---|
| >gi|312379012|gb|EFR25425.1| hypothetical protein AND_09241 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|3047195|gb|AAC13673.1| GLY5c [Caenorhabditis elegans] | Back alignment and taxonomy information |
|---|
| >gi|71993517|ref|NP_001022852.1| Protein GLY-5, isoform c [Caenorhabditis elegans] gi|14530627|emb|CAC42369.1| Protein GLY-5, isoform c [Caenorhabditis elegans] | Back alignment and taxonomy information |
|---|
| >gi|157114750|ref|XP_001652403.1| n-acetylgalactosaminyltransferase [Aedes aegypti] gi|108883556|gb|EAT47781.1| AAEL001121-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 96 | ||||||
| WB|WBGene00001630 | 626 | gly-5 [Caenorhabditis elegans | 0.822 | 0.126 | 0.487 | 1.5e-15 | |
| FB|FBgn0050463 | 650 | CG30463 [Drosophila melanogast | 0.812 | 0.12 | 0.493 | 2.5e-15 | |
| UNIPROTKB|F1PSA3 | 578 | GALNT12 "Uncharacterized prote | 0.364 | 0.060 | 0.628 | 1.6e-11 | |
| UNIPROTKB|E1BYU3 | 608 | GALNT11 "Uncharacterized prote | 0.364 | 0.057 | 0.628 | 6.1e-11 | |
| UNIPROTKB|B7Z5G5 | 527 | GALNT11 "cDNA FLJ58212, highly | 0.354 | 0.064 | 0.647 | 1e-10 | |
| RGD|1562001 | 576 | Galnt12 "UDP-N-acetyl-alpha-D- | 0.364 | 0.060 | 0.657 | 1.1e-10 | |
| UNIPROTKB|Q8NCW6 | 608 | GALNT11 "Polypeptide N-acetylg | 0.354 | 0.055 | 0.647 | 1.6e-10 | |
| MGI|MGI:2137594 | 598 | Wbscr17 "Williams-Beuren syndr | 0.458 | 0.073 | 0.5 | 3.2e-10 | |
| UNIPROTKB|A6QLD9 | 557 | GALNTL1 "GALNTL1 protein" [Bos | 0.510 | 0.087 | 0.5 | 3.2e-10 | |
| UNIPROTKB|Q6IS24 | 598 | WBSCR17 "Putative polypeptide | 0.458 | 0.073 | 0.5 | 5.2e-10 |
| WB|WBGene00001630 gly-5 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 205 (77.2 bits), Expect = 1.5e-15, P = 1.5e-15
Identities = 40/82 (48%), Positives = 53/82 (64%)
Query: 1 GDFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRR--LIFHGTSKKCLAI 58
GDFGD++SRK+LR +LGCKSFKWYLDNIYPELF+PG++VA G+ R + C+
Sbjct: 449 GDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGEVRNSAVQPARCLDCMVG 508
Query: 59 STNKLK-LTMQDCDEERSNQRW 79
K + + C + NQ W
Sbjct: 509 RHEKNRPVGTYQCHGQGGNQYW 530
|
|
| FB|FBgn0050463 CG30463 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PSA3 GALNT12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BYU3 GALNT11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7Z5G5 GALNT11 "cDNA FLJ58212, highly similar to PolypeptideN-acetylgalactosaminyltransferase 11 (EC 2.4.1.41)" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1562001 Galnt12 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 12 (GalNAc-T12)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8NCW6 GALNT11 "Polypeptide N-acetylgalactosaminyltransferase 11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2137594 Wbscr17 "Williams-Beuren syndrome chromosome region 17 homolog (human)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QLD9 GALNTL1 "GALNTL1 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6IS24 WBSCR17 "Putative polypeptide N-acetylgalactosaminyltransferase-like protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 96 | |||
| cd02510 | 299 | cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the fo | 1e-11 | |
| pfam00652 | 124 | pfam00652, Ricin_B_lectin, Ricin-type beta-trefoil | 3e-05 | |
| smart00458 | 118 | smart00458, RICIN, Ricin-type beta-trefoil | 3e-04 | |
| cd00161 | 124 | cd00161, RICIN, Ricin-type beta-trefoil; Carbohydr | 4e-04 | |
| smart00458 | 118 | smart00458, RICIN, Ricin-type beta-trefoil | 0.001 | |
| cd00161 | 124 | cd00161, RICIN, Ricin-type beta-trefoil; Carbohydr | 0.004 |
| >gnl|CDD|133004 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the formation of mucin-type O-linked glycans | Back alignment and domain information |
|---|
Score = 58.8 bits (143), Expect = 1e-11
Identities = 18/28 (64%), Positives = 23/28 (82%)
Query: 2 DFGDVTSRKELRRNLGCKSFKWYLDNIY 29
D+GD++ RK LR L CKSFKWYL+N+Y
Sbjct: 272 DYGDLSERKALRERLKCKSFKWYLENVY 299
|
UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferases (pp-GalNAc-T) initiate the formation of mucin-type, O-linked glycans by catalyzing the transfer of alpha-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to hydroxyl groups of Ser or Thr residues of core proteins to form the Tn antigen (GalNAc-a-1-O-Ser/Thr). These enzymes are type II membrane proteins with a GT-A type catalytic domain and a lectin domain located on the lumen side of the Golgi apparatus. In human, there are 15 isozymes of pp-GalNAc-Ts, representing the largest of all glycosyltransferase families. Each isozyme has unique but partially redundant substrate specificity for glycosylation sites on acceptor proteins. Length = 299 |
| >gnl|CDD|216044 pfam00652, Ricin_B_lectin, Ricin-type beta-trefoil lectin domain | Back alignment and domain information |
|---|
| >gnl|CDD|214672 smart00458, RICIN, Ricin-type beta-trefoil | Back alignment and domain information |
|---|
| >gnl|CDD|238092 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication | Back alignment and domain information |
|---|
| >gnl|CDD|214672 smart00458, RICIN, Ricin-type beta-trefoil | Back alignment and domain information |
|---|
| >gnl|CDD|238092 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| KOG3736|consensus | 578 | 99.88 | ||
| KOG3737|consensus | 603 | 99.8 | ||
| KOG3738|consensus | 559 | 99.79 | ||
| PF00652 | 124 | Ricin_B_lectin: Ricin-type beta-trefoil lectin dom | 97.48 | |
| PF00652 | 124 | Ricin_B_lectin: Ricin-type beta-trefoil lectin dom | 96.98 | |
| cd00161 | 124 | RICIN Ricin-type beta-trefoil; Carbohydrate-bindin | 96.9 | |
| cd00161 | 124 | RICIN Ricin-type beta-trefoil; Carbohydrate-bindin | 96.84 | |
| KOG3736|consensus | 578 | 96.63 | ||
| smart00458 | 117 | RICIN Ricin-type beta-trefoil. Carbohydrate-bindin | 96.56 | |
| smart00458 | 117 | RICIN Ricin-type beta-trefoil. Carbohydrate-bindin | 96.47 | |
| PF14200 | 105 | RicinB_lectin_2: Ricin-type beta-trefoil lectin do | 95.85 | |
| PF14200 | 105 | RicinB_lectin_2: Ricin-type beta-trefoil lectin do | 95.23 | |
| KOG3737|consensus | 603 | 91.79 | ||
| KOG3738|consensus | 559 | 84.87 | ||
| PF03498 | 150 | CDtoxinA: Cytolethal distending toxin A/C family; | 81.25 |
| >KOG3736|consensus | Back alignment and domain information |
|---|
Probab=99.88 E-value=3.5e-23 Score=166.93 Aligned_cols=82 Identities=39% Similarity=0.754 Sum_probs=71.6
Q ss_pred CCCCCchHHHHHHHHcCCcCchhchhccCcCCCCCCCC-cccceeEEEeecCCCceeeeeC----CCCeEEEEcCCCCCC
Q psy1795 1 GDFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDA-VASGDRRLIFHGTSKKCLAIST----NKLKLTMQDCDEERS 75 (96)
Q Consensus 1 ~~~Gdis~r~~LR~~L~CKsF~WyL~nVyPe~~~p~~~-~~~G~i~~i~~~~~~~CL~~~~----~~~~v~l~~C~~~~~ 75 (96)
.++||||+|++||++|+||||+|||+|||||+++|.+. .++|+| ++..++.|+|... .|..+++++||+.+.
T Consensus 414 ~d~GDvseR~~LR~~L~CKsFkWyL~nVyPel~~~~~~~~~~G~i---~~~~~~~cld~~~~~~~~~~~~~~~~Ch~~~~ 490 (578)
T KOG3736|consen 414 IDEGDLTERKALRERLNCKSFKWYLENVYPELYLPTPHVYASGEI---RNGNPNLCLDTERAPAGQGMAVGLYPCHGPGG 490 (578)
T ss_pred cCCCCchhHHHHHHhcCCccccchHhhcCccccCCCCccccccee---ccCCcchhhhhhchhccCCCcceEecCCCccc
Confidence 47999999999999999999999999999999999766 678887 3367899999753 246899999999999
Q ss_pred CcceEeeecC
Q psy1795 76 NQRWDFENYE 85 (96)
Q Consensus 76 ~Q~W~~~~~~ 85 (96)
+|.|.++..+
T Consensus 491 ~Q~~~yT~~~ 500 (578)
T KOG3736|consen 491 NQYFPYTKQG 500 (578)
T ss_pred cccccccCCc
Confidence 9999988754
|
|
| >KOG3737|consensus | Back alignment and domain information |
|---|
| >KOG3738|consensus | Back alignment and domain information |
|---|
| >PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis | Back alignment and domain information |
|---|
| >PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis | Back alignment and domain information |
|---|
| >cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication | Back alignment and domain information |
|---|
| >cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication | Back alignment and domain information |
|---|
| >KOG3736|consensus | Back alignment and domain information |
|---|
| >smart00458 RICIN Ricin-type beta-trefoil | Back alignment and domain information |
|---|
| >smart00458 RICIN Ricin-type beta-trefoil | Back alignment and domain information |
|---|
| >PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A | Back alignment and domain information |
|---|
| >PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A | Back alignment and domain information |
|---|
| >KOG3737|consensus | Back alignment and domain information |
|---|
| >KOG3738|consensus | Back alignment and domain information |
|---|
| >PF03498 CDtoxinA: Cytolethal distending toxin A/C family; InterPro: IPR003558 Escherichia coli, Haemophilus spp and Campylobacter spp | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 96 | ||||
| 1xhb_A | 472 | The Crystal Structure Of Udp-Galnac: Polypeptide Al | 1e-08 | ||
| 2ffu_A | 501 | Crystal Structure Of Human Ppgalnact-2 Complexed Wi | 2e-08 |
| >pdb|1XHB|A Chain A, The Crystal Structure Of Udp-Galnac: Polypeptide Alpha-N- Acetylgalactosaminyltransferase-T1 Length = 472 | Back alignment and structure |
|
| >pdb|2FFU|A Chain A, Crystal Structure Of Human Ppgalnact-2 Complexed With Udp And Ea2 Length = 501 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 96 | |||
| 1xhb_A | 472 | Polypeptide N-acetylgalactosaminyltransferase 1; g | 1e-17 | |
| 1xhb_A | 472 | Polypeptide N-acetylgalactosaminyltransferase 1; g | 2e-07 | |
| 2ffu_A | 501 | Ppgalnact-2, polypeptide N-acetylgalactosaminyltra | 6e-16 | |
| 2ffu_A | 501 | Ppgalnact-2, polypeptide N-acetylgalactosaminyltra | 8e-06 | |
| 2d7i_A | 570 | Polypeptide N-acetylgalactosaminyltransferase 10; | 2e-10 | |
| 2d7i_A | 570 | Polypeptide N-acetylgalactosaminyltransferase 10; | 5e-10 | |
| 1dqg_A | 135 | Mannose receptor; beta trefoil, multilectin recept | 3e-04 |
| >1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 | Back alignment and structure |
|---|
Score = 75.2 bits (184), Expect = 1e-17
Identities = 34/117 (29%), Positives = 47/117 (40%), Gaps = 37/117 (31%)
Query: 2 DFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRRLIF------------- 48
D+GD++SR LRR L CK F WYL+NIYP+ IP + G+ R +
Sbjct: 305 DYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKEN 364
Query: 49 --------HGTSK----------------KCLAISTNKLKLTMQDCDEERSNQRWDF 81
HG CL +S +TM C + NQ W++
Sbjct: 365 EKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEY 421
|
| >1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 | Back alignment and structure |
|---|
| >2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 | Back alignment and structure |
|---|
| >2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 | Back alignment and structure |
|---|
| >2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 | Back alignment and structure |
|---|
| >2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 | Back alignment and structure |
|---|
| >1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* Length = 135 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| 1xhb_A | 472 | Polypeptide N-acetylgalactosaminyltransferase 1; g | 99.86 | |
| 2ffu_A | 501 | Ppgalnact-2, polypeptide N-acetylgalactosaminyltra | 99.86 | |
| 2d7i_A | 570 | Polypeptide N-acetylgalactosaminyltransferase 10; | 99.81 | |
| 3a21_A | 614 | Putative secreted alpha-galactosidase; beta-alpha- | 99.56 | |
| 2d7i_A | 570 | Polypeptide N-acetylgalactosaminyltransferase 10; | 98.09 | |
| 1knl_A | 130 | Endo-1,4-beta-xylanase A; carbohydrate binding mod | 97.32 | |
| 3a07_A | 118 | Actinohivin; carbohydrate-binding module family 13 | 97.23 | |
| 1xhb_A | 472 | Polypeptide N-acetylgalactosaminyltransferase 1; g | 97.16 | |
| 1knl_A | 130 | Endo-1,4-beta-xylanase A; carbohydrate binding mod | 97.15 | |
| 3a07_A | 118 | Actinohivin; carbohydrate-binding module family 13 | 97.06 | |
| 3pg0_A | 165 | Threefoil; symmetric design, beta-trefoil, enginee | 96.99 | |
| 2ao3_A | 130 | 29-kDa galactose-binding lectin; earthworm lumbric | 96.86 | |
| 3pg0_A | 165 | Threefoil; symmetric design, beta-trefoil, enginee | 96.77 | |
| 2aai_B | 262 | Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG | 96.65 | |
| 1ggp_B | 254 | TKL-1, protein (lectin 1 B chain); sugar binding p | 96.53 | |
| 2ao3_A | 130 | 29-kDa galactose-binding lectin; earthworm lumbric | 96.52 | |
| 2ffu_A | 501 | Ppgalnact-2, polypeptide N-acetylgalactosaminyltra | 96.45 | |
| 2dry_A | 130 | 29-kDa galactose-binding lectin; earthworm lumbric | 96.44 | |
| 2dry_A | 130 | 29-kDa galactose-binding lectin; earthworm lumbric | 96.41 | |
| 2aai_B | 262 | Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG | 96.4 | |
| 1m2t_B | 263 | Mistletoe lectin I B chain; ribosome inactivation, | 96.39 | |
| 1vcl_A | 432 | Hemolytic lectin CEL-III; hemolysis, hemagglutinat | 96.39 | |
| 1vcl_A | 432 | Hemolytic lectin CEL-III; hemolysis, hemagglutinat | 96.09 | |
| 3c9z_A | 258 | Agglutinin II, SNA-II; beta-trefoil, ricin-B domai | 96.02 | |
| 1ggp_B | 254 | TKL-1, protein (lectin 1 B chain); sugar binding p | 95.95 | |
| 1abr_B | 267 | Abrin-A; glycosidase/carbohydrate complex, lectin, | 95.92 | |
| 3nbc_A | 148 | Ricin B-like lectin; lactose, sugar BIND protein; | 95.78 | |
| 1abr_B | 267 | Abrin-A; glycosidase/carbohydrate complex, lectin, | 95.75 | |
| 1m2t_B | 263 | Mistletoe lectin I B chain; ribosome inactivation, | 95.65 | |
| 3a21_A | 614 | Putative secreted alpha-galactosidase; beta-alpha- | 95.54 | |
| 2d1z_A | 436 | Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en | 95.52 | |
| 3vsf_A | 526 | Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana | 95.32 | |
| 3c9z_A | 258 | Agglutinin II, SNA-II; beta-trefoil, ricin-B domai | 95.31 | |
| 3phz_A | 286 | Ricin B-related lectin; beta trefoil, saccharide b | 95.13 | |
| 3vsf_A | 526 | Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana | 95.1 | |
| 2d1z_A | 436 | Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en | 95.0 | |
| 1dqg_A | 135 | Mannose receptor; beta trefoil, multilectin recept | 94.3 | |
| 3ef2_A | 293 | Agglutinin, lectin; beta-trefoil, calcium-binding, | 94.29 | |
| 1dqg_A | 135 | Mannose receptor; beta trefoil, multilectin recept | 94.14 | |
| 3nbc_A | 148 | Ricin B-like lectin; lactose, sugar BIND protein; | 94.13 | |
| 2vlc_A | 570 | Cinnamomin, type 2 ribosome-inactivating protein c | 94.06 | |
| 2vlc_A | 570 | Cinnamomin, type 2 ribosome-inactivating protein c | 94.03 | |
| 3phz_A | 286 | Ricin B-related lectin; beta trefoil, saccharide b | 93.75 | |
| 3ef2_A | 293 | Agglutinin, lectin; beta-trefoil, calcium-binding, | 93.58 | |
| 1sr4_A | 206 | CDT A, cytolethal distending toxin subunit A; bact | 93.27 | |
| 1ybi_A | 288 | HA33A, HA33/A, non-toxin haemagglutinin HA34; beta | 92.27 | |
| 3aj6_A | 286 | Main hemagglutinin component; toxin, beta-trefoil; | 91.8 | |
| 3aj6_A | 286 | Main hemagglutinin component; toxin, beta-trefoil; | 90.64 | |
| 1xez_A | 721 | Hemolysin, cytolysin; pore-forming toxin, Pro-toxi | 85.52 | |
| 1sr4_A | 206 | CDT A, cytolethal distending toxin subunit A; bact | 82.78 | |
| 2vse_A | 841 | MTX holotoxin, mosquitocidal toxin; ADP-ribosyltra | 81.61 | |
| 1ybi_A | 288 | HA33A, HA33/A, non-toxin haemagglutinin HA34; beta | 80.99 |
| >1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 | Back alignment and structure |
|---|
Probab=99.86 E-value=2.6e-22 Score=153.98 Aligned_cols=81 Identities=35% Similarity=0.701 Sum_probs=71.6
Q ss_pred CCCCchHHHHHHHHcCCcCchhchhccCcCCCCCCCCcccceeEEEeecCCCceeeeeC--CCCeEEEEcCCCCCCCcce
Q psy1795 2 DFGDVTSRKELRRNLGCKSFKWYLDNIYPELFIPGDAVASGDRRLIFHGTSKKCLAIST--NKLKLTMQDCDEERSNQRW 79 (96)
Q Consensus 2 ~~Gdis~r~~LR~~L~CKsF~WyL~nVyPe~~~p~~~~~~G~i~~i~~~~~~~CL~~~~--~~~~v~l~~C~~~~~~Q~W 79 (96)
++|||++|++||++|+||+|+|||+|||||+.+|.+..++|+| ++..+++|||+.. .|..|.+.+||+.+++|+|
T Consensus 305 ~~g~~~~~~~lr~~l~~~~f~w~l~~v~p~~~~p~~~~~~g~i---~~~~~~~Cld~~~~~~g~~v~l~~C~~~~~nQ~w 381 (472)
T 1xhb_A 305 DYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEI---RNVETNQCLDNMARKENEKVGIFNCHGMGGNQVF 381 (472)
T ss_dssp CCCCCHHHHHHHHHTTCCCHHHHHHHTCTTCSSCSSEEEEECE---EETTTCEEEECTTCCTTEECEEEECCSCCGGGCE
T ss_pred CCCCHHHHHHHHHhcCCCCccchhhhhhhhhcccccccccceE---EECCCCccccccCCCCCCeEEEEeCCCCCcceeE
Confidence 6899999999999999999999999999999999887888876 6667899999753 5678999999998889999
Q ss_pred EeeecC
Q psy1795 80 DFENYE 85 (96)
Q Consensus 80 ~~~~~~ 85 (96)
.++..+
T Consensus 382 ~~~~~g 387 (472)
T 1xhb_A 382 SYTANK 387 (472)
T ss_dssp EEETTS
T ss_pred EEcccc
Confidence 997643
|
| >2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* | Back alignment and structure |
|---|
| >2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* | Back alignment and structure |
|---|
| >3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* | Back alignment and structure |
|---|
| >2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* | Back alignment and structure |
|---|
| >1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* | Back alignment and structure |
|---|
| >3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} | Back alignment and structure |
|---|
| >1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 | Back alignment and structure |
|---|
| >1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* | Back alignment and structure |
|---|
| >3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} | Back alignment and structure |
|---|
| >3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} | Back alignment and structure |
|---|
| >3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} | Back alignment and structure |
|---|
| >2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* | Back alignment and structure |
|---|
| >1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 | Back alignment and structure |
|---|
| >2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* | Back alignment and structure |
|---|
| >2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* | Back alignment and structure |
|---|
| >2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* | Back alignment and structure |
|---|
| >2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* | Back alignment and structure |
|---|
| >1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* | Back alignment and structure |
|---|
| >1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* | Back alignment and structure |
|---|
| >1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* | Back alignment and structure |
|---|
| >3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* | Back alignment and structure |
|---|
| >1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 | Back alignment and structure |
|---|
| >1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* | Back alignment and structure |
|---|
| >3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* | Back alignment and structure |
|---|
| >1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* | Back alignment and structure |
|---|
| >1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* | Back alignment and structure |
|---|
| >3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* | Back alignment and structure |
|---|
| >2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A | Back alignment and structure |
|---|
| >3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* | Back alignment and structure |
|---|
| >3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* | Back alignment and structure |
|---|
| >3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} | Back alignment and structure |
|---|
| >3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* | Back alignment and structure |
|---|
| >2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A | Back alignment and structure |
|---|
| >1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* | Back alignment and structure |
|---|
| >3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* | Back alignment and structure |
|---|
| >1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* | Back alignment and structure |
|---|
| >3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* | Back alignment and structure |
|---|
| >2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} | Back alignment and structure |
|---|
| >2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} | Back alignment and structure |
|---|
| >3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} | Back alignment and structure |
|---|
| >3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* | Back alignment and structure |
|---|
| >1sr4_A CDT A, cytolethal distending toxin subunit A; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: b.42.2.1 PDB: 2f2f_A | Back alignment and structure |
|---|
| >1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} | Back alignment and structure |
|---|
| >3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A | Back alignment and structure |
|---|
| >3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A | Back alignment and structure |
|---|
| >1xez_A Hemolysin, cytolysin; pore-forming toxin, Pro-toxin, water- soluble monomer, beta-prism, beta-trefoil; HET: BOG; 2.30A {Vibrio cholerae} PDB: 3o44_A | Back alignment and structure |
|---|
| >1sr4_A CDT A, cytolethal distending toxin subunit A; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: b.42.2.1 PDB: 2f2f_A | Back alignment and structure |
|---|
| >2vse_A MTX holotoxin, mosquitocidal toxin; ADP-ribosyltransferase, lectin, ricin-B-like domain; 2.5A {Lysinibacillus sphaericus} PDB: 2vsa_A | Back alignment and structure |
|---|
| >1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 96 | ||||
| d1xhba2 | 328 | c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosa | 2e-13 | |
| d1xhba1 | 131 | b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosa | 2e-04 |
| >d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 328 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 61.9 bits (149), Expect = 2e-13
Identities = 19/30 (63%), Positives = 24/30 (80%)
Query: 2 DFGDVTSRKELRRNLGCKSFKWYLDNIYPE 31
D+GD++SR LRR L CK F WYL+NIYP+
Sbjct: 298 DYGDISSRLGLRRKLQCKPFSWYLENIYPD 327
|
| >d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 131 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| d1xhba2 | 328 | Polypeptide N-acetylgalactosaminyltransferase 1, N | 99.27 | |
| d1xhba1 | 131 | Polypeptide N-acetylgalactosaminyltransferase 1, C | 98.27 | |
| d1dqga_ | 134 | Mannose receptor {Mouse (Mus musculus) [TaxId: 100 | 97.77 | |
| d1vcla2 | 133 | Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar | 97.63 | |
| d1hwmb2 | 131 | Plant cytotoxin B-chain (lectin) {Sambucus ebulus, | 97.59 | |
| d1dqga_ | 134 | Mannose receptor {Mouse (Mus musculus) [TaxId: 100 | 97.58 | |
| d1vcla1 | 150 | Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar | 97.55 | |
| d2aaib2 | 127 | Plant cytotoxin B-chain (lectin) {Castor bean (Ric | 97.53 | |
| d1ggpb2 | 128 | Plant cytotoxin B-chain (lectin) {Mongolian snake- | 97.52 | |
| d1xhba1 | 131 | Polypeptide N-acetylgalactosaminyltransferase 1, C | 97.35 | |
| d1vcla1 | 150 | Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar | 97.29 | |
| d1abrb2 | 127 | Plant cytotoxin B-chain (lectin) {Abrus precatoriu | 97.28 | |
| d1m2tb2 | 126 | Plant cytotoxin B-chain (lectin) {European mistlet | 97.28 | |
| d1hwmb2 | 131 | Plant cytotoxin B-chain (lectin) {Sambucus ebulus, | 97.26 | |
| d1hwmb1 | 133 | Plant cytotoxin B-chain (lectin) {Sambucus ebulus, | 97.23 | |
| d1knma_ | 129 | Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas | 97.19 | |
| d1ggpb1 | 126 | Plant cytotoxin B-chain (lectin) {Mongolian snake- | 97.15 | |
| d1knma_ | 129 | Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas | 97.06 | |
| d1sr4a_ | 167 | Cytolethal distending toxin subunit A {Haemophilus | 96.97 | |
| d1rzob1 | 135 | Plant cytotoxin B-chain (lectin) {Castor bean (Ric | 96.86 | |
| d1abrb2 | 127 | Plant cytotoxin B-chain (lectin) {Abrus precatoriu | 96.82 | |
| d1m2tb2 | 126 | Plant cytotoxin B-chain (lectin) {European mistlet | 96.81 | |
| d1vcla2 | 133 | Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar | 96.8 | |
| d1abrb1 | 140 | Plant cytotoxin B-chain (lectin) {Abrus precatoriu | 96.64 | |
| d1ggpb1 | 126 | Plant cytotoxin B-chain (lectin) {Mongolian snake- | 96.62 | |
| d1hwmb1 | 133 | Plant cytotoxin B-chain (lectin) {Sambucus ebulus, | 96.58 | |
| d1m2tb1 | 136 | Plant cytotoxin B-chain (lectin) {European mistlet | 96.57 | |
| d2aaib2 | 127 | Plant cytotoxin B-chain (lectin) {Castor bean (Ric | 96.55 | |
| d1ggpb2 | 128 | Plant cytotoxin B-chain (lectin) {Mongolian snake- | 96.37 | |
| d2ihoa1 | 154 | Agglutinin MOA, N-terminal domain {Fairy-ring mush | 96.34 | |
| d2ihoa1 | 154 | Agglutinin MOA, N-terminal domain {Fairy-ring mush | 96.07 | |
| d2zqna1 | 130 | 29-kDa galactose-binding lectin {Lumbricus terrest | 96.01 | |
| d1rzob1 | 135 | Plant cytotoxin B-chain (lectin) {Castor bean (Ric | 95.67 | |
| d1abrb1 | 140 | Plant cytotoxin B-chain (lectin) {Abrus precatoriu | 95.51 | |
| d1qxma2 | 138 | Hemagglutinin component Ha1 {Clostridium botulinum | 95.39 | |
| d1m2tb1 | 136 | Plant cytotoxin B-chain (lectin) {European mistlet | 95.33 | |
| d2zqna1 | 130 | 29-kDa galactose-binding lectin {Lumbricus terrest | 95.08 | |
| d1sr4a_ | 167 | Cytolethal distending toxin subunit A {Haemophilus | 94.71 | |
| d1qxma2 | 138 | Hemagglutinin component Ha1 {Clostridium botulinum | 94.59 | |
| d1qxma1 | 145 | Hemagglutinin component Ha1 {Clostridium botulinum | 94.44 | |
| d1qxma1 | 145 | Hemagglutinin component Ha1 {Clostridium botulinum | 91.91 | |
| d1upsa2 | 131 | GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi | 87.71 | |
| d1upsa2 | 131 | GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi | 80.98 |
| >d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.27 E-value=5.5e-13 Score=95.47 Aligned_cols=30 Identities=63% Similarity=1.372 Sum_probs=29.0
Q ss_pred CCCCchHHHHHHHHcCCcCchhchhccCcC
Q psy1795 2 DFGDVTSRKELRRNLGCKSFKWYLDNIYPE 31 (96)
Q Consensus 2 ~~Gdis~r~~LR~~L~CKsF~WyL~nVyPe 31 (96)
++|||++|++||++|+||||+|||+|||||
T Consensus 298 ~~~~i~~r~~Lr~~l~ck~f~w~~~~~~~~ 327 (328)
T d1xhba2 298 DYGDISSRLGLRRKLQCKPFSWYLENIYPD 327 (328)
T ss_dssp CCCCCHHHHHHHHHTTCCCHHHHHHHTCTT
T ss_pred CcccHHHHHHHHHHhCCCChHHHHhhCCCC
Confidence 579999999999999999999999999998
|
| >d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} | Back information, alignment and structure |
|---|
| >d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} | Back information, alignment and structure |
|---|
| >d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} | Back information, alignment and structure |
|---|
| >d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} | Back information, alignment and structure |
|---|
| >d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} | Back information, alignment and structure |
|---|
| >d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} | Back information, alignment and structure |
|---|
| >d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} | Back information, alignment and structure |
|---|
| >d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} | Back information, alignment and structure |
|---|
| >d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} | Back information, alignment and structure |
|---|
| >d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} | Back information, alignment and structure |
|---|
| >d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} | Back information, alignment and structure |
|---|
| >d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} | Back information, alignment and structure |
|---|
| >d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} | Back information, alignment and structure |
|---|
| >d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} | Back information, alignment and structure |
|---|
| >d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} | Back information, alignment and structure |
|---|
| >d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} | Back information, alignment and structure |
|---|
| >d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} | Back information, alignment and structure |
|---|
| >d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} | Back information, alignment and structure |
|---|
| >d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} | Back information, alignment and structure |
|---|
| >d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} | Back information, alignment and structure |
|---|
| >d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} | Back information, alignment and structure |
|---|
| >d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} | Back information, alignment and structure |
|---|
| >d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} | Back information, alignment and structure |
|---|
| >d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} | Back information, alignment and structure |
|---|
| >d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} | Back information, alignment and structure |
|---|
| >d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} | Back information, alignment and structure |
|---|
| >d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} | Back information, alignment and structure |
|---|
| >d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} | Back information, alignment and structure |
|---|
| >d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} | Back information, alignment and structure |
|---|
| >d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} | Back information, alignment and structure |
|---|