Psyllid ID: psy17999

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-----
ECGADCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQVDIMFTASAMDQVSFDFLLSANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIEHVDNIYTTVKQYHSNLSILHCVSAYPTPYPTVKQYHSNLSILHCVSAYPTPYHDINLNVIHTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPELKALVTGIRDIEQSLGSPTKRMQVSEAPCYAKLGKCIVSSCDIQAGTVLQEFHVCIKVAEPKGICGTRYASVMGRKVNRDIRRDESIQDIDLDPVES
cccccEEEEEEEEcccccccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHccccEEEEEccccccHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEcccccccccHHHccHHHHHHHHHHcccccEEccccccccHHHHHHHHcccEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHcccEEEEEccccccccccccccEEEcccccccccccHHHHHccHHcccccccccccccccccccc
cccccEEEEEEEcccHEEcccccHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHccccEEEEcccccccHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHHHHcccccEcccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHEEEEHccccccEEcHHHEEEEEcccccccHHHHHHHHccHccHcccccccccHHHHHcccc
ecgadcvkfqksclstkftqsaldrpylsphawantygqhkqhlEFSQEEYVMLQQCADQVDIMFTASAMDQVSFDFLlsanvpfikigsgdsnnipLIKYAaskqkpliistgmlpsiehVDNIYTTVKQYHSnlsilhcvsayptpyptvkqyhsnlsilhcvsayptpyhdinlNVIHTLrsrypdipigysghengVHVCYAAVAMGAQIIEKHFtldkswkgsdhassltppeLKALVTGIRDIeqslgsptkrmqvseapcyaklgkcivsscdiqagtVLQEFHVCIKvaepkgicgtryasvmgrkvnrdirrdesiqdidldpves
ECGADCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQVDIMFTASAMDQVSFDFLLSANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIEHVDNIYTTVKQYHSNLSILHCVSAYPTPYPTVKQYHSNLSILHCVSAYPTPYHDINLNVIHTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPELKALVTGIRDIEQslgsptkrmqvSEAPCYAKLGKCIVSSCDIQAGTVLQEFHVCIKvaepkgicgtryasvmgrkvnrdirrdesiqdidldpves
ECGADCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQVDIMFTASAMDQVSFDFLLSANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIEHVDNIYTTVKQYHSNLSILHCVSAYPTPYPTVKQYHSNLSILHCVSAYPTPYHDINLNVIHTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPELKALVTGIRDIEQSLGSPTKRMQVSEAPCYAKLGKCIVSSCDIQAGTVLQEFHVCIKVAEPKGICGTRYASVMGRKVNRDIRRDESIQDIDLDPVES
****DCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQVDIMFTASAMDQVSFDFLLSANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIEHVDNIYTTVKQYHSNLSILHCVSAYPTPYPTVKQYHSNLSILHCVSAYPTPYHDINLNVIHTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWK**************ALVTGIR****************EAPCYAKLGKCIVSSCDIQAGTVLQEFHVCIKVAEPKGICGTRYASVMGRKV********************
ECGADCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQVDIMFTASAMDQVSFDFLLSANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIEHVDNIYTTVKQYHSNLSILHCVSAYPTPYPTVKQYHSNLSILHCVSAYPTPYHDINLNVIHTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPELKALVTGIRDIEQSLGSPTKRMQVSEAPCYAKLGKCIVSSCDIQAGTVLQEFHVCIKVAEPKGICGTRYASVMGRKVNRDIRRDESIQDIDLDPVE*
ECGADCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQVDIMFTASAMDQVSFDFLLSANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIEHVDNIYTTVKQYHSNLSILHCVSAYPTPYPTVKQYHSNLSILHCVSAYPTPYHDINLNVIHTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKS**********TPPELKALVTGIRDIEQSLGSPTKRMQVSEAPCYAKLGKCIVSSCDIQAGTVLQEFHVCIKVAEPKGICGTRYASVMGRKVNRDIRRDESIQDIDLDPVES
**GADCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQVDIMFTASAMDQVSFDFLLSANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIEHVDNIYTTVKQYHSNLSILHCVSAYPTPYPTVKQYHSNLSILHCVSAYPTPYHDINLNVIHTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPELKALVTGIRDIEQSLGSPTKRMQVSEAPCYAKLGKCIVSSCDIQAGTVLQEFHVCIKVAEPKGICGTRYASVMGRKVNRDIRRDESIQDIDLDP***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ECGADCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQVDIMFTASAMDQVSFDFLLSANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIEHVDNIYTTVKQYHSNLSILHCVSAYPTPYPTVKQYHSNLSILHCVSAYPTPYHDINLNVIHTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPELKALVTGIRDIEQSLGSPTKRMQVSEAPCYAKLGKCIVSSCDIQAGTVLQEFHVCIKVAEPKGICGTRYASVMGRKVNRDIRRDESIQDIDLDPVES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query335 2.2.26 [Sep-21-2011]
Q9NR45359 Sialic acid synthase OS=H yes N/A 0.916 0.855 0.459 2e-82
Q58465337 Uncharacterized protein M yes N/A 0.853 0.848 0.353 9e-46
P39625373 Spore coat polysaccharide yes N/A 0.776 0.697 0.298 3e-26
Q939J8343 Pseudaminic acid synthase yes N/A 0.767 0.749 0.273 5e-23
Q0P8U0343 Pseudaminic acid synthase no N/A 0.767 0.749 0.269 6e-22
O24980340 Pseudaminic acid synthase yes N/A 0.907 0.894 0.269 5e-19
>sp|Q9NR45|SIAS_HUMAN Sialic acid synthase OS=Homo sapiens GN=NANS PE=1 SV=2 Back     alignment and function desciption
 Score =  306 bits (783), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 152/331 (45%), Positives = 211/331 (63%), Gaps = 24/331 (7%)

Query: 1   ECGADCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQ 60
           ECGADC KFQKS L  KF + AL+RPY S H+W  TYG+HK+HLEFS ++Y  LQ+ A++
Sbjct: 45  ECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEE 104

Query: 61  VDIMFTASAMDQVSFDFLLSANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIE 120
           V I FTAS MD+++ +FL   NVPF K+GSGD+NN P ++  A K +P++IS+GM    +
Sbjct: 105 VGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGM----Q 160

Query: 121 HVDNIYTTVKQYHSNLSILHCVSAYPTPYPTVKQYHSNLSILHCVSAYPTPYHDINLNVI 180
            +D    T+KQ                 Y  VK  + N   L C SAYP    D+NL VI
Sbjct: 161 SMD----TMKQV----------------YQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVI 200

Query: 181 HTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPELK 240
              +  +PDIPIGYSGHE G+ +  AAVA+GA+++E+H TLDK+WKGSDH++SL P EL 
Sbjct: 201 SEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELA 260

Query: 241 ALVTGIRDIEQSLGSPTKRMQVSEAPCYAKLGKCIVSSCDIQAGTVLQEFHVCIKVAEPK 300
            LV  +R +E++LGSPTK++   E  C  KLGK +V+   I  GT+L    + +KV EPK
Sbjct: 261 ELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPK 320

Query: 301 GICGTRYASVMGRKVNRDIRRDESIQDIDLD 331
           G       +++G+KV   +  D++I +  +D
Sbjct: 321 GYPPEDIFNLVGKKVLVTVEEDDTIMEELVD 351
Produces N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN). Can also use N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of Neu5Ac and KDN, respectively.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 5EC: 7
>sp|Q58465|Y1065_METJA Uncharacterized protein MJ1065 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1065 PE=4 SV=1 Back     alignment and function description
>sp|P39625|SPSE_BACSU Spore coat polysaccharide biosynthesis protein SpsE OS=Bacillus subtilis (strain 168) GN=spsE PE=1 SV=1 Back     alignment and function description
>sp|Q939J8|PSEI_CAMJJ Pseudaminic acid synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pseI PE=3 SV=1 Back     alignment and function description
>sp|Q0P8U0|PSEI_CAMJE Pseudaminic acid synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168) GN=pseI PE=1 SV=1 Back     alignment and function description
>sp|O24980|PSEI_HELPY Pseudaminic acid synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pseI PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query335
270001379350 hypothetical protein TcasGA2_TC000193 [T 0.916 0.877 0.516 1e-87
189234957 886 PREDICTED: similar to CG17754 CG17754-PC 0.916 0.346 0.519 2e-87
45592938359 sialic acid synthase [Danio rerio] gi|41 0.910 0.849 0.474 5e-87
348524978359 PREDICTED: sialic acid synthase-like [Or 0.898 0.838 0.476 1e-85
55925431352 uncharacterized protein LOC492779 [Danio 0.904 0.860 0.464 2e-85
64966516358 N-acetylneuraminic acid synthase [Takifu 0.898 0.840 0.473 4e-85
410918169359 PREDICTED: sialic acid synthase [Takifug 0.898 0.838 0.473 7e-85
47220009 454 unnamed protein product [Tetraodon nigro 0.898 0.662 0.470 1e-84
213515494362 Sialic acid synthase [Salmo salar] gi|20 0.898 0.831 0.48 1e-84
317575692359 sialic acid synthase [Ictalurus punctatu 0.904 0.844 0.474 2e-83
>gi|270001379|gb|EEZ97826.1| hypothetical protein TcasGA2_TC000193 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  329 bits (844), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 171/331 (51%), Positives = 219/331 (66%), Gaps = 24/331 (7%)

Query: 1   ECGADCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQ 60
           E GADCVKFQK+CL+ KF +SALDRPY  PH+W  TYG+HKQ LEF++E++  LQ  A +
Sbjct: 44  ESGADCVKFQKTCLTEKFNKSALDRPYRGPHSWGATYGEHKQFLEFTKEQFRELQSFAAE 103

Query: 61  VDIMFTASAMDQVSFDFLLSANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIE 120
           + I+FTASAMD  S  FL S NVPFIKIGSGDSNN+ LI+ AA+   PL+ISTGM    +
Sbjct: 104 IGILFTASAMDSQSLRFLASLNVPFIKIGSGDSNNLLLIQEAAAMNVPLVISTGM----Q 159

Query: 121 HVDNIYTTVKQYHSNLSILHCVSAYPTPYPTVKQYHSNLSILHCVSAYPTPYHDINLNVI 180
            +  +  T                    Y  V QYH   ++LHCVSAYPTP  +INLNVI
Sbjct: 160 DLGGVRAT--------------------YECVAQYHKKFALLHCVSAYPTPLQEINLNVI 199

Query: 181 HTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPELK 240
               + +PD+ IGYSGHE G+    AAVA+GA+IIE+H TLDK+ KGSDH  SL P ELK
Sbjct: 200 KLYETEFPDVVIGYSGHELGIEASVAAVAVGAKIIERHVTLDKTQKGSDHQCSLEPQELK 259

Query: 241 ALVTGIRDIEQSLGSPTKRMQVSEAPCYAKLGKCIVSSCDIQAGTVLQEFHVCIKVAEPK 300
            L+  IR+++ +LG P K  Q SE PCYAKLGK +V++  ++ G +LQ  ++ IKVAEPK
Sbjct: 260 LLIEKIRELDITLGKPVKAFQASERPCYAKLGKSLVAATTLRKGDILQHENIKIKVAEPK 319

Query: 301 GICGTRYASVMGRKVNRDIRRDESIQDIDLD 331
           GI  +    V+G+ V   I  DESI   +L+
Sbjct: 320 GIDASLLKDVIGKHVKGVINEDESILQENLE 350

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189234957|ref|XP_973182.2| PREDICTED: similar to CG17754 CG17754-PC [Tribolium castaneum] Back     alignment and taxonomy information
>gi|45592938|ref|NP_996660.1| sialic acid synthase [Danio rerio] gi|41351113|gb|AAH65584.1| Zgc:77126 [Danio rerio] Back     alignment and taxonomy information
>gi|348524978|ref|XP_003449999.1| PREDICTED: sialic acid synthase-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|55925431|ref|NP_001007421.1| uncharacterized protein LOC492779 [Danio rerio] gi|55249977|gb|AAH85365.1| Zgc:101549 [Danio rerio] Back     alignment and taxonomy information
>gi|64966516|emb|CAG29226.1| N-acetylneuraminic acid synthase [Takifugu rubripes] Back     alignment and taxonomy information
>gi|410918169|ref|XP_003972558.1| PREDICTED: sialic acid synthase [Takifugu rubripes] Back     alignment and taxonomy information
>gi|47220009|emb|CAG11542.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|213515494|ref|NP_001133567.1| Sialic acid synthase [Salmo salar] gi|209154520|gb|ACI33492.1| Sialic acid synthase [Salmo salar] Back     alignment and taxonomy information
>gi|317575692|ref|NP_001187692.1| sialic acid synthase [Ictalurus punctatus] gi|308323717|gb|ADO28994.1| sialic acid synthase [Ictalurus punctatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query335
ZFIN|ZDB-GENE-030131-1500359 nans "N-acetylneuraminic acid 0.537 0.501 0.497 1.9e-89
UNIPROTKB|F1SSG5359 NANS "Uncharacterized protein" 0.534 0.498 0.474 1.3e-82
UNIPROTKB|Q9NR45359 NANS "Sialic acid synthase" [H 0.534 0.498 0.458 1.7e-82
UNIPROTKB|Q1RMX7359 NANS "Uncharacterized protein" 0.534 0.498 0.458 5.8e-82
UNIPROTKB|E2QWN4359 NANS "Uncharacterized protein" 0.432 0.403 0.527 1.2e-81
RGD|1311943359 Nans "N-acetylneuraminic acid 0.549 0.512 0.454 1.5e-81
TIGR_CMR|CJE_1516334 CJE_1516 "N-acetylneuraminic a 0.501 0.502 0.382 2.3e-48
FB|FBgn0038045372 Sas "Sialic acid phosphate syn 0.949 0.854 0.370 6e-48
ZFIN|ZDB-GENE-041114-125352 zgc:101549 "zgc:101549" [Danio 0.534 0.508 0.474 1.9e-44
UNIPROTKB|F1ND68360 NANS "Uncharacterized protein" 0.534 0.497 0.469 2.8e-41
ZFIN|ZDB-GENE-030131-1500 nans "N-acetylneuraminic acid synthase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 474 (171.9 bits), Expect = 1.9e-89, Sum P(2) = 1.9e-89
 Identities = 90/181 (49%), Positives = 122/181 (67%)

Query:   149 YPTVKQYHSNLSILHCVSAYPTPYHDINLNVIHTLRSRYPDIPIGYSGHENGVHVCYAAV 208
             Y  VK+++ N  IL C SAYP    D+NL VI   +  +PDIPIGYSGHE+G+++   AV
Sbjct:   169 YKIVKEHNQNFCILQCTSAYPLEPEDVNLRVITEYQKEFPDIPIGYSGHESGINITVGAV 228

Query:   209 AMGAQIIEKHFTLDKSWKGSDHASSLTPPELKALVTGIRDIEQSLGSPTKRMQVSEAPCY 268
             A+GA+++E+H TLDKSWKGSDHA+SL P EL  LV  IR +E++LG+  KRM   E PC+
Sbjct:   229 ALGAKVVERHVTLDKSWKGSDHAASLEPEELAELVRSIRIVERALGTGLKRMLPCEVPCH 288

Query:   269 AKLGKCIVSSCDIQAGTVLQEFHVCIKVAEPKGICGTRYASVMGRKVNRDIRRDESI-QD 327
              KLGK +V+   I  GT L    + +KVAEPKG+       ++G+KV  D+  DESI +D
Sbjct:   289 DKLGKSVVAKTSIPKGTELTLDMLAVKVAEPKGVAPEEIFQLVGKKVTTDVEEDESITED 348

Query:   328 I 328
             +
Sbjct:   349 V 349
GO:0016051 "carbohydrate biosynthetic process" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|F1SSG5 NANS "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NR45 NANS "Sialic acid synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q1RMX7 NANS "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QWN4 NANS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1311943 Nans "N-acetylneuraminic acid synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_1516 CJE_1516 "N-acetylneuraminic acid synthetase" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
FB|FBgn0038045 Sas "Sialic acid phosphate synthase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041114-125 zgc:101549 "zgc:101549" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1ND68 NANS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9NR45SIAS_HUMAN2, ., 5, ., 1, ., 5, 70.45920.91640.8551yesN/A
Q58465Y1065_METJANo assigned EC number0.35360.85370.8486yesN/A
O24980PSEI_HELPY2, ., 5, ., 1, ., 9, 70.26940.90740.8941yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query335
pfam03102240 pfam03102, NeuB, NeuB family 1e-100
TIGR03569329 TIGR03569, NeuB_NnaB, N-acetylneuraminate synthase 8e-91
COG2089347 COG2089, SpsE, Sialic acid synthase [Cell envelope 2e-85
TIGR03586327 TIGR03586, PseI, pseudaminic acid synthase 4e-49
cd1161558 cd11615, SAF_NeuB_like, C-terminal SAF domain of s 4e-09
pfam0866663 pfam08666, SAF, SAF domain 1e-04
PRK08673335 PRK08673, PRK08673, 3-deoxy-7-phosphoheptulonate s 4e-04
smart0085863 smart00858, SAF, This domain family includes a ran 0.003
>gnl|CDD|217370 pfam03102, NeuB, NeuB family Back     alignment and domain information 
 Score =  295 bits (758), Expect = e-100
 Identities = 94/259 (36%), Positives = 141/259 (54%), Gaps = 25/259 (9%)

Query: 1   ECGADCVKFQKSCLSTKFTQSALDRPYLSPHAW-ANTYGQHKQHLEFSQEEYVMLQQCAD 59
           E GAD VKFQ     T  +++A    Y   + W   +  +  + LE  +E +  L +   
Sbjct: 6   EAGADAVKFQTFTADTLVSKNADKADYQIGNLWGGESQYELLKKLELPEEWHKELFEYCK 65

Query: 60  QVDIMFTASAMDQVSFDFLLSANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSI 119
           +  I F ++  D  S DFL S  VP  KI SG+  N+PL++Y A   KP+I+STGM  ++
Sbjct: 66  EKGIEFFSTPFDLESVDFLESLGVPAYKIASGEITNLPLLRYIAKTGKPVILSTGM-ATL 124

Query: 120 EHVDNIYTTVKQYHSNLSILHCVSAYPTPYPTVKQYHSNLSILHCVSAYPTPYHDINLNV 179
           E ++    T+++  +                       ++++LHC S YP P+ D+NL  
Sbjct: 125 EEIEEAVETLREAGNE----------------------DITLLHCTSEYPAPFEDVNLRA 162

Query: 180 IHTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPEL 239
           I TL+  +  +P+GYS H  G+    AAVA+GA +IEKHFTLD++  G DH +SL P EL
Sbjct: 163 IPTLKEAFG-VPVGYSDHTLGIEAPIAAVALGASVIEKHFTLDRNLPGPDHKASLEPDEL 221

Query: 240 KALVTGIRDIEQSLGSPTK 258
           K LV  IR++E++LG   K
Sbjct: 222 KELVKDIRNVEKALGDGVK 240

NeuB is the prokaryotic N-acetylneuraminic acid (Neu5Ac) synthase. It catalyzes the direct formation of Neu5Ac (the most common sialic acid) by condensation of phosphoenolpyruvate (PEP) and N-acetylmannosamine (ManNAc). This reaction has only been observed in prokaryotes; eukaryotes synthesise the 9-phosphate form, Neu5Ac-9-P, and utilise ManNAc-6-P instead of ManNAc. Such eukaryotic enzymes are not present in this family. This family also contains SpsE spore coat polysaccharide biosynthesis proteins. Length = 240
>gnl|CDD|234264 TIGR03569, NeuB_NnaB, N-acetylneuraminate synthase Back     alignment and domain information
>gnl|CDD|225000 COG2089, SpsE, Sialic acid synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|163337 TIGR03586, PseI, pseudaminic acid synthase Back     alignment and domain information
>gnl|CDD|212160 cd11615, SAF_NeuB_like, C-terminal SAF domain of sialic acid synthetase Back     alignment and domain information
>gnl|CDD|219961 pfam08666, SAF, SAF domain Back     alignment and domain information
>gnl|CDD|181535 PRK08673, PRK08673, 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|214862 smart00858, SAF, This domain family includes a range of different proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 335
COG2089347 SpsE Sialic acid synthase [Cell envelope biogenesi 100.0
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 100.0
TIGR03586327 PseI pseudaminic acid synthase. 100.0
PF03102241 NeuB: NeuB family; InterPro: IPR013132 NeuB is the 100.0
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 100.0
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 100.0
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 100.0
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 100.0
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 100.0
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 100.0
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate ( 100.0
TIGR01362258 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase. 100.0
PRK05198264 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 100.0
PRK12457281 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 100.0
PLN03033290 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 99.98
PF00793270 DAHP_synth_1: DAHP synthetase I family; InterPro: 99.86
COG2877279 KdsA 3-deoxy-D-manno-octulosonic acid (KDO) 8-phos 99.81
PRK09261349 phospho-2-dehydro-3-deoxyheptonate aldolase; Valid 99.31
PF0866663 SAF: SAF domain; InterPro: IPR013974 This entry in 99.04
TIGR00034344 aroFGH phospho-2-dehydro-3-deoxyheptonate aldolase 99.03
PRK12755353 phospho-2-dehydro-3-deoxyheptonate aldolase; Provi 98.93
TIGR03170122 flgA_cterm flagella basal body P-ring formation pr 98.41
smart0085864 SAF This domain family includes a range of differe 98.23
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 97.75
PRK12618141 flgA flagellar basal body P-ring biosynthesis prot 97.33
PRK06005160 flgA flagellar basal body P-ring biosynthesis prot 97.16
PF13144196 SAF_2: SAF-like 97.13
PRK07018235 flgA flagellar basal body P-ring biosynthesis prot 97.1
COG1261220 FlgA Flagellar basal body P-ring biosynthesis prot 97.04
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 96.94
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 96.93
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 96.84
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 96.73
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 96.7
PRK12617214 flgA flagellar basal body P-ring biosynthesis prot 96.64
PRK08227264 autoinducer 2 aldolase; Validated 96.61
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 96.6
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 96.58
PRK06804261 flgA flagellar basal body P-ring biosynthesis prot 96.56
TIGR03177 261 pilus_cpaB Flp pilus assembly protein CpaB. Member 96.53
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 96.36
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 96.32
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 96.29
PRK15452 443 putative protease; Provisional 96.25
PRK12822356 phospho-2-dehydro-3-deoxyheptonate aldolase; Provi 96.25
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 96.24
PRK07226267 fructose-bisphosphate aldolase; Provisional 96.21
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 96.21
PRK08515222 flgA flagellar basal body P-ring biosynthesis prot 96.18
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 96.16
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 96.13
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 96.1
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 96.05
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 95.99
PRK09427454 bifunctional indole-3-glycerol phosphate synthase/ 95.9
PRK09250348 fructose-bisphosphate aldolase; Provisional 95.87
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 95.87
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 95.86
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 95.85
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 95.85
PRK12786338 flgA flagellar basal body P-ring biosynthesis prot 95.81
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 95.81
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 95.75
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 95.71
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 95.7
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 95.62
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 95.61
PRK14024241 phosphoribosyl isomerase A; Provisional 95.58
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 95.55
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 95.51
PRK07094323 biotin synthase; Provisional 95.45
PRK11613282 folP dihydropteroate synthase; Provisional 95.44
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.42
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 95.4
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 95.33
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 95.24
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 95.23
PRK06852304 aldolase; Validated 95.2
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 95.14
TIGR00433296 bioB biotin synthetase. Catalyzes the last step of 95.14
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 95.11
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 95.08
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 95.04
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav 95.0
TIGR00423309 radical SAM domain protein, CofH subfamily. This p 94.98
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 94.85
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 94.8
PRK12399324 tagatose 1,6-diphosphate aldolase; Reviewed 94.75
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 94.73
TIGR01496257 DHPS dihydropteroate synthase. This model represen 94.63
TIGR01232325 lacD tagatose 1,6-diphosphate aldolase. This famil 94.56
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 94.51
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 94.48
COG0673342 MviM Predicted dehydrogenases and related proteins 94.45
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 94.45
PLN02746347 hydroxymethylglutaryl-CoA lyase 94.35
PRK12581 468 oxaloacetate decarboxylase; Provisional 94.28
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 94.26
PRK14040 593 oxaloacetate decarboxylase; Provisional 94.24
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 94.24
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 94.2
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 94.16
PLN02460338 indole-3-glycerol-phosphate synthase 94.1
PRK14042 596 pyruvate carboxylase subunit B; Provisional 94.1
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 94.07
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 94.06
PRK04161329 tagatose 1,6-diphosphate aldolase; Reviewed 93.94
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 93.93
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 93.85
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 93.82
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 93.78
PRK12330 499 oxaloacetate decarboxylase; Provisional 93.73
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 93.7
PRK07535261 methyltetrahydrofolate:corrinoid/iron-sulfur prote 93.62
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 93.54
PRK13753279 dihydropteroate synthase; Provisional 93.53
PF00682237 HMGL-like: HMGL-like of this family is not conserv 93.45
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 93.36
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 93.36
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 93.33
PRK09282 592 pyruvate carboxylase subunit B; Validated 93.26
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 93.2
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 93.17
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 93.09
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 93.08
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 93.01
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 92.91
PRK14041 467 oxaloacetate decarboxylase; Provisional 92.81
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 92.44
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 92.38
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 92.26
PRK00208250 thiG thiazole synthase; Reviewed 92.22
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 92.11
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 92.07
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 92.04
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 92.02
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 92.01
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 91.99
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 91.9
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 91.87
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 91.84
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 91.77
TIGR00284499 dihydropteroate synthase-related protein. This pro 91.67
PRK12756348 phospho-2-dehydro-3-deoxyheptonate aldolase; Provi 91.64
PRK02412253 aroD 3-dehydroquinate dehydratase; Provisional 91.61
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 91.52
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 91.37
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 91.27
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 91.18
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 91.12
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 90.96
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 90.95
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 90.89
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 90.88
PLN02274505 inosine-5'-monophosphate dehydrogenase 90.86
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 90.82
PRK15447301 putative protease; Provisional 90.82
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 90.8
PLN03228 503 methylthioalkylmalate synthase; Provisional 90.78
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 90.77
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 90.74
PLN02321 632 2-isopropylmalate synthase 90.61
PLN02623581 pyruvate kinase 90.58
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 90.4
PRK12331 448 oxaloacetate decarboxylase; Provisional 90.4
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 90.38
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 90.37
cd00739257 DHPS DHPS subgroup of Pterin binding enzymes. DHPS 90.37
KOG2741|consensus351 90.34
PRK10206344 putative oxidoreductase; Provisional 90.25
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 90.13
cd04261239 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kina 90.02
PLN02389379 biotin synthase 90.0
COG0826347 Collagenase and related proteases [Posttranslation 89.93
PLN02274505 inosine-5'-monophosphate dehydrogenase 89.67
PRK09389 488 (R)-citramalate synthase; Provisional 89.56
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 89.51
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 89.34
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 89.25
PRK08444353 hypothetical protein; Provisional 89.21
PF00224348 PK: Pyruvate kinase, barrel domain; InterPro: IPR0 89.19
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 89.18
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 89.02
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 88.78
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 88.74
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 88.71
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 88.69
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 88.54
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 88.54
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 88.5
PRK06256336 biotin synthase; Validated 88.26
PRK00915 513 2-isopropylmalate synthase; Validated 88.16
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 88.09
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 88.05
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 88.03
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 87.97
PRK00915 513 2-isopropylmalate synthase; Validated 87.94
PRK13523337 NADPH dehydrogenase NamA; Provisional 87.9
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 87.77
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 87.66
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 87.64
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 87.49
PRK09234843 fbiC FO synthase; Reviewed 87.48
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 87.47
cd00423258 Pterin_binding Pterin binding enzymes. This family 87.47
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 87.26
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 87.25
PRK04147293 N-acetylneuraminate lyase; Provisional 87.18
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 87.1
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 87.1
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 86.94
KOG4201|consensus289 86.92
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 86.62
TIGR00977 526 LeuA_rel 2-isopropylmalate synthase/homocitrate sy 86.58
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 86.37
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 86.27
PRK11579346 putative oxidoreductase; Provisional 86.26
PRK12999 1146 pyruvate carboxylase; Reviewed 86.07
PRK06806281 fructose-bisphosphate aldolase; Provisional 85.97
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 85.87
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 85.82
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 85.79
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 85.72
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 85.66
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 85.64
TIGR00973 494 leuA_bact 2-isopropylmalate synthase, bacterial ty 85.6
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 85.43
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 85.34
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 85.3
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 85.3
cd00740252 MeTr MeTr subgroup of pterin binding enzymes. This 85.29
PRK06739352 pyruvate kinase; Validated 85.03
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 84.93
PRK13575238 3-dehydroquinate dehydratase; Provisional 84.71
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 84.62
PRK13352431 thiamine biosynthesis protein ThiC; Provisional 84.41
cd06289268 PBP1_MalI_like Ligand-binding domain of MalI, a tr 84.34
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 84.3
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 84.29
PRK15108345 biotin synthase; Provisional 84.29
TIGR00973 494 leuA_bact 2-isopropylmalate synthase, bacterial ty 84.19
cd04246239 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kina 84.17
COG3684306 LacD Tagatose-1,6-bisphosphate aldolase [Carbohydr 84.03
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 84.0
PRK02227238 hypothetical protein; Provisional 83.98
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 83.7
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 83.64
TIGR03699340 mena_SCO4550 menaquinone biosynthesis protein, SCO 83.62
PRK08445348 hypothetical protein; Provisional 83.54
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 83.49
PRK05926370 hypothetical protein; Provisional 83.44
PRK07360371 FO synthase subunit 2; Reviewed 83.38
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 83.32
PRK12344 524 putative alpha-isopropylmalate/homocitrate synthas 83.25
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 83.1
cd01545270 PBP1_SalR Ligand-binding domain of DNA transcripti 83.04
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 83.01
TIGR00190423 thiC thiamine biosynthesis protein ThiC. The thiC 83.0
TIGR03700351 mena_SCO4494 putative menaquinone biosynthesis pro 82.98
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 82.79
PLN02321 632 2-isopropylmalate synthase 82.65
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 82.64
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 82.49
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 82.41
PLN02762509 pyruvate kinase complex alpha subunit 82.34
PRK05904353 coproporphyrinogen III oxidase; Provisional 82.28
PRK07695201 transcriptional regulator TenI; Provisional 82.26
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 82.25
cd04234227 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK) 82.07
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 81.92
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 81.9
PRK13523337 NADPH dehydrogenase NamA; Provisional 81.88
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 81.75
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 81.73
PLN02591250 tryptophan synthase 81.34
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 81.28
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 81.12
PRK11197381 lldD L-lactate dehydrogenase; Provisional 81.09
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 81.01
PF00072112 Response_reg: Response regulator receiver domain; 80.95
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 80.85
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 80.85
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 80.84
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 80.8
PLN02334229 ribulose-phosphate 3-epimerase 80.8
PTZ00081439 enolase; Provisional 80.75
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 80.73
COG3745 276 CpaB Flp pilus assembly protein CpaB [Intracellula 80.66
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 80.46
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 80.41
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 80.41
PRK13209283 L-xylulose 5-phosphate 3-epimerase; Reviewed 80.38
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 80.25
cd06267264 PBP1_LacI_sugar_binding_like Ligand binding domain 80.24
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 80.18
TIGR01064473 pyruv_kin pyruvate kinase. This enzyme is a homote 80.16
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-93  Score=677.91  Aligned_cols=305  Identities=35%  Similarity=0.556  Sum_probs=295.0

Q ss_pred             CCCCcEEEeecccccccccccccCCCCCCCCC-CcccHHHHHHhhcCCHHHHHHHHHHHHHcCCceEeccCChhhHHHHH
Q psy17999          1 ECGADCVKFQKSCLSTKFTQSALDRPYLSPHA-WANTYGQHKQHLEFSQEEYVMLQQCADQVDIMFTASAMDQVSFDFLL   79 (335)
Q Consensus         1 ~aGaDaVKFQ~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~el~~e~~~~L~~~~~~~Gi~f~stpfd~~svd~l~   79 (335)
                      +||||+||||+|.+.+.++.++...+|..+.. |+.++++++++++++.+|+.+|++||++.||.|+|||||..+||+|+
T Consensus        41 ~aGADavKfQt~~~~d~~t~~~~~~~~~i~~~~~~~slyel~e~~~~p~e~~~~Lke~a~~~Gi~~~SSPfd~~svd~l~  120 (347)
T COG2089          41 EAGADAVKFQTFYTPDIMTLESKNVPFKIKTLWDKVSLYELYEEAETPLEWHAQLKEYARKRGIIFFSSPFDLTAVDLLE  120 (347)
T ss_pred             HcCcceeeeecccccccccccccCCccccccccccccHHHHHHHhcCCHHHHHHHHHHHHHcCeEEEecCCCHHHHHHHH
Confidence            58999999999888888899988888876654 45789999999999999999999999999999999999999999999


Q ss_pred             hCCCCEEEEcCCCCCCHHHHHHHHhcCCcEEEeCCCCCCHHHHHHHHHHHHh-cCCCCceeecccCCCCCCCCcccccCc
Q psy17999         80 SANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIEHVDNIYTTVKQ-YHSNLSILHCVSAYPTPYPTVKQYHSN  158 (335)
Q Consensus        80 ~l~v~~~KIaS~d~~n~~LL~~~a~~gkPvilStG~~~tl~Ei~~Av~~i~~-g~~~~~~~~c~~g~~~~~~~~~~~~~~  158 (335)
                      ++++++|||||+++||+|||+++|+++|||||||||+ +++||..|++++++ ||+                       +
T Consensus       121 ~~~~~ayKIaS~E~~~~plik~iA~~~kPiIlSTGma-~~~ei~~av~~~r~~g~~-----------------------~  176 (347)
T COG2089         121 SLNPPAYKIASGEINDLPLIKYIAKKGKPIILSTGMA-TIEEIEEAVAILRENGNP-----------------------D  176 (347)
T ss_pred             hcCCCeEEecCccccChHHHHHHHhcCCCEEEEcccc-cHHHHHHHHHHHHhcCCC-----------------------C
Confidence            9999999999999999999999999999999999999 99999999999998 766                       8


Q ss_pred             eEEeeecCCCCCCccCCCchHHHHHHHHCCCCCeecCCCCCChHHHHHHHHcCCcEEEeccCCCCCCCCCCCCCCCCHHH
Q psy17999        159 LSILHCVSAYPTPYHDINLNVIHTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPE  238 (335)
Q Consensus       159 l~llHC~s~YP~~~~~~nL~~i~~L~~~fp~~pVG~SdHt~g~~~~~aAvalGA~vIEkH~tld~~~~G~Dh~~Sl~p~e  238 (335)
                      ++||||+|+||+|++++||+.|+.|++.| +++|||||||.|..++++||||||+|||||||+||+++||||++||+|++
T Consensus       177 i~LLhC~s~YPap~ed~NL~~i~~l~~~F-n~~vGlSDHT~g~~a~l~AvALGA~viEKHFtldk~~~GpD~~fSldP~e  255 (347)
T COG2089         177 IALLHCTSAYPAPFEDVNLKAIPKLAEAF-NAIVGLSDHTLGILAPLAAVALGASVIEKHFTLDKSREGPDHAFSLDPDE  255 (347)
T ss_pred             eEEEEecCCCCCCHHHhhHHHHHHHHHHh-CCccccccCccchhHHHHHHHhcccceeeeeeecCCCCCCCcceecCHHH
Confidence            99999999999999999999999999999 99999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhCCCCccCCccccccccccceEEEEeecCCCCcccccCCcEEeeCCCCCCCcchHHHHhcchhhcc
Q psy17999        239 LKALVTGIRDIEQSLGSPTKRMQVSEAPCYAKLGKCIVSSCDIQAGTVLQEFHVCIKVAEPKGICGTRYASVMGRKVNRD  318 (335)
Q Consensus       239 l~~lv~~ir~~~~alG~~~k~~~~~E~~~~~~~rrsl~a~~di~~G~~l~~~dl~~kr~~~~Gi~p~~~~~viG~~~~~d  318 (335)
                      |+.||+++|+++.+||++.|++.++|+..+..+|||||+.+||||||+||++||+++|| +.||+|.+|+.++|++++||
T Consensus       256 fk~mv~~ir~~~~alG~~~k~~~~~E~~~~~~~~Rsl~~~kdikkGe~ls~~Nl~~~RP-~~gl~~~~~e~llGkka~kd  334 (347)
T COG2089         256 FKEMVDAIRQVEKALGDGEKEILPSEEETRNFARRSLVATKDIKKGEILSEDNLKVLRP-GNGLHPKEYEELLGKKATKD  334 (347)
T ss_pred             HHHHHHHHHHHHHHhCCCccccChhHHHHHHHHhhheeeecccccCccccccceEEeCC-CCCCCHhHHHHHHhHHHhcc
Confidence            99999999999999999999999999999999999999999999999999999999985 78999999999999999999


Q ss_pred             cCCCCcccCCCCC
Q psy17999        319 IRRDESIQDIDLD  331 (335)
Q Consensus       319 i~~~~~i~~~~l~  331 (335)
                      |++|++|+|+||+
T Consensus       335 i~~~~~l~w~Di~  347 (347)
T COG2089         335 IKAGTPLRWDDIE  347 (347)
T ss_pred             ccCCCCcchhccC
Confidence            9999999999985

>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase Back     alignment and domain information
>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>PLN03033 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>PF00793 DAHP_synth_1: DAHP synthetase I family; InterPro: IPR006218 Members of the 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthetase family catalyse the first step in aromatic amino acid biosynthesis from chorismate Back     alignment and domain information
>COG2877 KdsA 3-deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09261 phospho-2-dehydro-3-deoxyheptonate aldolase; Validated Back     alignment and domain information
>PF08666 SAF: SAF domain; InterPro: IPR013974 This entry includes a range of different proteins, such as antifreeze proteins, flagellar FlgA proteins, and CpaB pilus proteins Back     alignment and domain information
>TIGR00034 aroFGH phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK12755 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional Back     alignment and domain information
>TIGR03170 flgA_cterm flagella basal body P-ring formation protein FlgA Back     alignment and domain information
>smart00858 SAF This domain family includes a range of different proteins Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12618 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>PRK06005 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>PF13144 SAF_2: SAF-like Back     alignment and domain information
>PRK07018 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>COG1261 FlgA Flagellar basal body P-ring biosynthesis protein [Cell motility and secretion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK12617 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK06804 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>TIGR03177 pilus_cpaB Flp pilus assembly protein CpaB Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>PRK12822 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK08515 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK12786 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>TIGR00433 bioB biotin synthetase Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>TIGR00423 radical SAM domain protein, CofH subfamily Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK12399 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>TIGR01232 lacD tagatose 1,6-diphosphate aldolase Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK04161 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK13753 dihydropteroate synthase; Provisional Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>TIGR00284 dihydropteroate synthase-related protein Back     alignment and domain information
>PRK12756 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional Back     alignment and domain information
>PRK02412 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK15447 putative protease; Provisional Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information
>PLN02623 pyruvate kinase Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes Back     alignment and domain information
>KOG2741|consensus Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences Back     alignment and domain information
>PLN02389 biotin synthase Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>PF00224 PK: Pyruvate kinase, barrel domain; InterPro: IPR015793 Pyruvate kinase (2 Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd00423 Pterin_binding Pterin binding enzymes Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>KOG4201|consensus Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>cd00740 MeTr MeTr subgroup of pterin binding enzymes Back     alignment and domain information
>PRK06739 pyruvate kinase; Validated Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PRK13575 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13352 thiamine biosynthesis protein ThiC; Provisional Back     alignment and domain information
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type Back     alignment and domain information
>cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes Back     alignment and domain information
>COG3684 LacD Tagatose-1,6-bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family Back     alignment and domain information
>PRK08445 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK05926 hypothetical protein; Provisional Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>TIGR00190 thiC thiamine biosynthesis protein ThiC Back     alignment and domain information
>TIGR03700 mena_SCO4494 putative menaquinone biosynthesis protein, SCO4494 family Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PLN02762 pyruvate kinase complex alpha subunit Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>PTZ00081 enolase; Provisional Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>COG3745 CpaB Flp pilus assembly protein CpaB [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01064 pyruv_kin pyruvate kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query335
1xuu_A349 Crystal Structure Of Sialic Acid Synthase (Neub) In 2e-29
2wqp_A349 Crystal Structure Of Sialic Acid Synthase Neub-Inhi 1e-27
1vli_A385 Crystal Structure Of Spore Coat Polysaccharide Bios 6e-26
3g8r_A350 Crystal Structure Of Putative Spore Coat Polysaccha 1e-10
>pdb|1XUU|A Chain A, Crystal Structure Of Sialic Acid Synthase (Neub) In Complex With Mn2+ And Malate From Neisseria Meningitidis Length = 349 Back     alignment and structure 
Iteration: 1

 Score =  126 bits (317), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 87/330 (26%), Positives = 150/330 (45%), Gaps = 27/330 (8%)
Query: 2   CGADCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQV 61
            GA+ VK Q   +  + +  A  +  +  +A  + Y +  +    ++E+ + L++  +  
Sbjct: 47  AGAEVVKHQTHIVEDEMSDEA--KQVIPGNADVSIY-EIMERCALNEEDEIKLKEYVESK 103
Query: 62  DIMFTASAMDQVSFDFLLSANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIEH 121
            ++F ++   + +   L   ++P  KIGSG+ NN PLIK  AS  KP+I+STGM  SIE 
Sbjct: 104 GMIFISTPFSRAAALRLQRMDIPAYKIGSGECNNYPLIKLVASFGKPIILSTGM-NSIES 162
Query: 122 VDNIYTTVKQYHSNLSILHCVSAYPTPYPTVKQYHSNLSILHCVSAYPTPYHDINLNVIH 181
           +      +++                PY          ++LHC + YPTPY D+ L  ++
Sbjct: 163 IKKSVEIIREAG-------------VPY----------ALLHCTNIYPTPYEDVRLGGMN 199
Query: 182 TLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPELKA 241
            L   +PD  IG S H    + C  AVA+G  I+E+HFT      G D   S+ P   K 
Sbjct: 200 DLSEAFPDAIIGLSDHTLDNYACLGAVALGGSILERHFTDRMDRPGPDIVCSMNPDTFKE 259
Query: 242 LVTGIRDIEQSLGSPTKRMQVSEAPCYAKLGKCIVSSCDIQAGTVLQEFHVCIKVAEPKG 301
           L  G   ++ + G     +   E P        +V+  DI+ G +L   ++ +K      
Sbjct: 260 LKQGAHALKLARGGKKDTIIAGEKPTKDFAFASVVADKDIKKGELLSGDNLWVKRPGNGD 319
Query: 302 ICGTRYASVMGRKVNRDIRRDESIQDIDLD 331
                Y ++ G+    +IR+   I+  D++
Sbjct: 320 FSVNEYETLFGKVAACNIRKGAQIKKTDIE 349
>pdb|2WQP|A Chain A, Crystal Structure Of Sialic Acid Synthase Neub-Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|1VLI|A Chain A, Crystal Structure Of Spore Coat Polysaccharide Biosynthesis Protein Spse (Bsu37870) From Bacillus Subtilis At 2.38 A Resolution Length = 385 Back     alignment and structure
>pdb|3G8R|A Chain A, Crystal Structure Of Putative Spore Coat Polysaccharide Biosynthesis Protein E From Chromobacterium Violaceum Atcc 12472 Length = 350 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query335
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 1e-122
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 1e-113
3g8r_A350 Probable spore coat polysaccharide biosynthesis P; 1e-110
1wvo_A79 Sialic acid synthase; antifreeze protein like doma 7e-12
1c89_A134 RD3, antifreeze protein type III; thermal hysteres 1e-11
1c89_A134 RD3, antifreeze protein type III; thermal hysteres 9e-07
1msi_A70 Type III antifreeze protein isoform HPLC 12; multi 4e-10
1ops_A64 Type III AFP, type III antifreeze protein; ICE cry 2e-09
1ucs_A64 Antifreeze peptide RD1; small beta barrel, pretzel 9e-09
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 9e-07
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 2e-06
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 2e-06
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Length = 349 Back     alignment and structure
 Score =  354 bits (911), Expect = e-122
 Identities = 83/332 (25%), Positives = 146/332 (43%), Gaps = 29/332 (8%)

Query: 1   ECGADCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQ 60
             GA+ VK Q   +  + +  A     + P     +  +  +    ++E+ + L++  + 
Sbjct: 46  NAGAEVVKHQTHIVEDEMSDEA---KQVIPGNADVSIYEIMERCALNEEDEIKLKEYVES 102

Query: 61  VDIMFTASAMDQVSFDFLLSANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIE 120
             ++F ++   + +   L   ++P  KIGSG+ NN PLIK  AS  KP+I+STGM     
Sbjct: 103 KGMIFISTLFSRAAALRLQRMDIPAYKIGSGECNNYPLIKLVASFGKPIILSTGM----- 157

Query: 121 HVDNIYTTVKQYHSNLS-ILHCVSAYPTPYPTVKQYHSNLSILHCVSAYPTPYHDINLNV 179
                        +++  I   V         +++     ++LHC + YPTPY D+ L  
Sbjct: 158 -------------NSIESIKKSVE-------IIREAGVPYALLHCTNIYPTPYEDVRLGG 197

Query: 180 IHTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPEL 239
           ++ L   +PD  IG S H    + C  AVA+G  I+E+HFT      G D   S+ P   
Sbjct: 198 MNDLSEAFPDAIIGLSDHTLDNYACLGAVALGGSILERHFTDRMDRPGPDIVCSMNPDTF 257

Query: 240 KALVTGIRDIEQSLGSPTKRMQVSEAPCYAKLGKCIVSSCDIQAGTVLQEFHVCIKVAEP 299
           K L  G   ++ + G     +   E P        +V+  DI+ G +L   ++ +K    
Sbjct: 258 KELKQGAHALKLARGGKKDTIIAGEKPTKDFAFASVVADKDIKKGELLSGDNLWVKRPGN 317

Query: 300 KGICGTRYASVMGRKVNRDIRRDESIQDIDLD 331
                  Y ++ G+    +IR+   I+  D++
Sbjct: 318 GDFSVNEYETLFGKVAACNIRKGAQIKKTDIE 349
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Length = 385 Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Length = 350 Back     alignment and structure
>1wvo_A Sialic acid synthase; antifreeze protein like domain, N-acetylneuraminic acid phosphate synthase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1c89_A RD3, antifreeze protein type III; thermal hysteresis protein, ICE binding protein; NMR {Pachycara brachycephalum} SCOP: b.85.1.1 b.85.1.1 PDB: 1c8a_A 3nla_A 3rdn_A Length = 134 Back     alignment and structure
>1c89_A RD3, antifreeze protein type III; thermal hysteresis protein, ICE binding protein; NMR {Pachycara brachycephalum} SCOP: b.85.1.1 b.85.1.1 PDB: 1c8a_A 3nla_A 3rdn_A Length = 134 Back     alignment and structure
>1msi_A Type III antifreeze protein isoform HPLC 12; multigene family, thermal hysteresis; 1.25A {Macrozoarces americanus} SCOP: b.85.1.1 Length = 70 Back     alignment and structure
>1ops_A Type III AFP, type III antifreeze protein; ICE crystal growth inhibition, pretzel fold, glycoprotein; 2.00A {Macrozoarces americanus} SCOP: b.85.1.1 Length = 64 Back     alignment and structure
>1ucs_A Antifreeze peptide RD1; small beta barrel, pretzel fold, antifreeze protein; 0.62A {Lycodichthys dearborni} SCOP: b.85.1.1 PDB: 9ame_A 1ame_A 1kde_A 1kdf_A 1gzi_A 1hg7_A 1b7i_A 2spg_A 1jab_A 1b7j_A 2msj_A 1ekl_A 4ame_A 7ame_A 3qf6_A 2ame_A 1msj_A 1b7k_A 6ame_A 9msi_A ... Length = 64 Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Length = 350 Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Length = 262 Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Length = 385 Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Length = 276 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query335
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 100.0
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 100.0
3g8r_A350 Probable spore coat polysaccharide biosynthesis P; 100.0
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 100.0
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 100.0
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 100.0
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 100.0
3sz8_A285 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci 100.0
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; 100.0
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 100.0
3fs2_A298 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 100.0
3tml_A288 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 100.0
2nwr_A267 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KD 100.0
1wvo_A79 Sialic acid synthase; antifreeze protein like doma 99.65
1n8f_A350 DAHP synthetase; (beta/alpha)8 barrel, metal bindi 99.57
1of8_A370 Phospho-2-dehydro-3-deoxyheptonate aldolase, tyros 99.42
1ucs_A64 Antifreeze peptide RD1; small beta barrel, pretzel 98.35
1ops_A64 Type III AFP, type III antifreeze protein; ICE cry 98.33
1msi_A70 Type III antifreeze protein isoform HPLC 12; multi 98.29
3tqk_A346 Phospho-2-dehydro-3-deoxyheptonate aldolase; trans 98.1
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 97.44
3tee_A219 Flagella basal BODY P-ring formation protein FLGA; 97.15
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 97.07
3frn_A278 Flagellar protein FLGA; structural genomics, perip 96.89
3t7v_A350 Methylornithine synthase PYLB; TIM-barrel fold, mu 96.75
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 96.72
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 96.69
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 96.67
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 96.57
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 96.46
1pii_A452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 96.41
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 96.1
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 96.04
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 95.97
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 95.88
1c89_A134 RD3, antifreeze protein type III; thermal hysteres 95.77
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 95.7
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 95.69
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 95.63
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 95.57
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 95.46
3ble_A337 Citramalate synthase from leptospira interrogans; 95.45
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 95.42
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 95.27
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 95.23
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 95.2
1c89_A134 RD3, antifreeze protein type III; thermal hysteres 95.2
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 95.16
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 95.1
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 95.05
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 95.03
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 95.0
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 94.98
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 94.91
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 94.91
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 94.85
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 94.73
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 94.72
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 94.69
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 94.61
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 94.51
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 94.48
2vef_A314 Dihydropteroate synthase; antibiotic resistance, t 94.47
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 94.46
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 94.41
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 94.31
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM r 94.25
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 94.15
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 94.05
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 94.03
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 93.98
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 93.96
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 93.96
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 93.94
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 93.91
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 93.86
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 93.85
1f6y_A262 5-methyltetrahydrofolate corrinoid/iron sulfur PR 93.84
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 93.84
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 93.78
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 93.76
4had_A350 Probable oxidoreductase protein; structural genomi 93.73
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 93.71
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 93.67
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 93.66
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 93.45
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 93.35
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 93.33
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 93.3
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 93.3
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 93.24
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 93.19
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 93.14
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 93.13
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 93.06
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 93.01
4h3v_A390 Oxidoreductase domain protein; structural genomics 92.99
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 92.96
3mcm_A442 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine 92.89
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 92.87
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 92.81
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 92.77
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 92.75
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 92.75
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 92.54
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 92.52
2ztj_A382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 92.36
2dqw_A294 Dihydropteroate synthase; dimer, structural genomi 92.33
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 92.3
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 92.25
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 92.25
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 92.21
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 92.2
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 92.16
3oqb_A383 Oxidoreductase; structural genomics, protein struc 92.07
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 91.99
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 91.92
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 91.91
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 91.86
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 91.71
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 91.67
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 91.65
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 91.65
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 91.63
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 91.51
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 91.43
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 91.38
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 91.32
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 91.3
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 91.28
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 91.21
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 91.21
4hb7_A270 Dihydropteroate synthase; transferase; 1.95A {Stap 91.13
2y5s_A294 DHPS, dihydropteroate synthase; transferase, folat 91.1
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 90.91
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 90.79
2h9a_B310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 90.78
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 90.76
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 90.71
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 90.59
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 90.57
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, 90.49
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 90.43
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 90.41
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 90.39
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 90.36
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 90.26
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 90.23
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 90.21
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 90.17
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 90.14
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 90.13
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 90.09
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 90.06
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 89.95
2ffi_A288 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; 89.93
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 89.44
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 89.27
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 89.21
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 89.17
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 89.09
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 89.07
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 88.99
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 88.95
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 88.9
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 88.88
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 88.76
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 88.45
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 88.28
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 88.17
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 88.03
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 87.89
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 87.89
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 87.78
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 87.7
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 87.43
3k13_A300 5-methyltetrahydrofolate-homocysteine methyltrans; 87.43
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 87.38
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 87.37
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 87.35
3o74_A272 Fructose transport system repressor FRUR; dual tra 87.34
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 87.11
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 87.09
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 87.03
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 87.02
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 86.95
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 86.94
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 86.94
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 86.89
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 86.82
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 86.74
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 86.74
1ydw_A362 AX110P-like protein; structural genomics, protein 86.71
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 86.68
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 86.65
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 86.46
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 86.37
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 86.2
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 85.87
3euw_A344 MYO-inositol dehydrogenase; protein structure init 85.77
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 85.66
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 85.64
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 85.6
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 85.51
3qk7_A294 Transcriptional regulators; structural genomics, N 85.42
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 85.42
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 85.36
2rgy_A290 Transcriptional regulator, LACI family; 11011J, NY 85.33
3k4h_A292 Putative transcriptional regulator; structural gen 85.33
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 85.32
3ivs_A423 Homocitrate synthase, mitochondrial; TIM barrel, m 85.08
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 85.01
3tb6_A298 Arabinose metabolism transcriptional repressor; tr 84.84
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 84.75
2h9a_A445 Carbon monoxide dehydrogenase corrinoid/iron- sulf 84.72
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 84.66
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 84.63
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 84.62
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 84.57
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 84.54
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 84.53
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 84.29
2pln_A137 HP1043, response regulator; signaling protein; 1.8 84.22
3brq_A296 HTH-type transcriptional regulator ASCG; transcrip 84.17
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 84.06
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 84.03
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 84.02
3bbl_A287 Regulatory protein of LACI family; protein structu 84.0
3d8u_A275 PURR transcriptional regulator; APC91343.1, vibrio 83.95
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 83.94
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 83.93
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 83.87
3dxi_A320 Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX 83.62
3e61_A277 Putative transcriptional repressor of ribose OPER; 83.61
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 83.58
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 83.58
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 83.52
3gt7_A154 Sensor protein; structural genomics, signal receiv 83.28
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 83.22
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 83.16
3jy6_A276 Transcriptional regulator, LACI family; NYSGXRC, P 83.1
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 83.09
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 82.9
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 82.88
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 82.84
3kts_A192 Glycerol uptake operon antiterminator regulatory; 82.83
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 82.76
3e3m_A355 Transcriptional regulator, LACI family; structural 82.75
3btv_A438 Galactose/lactose metabolism regulatory protein GA 82.69
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 82.65
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 82.43
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 82.41
3gv0_A288 Transcriptional regulator, LACI family; transcript 82.41
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 82.35
3dbi_A338 Sugar-binding transcriptional regulator, LACI FAM; 82.31
3hdg_A137 Uncharacterized protein; two-component sensor acti 82.29
3qtg_A461 Pyruvate kinase, PK; TIM barrel, glycolysis, trans 82.09
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 82.03
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 81.99
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 81.56
2bmb_A545 Folic acid synthesis protein FOL1; folate biosynth 81.29
4djd_D323 C/Fe-SP, corrinoid/iron-sulfur protein small subun 81.08
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 80.99
3kke_A303 LACI family transcriptional regulator; structural 80.79
3cnb_A143 DNA-binding response regulator, MERR family; signa 80.71
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 80.62
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 80.57
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 80.16
3heb_A152 Response regulator receiver domain protein (CHEY); 80.06
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 80.02
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 80.01
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
Probab=100.00  E-value=9e-93  Score=697.23  Aligned_cols=303  Identities=32%  Similarity=0.470  Sum_probs=286.9

Q ss_pred             CCCCcEEEeecccccccccccccCCCCCCCCCCcccHHHHHHhhcCCHHHHHHHHHHHHHcCCceEeccCChhhHHHHHh
Q psy17999          1 ECGADCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQVDIMFTASAMDQVSFDFLLS   80 (335)
Q Consensus         1 ~aGaDaVKFQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~el~~e~~~~L~~~~~~~Gi~f~stpfd~~svd~l~~   80 (335)
                      +|||||||||+|+++++++..+  .+|+.++.|+.++++++++++|++|||++|+++|+++||.|+|||||.++||+|++
T Consensus        55 ~aGAdavKfQ~~k~~tl~s~~~--~~fq~~~~~~~~~ye~~~~~~l~~e~~~~L~~~~~~~Gi~~~stpfD~~svd~l~~  132 (385)
T 1vli_A           55 EAGADAVKFQMFQADRMYQKDP--GLYKTAAGKDVSIFSLVQSMEMPAEWILPLLDYCREKQVIFLSTVCDEGSADLLQS  132 (385)
T ss_dssp             HHTCSEEEECCBCGGGGTSCCC-----------CCCHHHHGGGBSSCGGGHHHHHHHHHHTTCEEECBCCSHHHHHHHHT
T ss_pred             HhCCCEEeeeeeccCcccCcch--hhhccCCCCCccHHHHHHhcCCCHHHHHHHHHHHHHcCCcEEEccCCHHHHHHHHh
Confidence            4899999999999999998877  56766555776778999999999999999999999999999999999999999999


Q ss_pred             CCCCEEEEcCCCCCCHHHHHHHHhcCCcEEEeCCCCCCHHHHHHHHHHHHh-cCCCCceeecccCCCCCCCCcccccCce
Q psy17999         81 ANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIEHVDNIYTTVKQ-YHSNLSILHCVSAYPTPYPTVKQYHSNL  159 (335)
Q Consensus        81 l~v~~~KIaS~d~~n~~LL~~~a~~gkPvilStG~~~tl~Ei~~Av~~i~~-g~~~~~~~~c~~g~~~~~~~~~~~~~~l  159 (335)
                      +++|+|||||++++|+|||+++|++||||||||||+ |++||+.|+++|.+ ||.                       ++
T Consensus       133 ~~vd~~KIgS~~~~N~pLL~~va~~gKPViLStGma-Tl~Ei~~Ave~i~~~Gn~-----------------------~i  188 (385)
T 1vli_A          133 TSPSAFKIASYEINHLPLLKYVARLNRPMIFSTAGA-EISDVHEAWRTIRAEGNN-----------------------QI  188 (385)
T ss_dssp             TCCSCEEECGGGTTCHHHHHHHHTTCSCEEEECTTC-CHHHHHHHHHHHHTTTCC-----------------------CE
T ss_pred             cCCCEEEECcccccCHHHHHHHHhcCCeEEEECCCC-CHHHHHHHHHHHHHCCCC-----------------------cE
Confidence            999999999999999999999999999999999999 99999999999998 766                       89


Q ss_pred             EEeeecCCCCCCccCCCchHHHHHHHHCCCCCeecCCCCCC-hHHHHHHHHcCCcEEEeccCCCCCCCCCCCCCCCCHHH
Q psy17999        160 SILHCVSAYPTPYHDINLNVIHTLRSRYPDIPIGYSGHENG-VHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPE  238 (335)
Q Consensus       160 ~llHC~s~YP~~~~~~nL~~i~~L~~~fp~~pVG~SdHt~g-~~~~~aAvalGA~vIEkH~tld~~~~G~Dh~~Sl~p~e  238 (335)
                      +||||+|+||+|.+++||++|++||++||++|||||||+.| ..+++||||+||+||||||||||+++|+||.+||+|+|
T Consensus       189 iLlhc~s~YPtp~~~~nL~aI~~Lk~~f~~lpVG~SdHt~G~~~~~~AAvAlGA~iIEkHftldra~~G~D~~~SL~P~e  268 (385)
T 1vli_A          189 AIMHCVAKYPAPPEYSNLSVIPMLAAAFPEAVIGFSDHSEHPTEAPCAAVRLGAKLIEKHFTIDKNLPGADHSFALNPDE  268 (385)
T ss_dssp             EEEEECSSSSCCGGGCCTTHHHHHHHHSTTSEEEEEECCSSSSHHHHHHHHTTCSEEEEEBCSCTTSSCSSCTTSBCHHH
T ss_pred             EEEeccCCCCCChhhcCHHHHHHHHHHcCCCCEEeCCCCCCchHHHHHHHHcCCCEEEeCCCccccCCCCchhhhCCHHH
Confidence            99999999999999999999999999998999999999999 99999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHH-------------HHhCCCCccCCccccccccccceEEEEeecCCCCcccccCCcEEeeCCCC---CC
Q psy17999        239 LKALVTGIRDIE-------------QSLGSPTKRMQVSEAPCYAKLGKCIVSSCDIQAGTVLQEFHVCIKVAEPK---GI  302 (335)
Q Consensus       239 l~~lv~~ir~~~-------------~alG~~~k~~~~~E~~~~~~~rrsl~a~~di~~G~~l~~~dl~~kr~~~~---Gi  302 (335)
                      |++||+.+|.++             .+||++.|.+.++|+.++.++|||||+++||++|++||++||++||| +.   ||
T Consensus       269 f~~lv~~ir~i~~~~~~~~~~~~~~~alG~~~k~~~~~E~~~~~~~rrSlva~~di~~Ge~it~~nl~~kRP-g~~~~Gi  347 (385)
T 1vli_A          269 LKEMVDGIRKTEAELKQGITKPVSEKLLGSSYKTTTAIEGEIRNFAYRGIFTTAPIQKGEAFSEDNIAVLRP-GQKPQGL  347 (385)
T ss_dssp             HHHHHHHHHHHHHHHHHTCCCCCCHHHHCCSSCCCCTTTCSHHHHTSCEEEESSCBCTTCBCCTTTEEEECC-TTSCCCB
T ss_pred             HHHHHHHHHHHHhhcccccccchHHHHhCcccCccCHHHHHHHhhheeEEEEccccCCCCEecHHHeeEEcC-CCCCCCC
Confidence            999999999999             99999999999999999999999999999999999999999999995 67   99


Q ss_pred             CcchHHHHh-cchhhcccCCCCcccCCCC
Q psy17999        303 CGTRYASVM-GRKVNRDIRRDESIQDIDL  330 (335)
Q Consensus       303 ~p~~~~~vi-G~~~~~di~~~~~i~~~~l  330 (335)
                      +|.+|++|+ ||+++||+++|++|+|+||
T Consensus       348 ~p~~~~~vl~Gk~~~~di~~~~~i~~~~i  376 (385)
T 1vli_A          348 HPRFFELLTSGVRAVRDIPADTGIVWDDI  376 (385)
T ss_dssp             CGGGHHHHHTTCBCSSCBCTTCBCCGGGT
T ss_pred             CHHHHHHHhCCCEEccccCCCCccCHHHh
Confidence            999999999 9999999999999999998
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} Back     alignment and structure
>3tml_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.90A {Burkholderia cenocepacia} PDB: 3t4c_A Back     alignment and structure
>2nwr_A 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KDO8P, KDO8PS, PEP, A5P, transferase; HET: PEP; 1.50A {Aquifex aeolicus} PDB: 2nws_A* 2nx1_A* 3e0i_A* 1fwn_A* 1fwt_A* 1fws_A* 1fx6_A 1fww_A 1fxq_A* 1fy6_A* 1jcx_A* 1jcy_A* 1pck_A* 1pcw_A* 1fxp_A* 2a21_A* 2a2i_A* 1pe1_A* 3e12_A* 2nx3_A* ... Back     alignment and structure
>1wvo_A Sialic acid synthase; antifreeze protein like domain, N-acetylneuraminic acid phosphate synthase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1n8f_A DAHP synthetase; (beta/alpha)8 barrel, metal binding protein; HET: PEP; 1.75A {Escherichia coli} SCOP: c.1.10.4 PDB: 1gg1_A 1kfl_A* 1qr7_A* Back     alignment and structure
>1of8_A Phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited; beta-alpha-barrel, lyase, synthase, synthetase; HET: PEP G3P; 1.5A {Saccharomyces cerevisiae} SCOP: c.1.10.4 PDB: 1oab_A* 1of6_A* 1hfb_A* 1ofa_A* 1ofb_A 1ofo_A 1ofp_A 1ofq_A 1ofr_A* 1og0_A* Back     alignment and structure
>1ucs_A Antifreeze peptide RD1; small beta barrel, pretzel fold, antifreeze protein; 0.62A {Lycodichthys dearborni} SCOP: b.85.1.1 PDB: 9ame_A 1ame_A 1kde_A 1kdf_A 1gzi_A 1hg7_A 1b7i_A 2spg_A 1jab_A 1b7j_A 2msj_A 1ekl_A 4ame_A 7ame_A 3qf6_A 2ame_A 1msj_A 1b7k_A 6ame_A 9msi_A ... Back     alignment and structure
>1ops_A Type III AFP, type III antifreeze protein; ICE crystal growth inhibition, pretzel fold, glycoprotein; 2.00A {Macrozoarces americanus} SCOP: b.85.1.1 Back     alignment and structure
>1msi_A Type III antifreeze protein isoform HPLC 12; multigene family, thermal hysteresis; 1.25A {Macrozoarces americanus} SCOP: b.85.1.1 Back     alignment and structure
>3tqk_A Phospho-2-dehydro-3-deoxyheptonate aldolase; transferase; 2.30A {Francisella tularensis} Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>3tee_A Flagella basal BODY P-ring formation protein FLGA; chaperone, flagellar P-ring formation, flagellar FLGI protei periplasmic protein; 1.95A {Salmonella typhimurium} Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3frn_A Flagellar protein FLGA; structural genomics, periplasmic, PSI-2, protein structure initiative; 2.05A {Thermotoga maritima} Back     alignment and structure
>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri} Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>1c89_A RD3, antifreeze protein type III; thermal hysteresis protein, ICE binding protein; NMR {Pachycara brachycephalum} SCOP: b.85.1.1 b.85.1.1 PDB: 1c8a_A 3nla_A 3rdn_A Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>1c89_A RD3, antifreeze protein type III; thermal hysteresis protein, ICE binding protein; NMR {Pachycara brachycephalum} SCOP: b.85.1.1 b.85.1.1 PDB: 1c8a_A 3nla_A 3rdn_A Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>2vef_A Dihydropteroate synthase; antibiotic resistance, transferase, folate biosynthesis; 1.8A {Streptococcus pneumoniae} PDB: 2veg_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A* Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3mcm_A 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase/dihydropteroate...; folate, TIM barrel, synthase, HPPK, DHPS; 2.20A {Francisella tularensis subsp} PDB: 3mcn_A* 3mco_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>2dqw_A Dihydropteroate synthase; dimer, structural genomics; 1.65A {Thermus thermophilus} PDB: 2dza_A* 2dzb_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A* Back     alignment and structure
>2y5s_A DHPS, dihydropteroate synthase; transferase, folate biosynthesis; HET: 78H; 1.95A {Burkholderia cenocepacia} PDB: 2y5j_A* Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>2ffi_A 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; TIM-barrel protein., structural genomics, PSI, protein struc initiative; 2.61A {Pseudomonas putida} SCOP: c.1.9.15 Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>3k13_A 5-methyltetrahydrofolate-homocysteine methyltrans; 5-methyltetrahydrofolate,methyltransferase, TIM barrel, STRU genomics, PSI-2; HET: MSE THH GOL; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} Back     alignment and structure
>3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2h9a_A Carbon monoxide dehydrogenase corrinoid/iron- sulfur protein, gamma subunit; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_A* Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} Back     alignment and structure
>3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>3qtg_A Pyruvate kinase, PK; TIM barrel, glycolysis, transferase; 2.20A {Pyrobaculum aerophilum} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2bmb_A Folic acid synthesis protein FOL1; folate biosynthesis, transferase, ligase, multifunctional enzyme; HET: PMM; 2.3A {Saccharomyces cerevisiae} Back     alignment and structure
>4djd_D C/Fe-SP, corrinoid/iron-sulfur protein small subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_D* 4djf_D* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 335
d2zdra2280 c.1.10.6 (A:2-281) Capsule biosynthesis protein Si 5e-30
d1vlia2295 c.1.10.6 (A:2-296) Spore coat polysaccharide biosy 2e-28
d1o60a_281 c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosp 3e-16
d1vr6a1338 c.1.10.4 (A:1-338) 3-deoxy-D-arabino-heptulosonate 2e-11
d1opsa_64 b.85.1.1 (A:) Type III antifreeze protein, AFP III 2e-10
d2zdra168 b.85.1.1 (A:282-349) Capsule biosynthesis protein 3e-09
d1ucsa_64 b.85.1.1 (A:) Type III antifreeze protein, AFP III 4e-08
d1vlia172 b.85.1.1 (A:297-368) Spore coat polysaccharide bio 8e-06
>d2zdra2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]} Length = 280 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: NeuB-like
domain: Capsule biosynthesis protein SiaC, N-terminal domain
species: Neisseria meningitidis [TaxId: 487]

 Score =  113 bits (283), Expect = 5e-30
 Identities = 66/260 (25%), Positives = 115/260 (44%), Gaps = 27/260 (10%)

Query: 1   ECGADCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQ 60
             GA+ VK Q   +  + +    +   + P     +  +  +    ++E+ + L++  + 
Sbjct: 45  NAGAEVVKHQTHIVEDEMSD---EAKQVIPGNADVSIYEIMERCALNEEDEIKLKEYVES 101

Query: 61  VDIMFTASAMDQVSFDFLLSANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIE 120
             ++F ++   + +   L   ++P  KIGSG+ NN PLIK  AS  KP+I+STGM     
Sbjct: 102 KGMIFISTPFSRAAALRLQRMDIPAYKIGSGECNNYPLIKLVASFGKPIILSTGM----- 156

Query: 121 HVDNIYTTVKQYHSNLSILHCVSAYPTPYPTVKQYHSNLSILHCVSAYPTPYHDINLNVI 180
                              + + +       +++     ++LHC + YPTPY D+ L  +
Sbjct: 157 -------------------NSIESIKKSVEIIREAGVPYALLHCTNIYPTPYEDVRLGGM 197

Query: 181 HTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPELK 240
           + L   +PD  IG S H    + C  AVA+G  I+E+HFT      G D   S+ P   K
Sbjct: 198 NDLSEAFPDAIIGLSDHTLDNYACLGAVALGGSILERHFTDRMDRPGPDIVCSMNPDTFK 257

Query: 241 ALVTGIRDIEQSLGSPTKRM 260
            L  G   ++ + G     +
Sbjct: 258 ELKQGAHALKLARGGKKDTI 277
>d1vlia2 c.1.10.6 (A:2-296) Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 295 Back     information, alignment and structure
>d1o60a_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Haemophilus influenzae [TaxId: 727]} Length = 281 Back     information, alignment and structure
>d1vr6a1 c.1.10.4 (A:1-338) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} Length = 338 Back     information, alignment and structure
>d1opsa_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Ocean pout (Macrozoarces americanus), different isoforms [TaxId: 8199]} Length = 64 Back     information, alignment and structure
>d2zdra1 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis [TaxId: 487]} Length = 68 Back     information, alignment and structure
>d1ucsa_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Antarctic eel pout (Lycodichthys dearborni), RD1 isoform [TaxId: 8201]} Length = 64 Back     information, alignment and structure
>d1vlia1 b.85.1.1 (A:297-368) Spore coat polysaccharide biosynthesis protein SpsE, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 72 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query335
d2zdra2280 Capsule biosynthesis protein SiaC, N-terminal doma 100.0
d1vlia2295 Spore coat polysaccharide biosynthesis protein Sps 100.0
d1o60a_281 3-deoxy-D-manno-octulosonate 8-phosphate synthase 100.0
d1vr6a1338 3-deoxy-D-arabino-heptulosonate-7-phosphate syntha 100.0
d2a21a1263 3-deoxy-D-manno-octulosonate 8-phosphate synthase 99.89
d1opsa_64 Type III antifreeze protein, AFP III {Ocean pout ( 99.72
d2zdra168 Capsule biosynthesis protein SiaC, C-terminal doma 99.72
d1vlia172 Spore coat polysaccharide biosynthesis protein Sps 99.66
d1ucsa_64 Type III antifreeze protein, AFP III {Antarctic ee 99.08
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 96.88
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 96.67
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 96.19
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 95.67
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 94.98
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 94.82
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 94.47
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 94.31
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 93.72
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 93.29
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 92.82
d1tx2a_273 Dihydropteroate synthetase {Bacillus anthracis [Ta 92.28
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 92.19
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 92.09
d1ajza_282 Dihydropteroate synthetase {Escherichia coli [TaxI 91.72
d1ad1a_264 Dihydropteroate synthetase {Staphylococcus aureus 90.1
d1eyea_270 Dihydropteroate synthetase {Mycobacterium tubercul 89.63
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 89.53
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 89.43
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 89.29
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 88.34
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 86.45
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 86.16
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 86.09
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 86.02
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 85.82
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 84.98
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 84.93
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 84.77
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 84.77
d1sfla_236 Type I 3-dehydroquinate dehydratase {Staphylococcu 84.7
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 84.59
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 84.38
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 83.83
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 83.67
d1w6ta1296 Enolase {Streptococcus pneumoniae [TaxId: 1313]} 83.65
d1w3ia_293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 83.32
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 83.23
d1e0ta2246 Pyruvate kinase, N-terminal domain {Escherichia co 83.22
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 83.08
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 82.94
d1pkla2258 Pyruvate kinase, N-terminal domain {Leishmania mex 82.89
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 82.54
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 82.39
d2akza1294 Enolase {Human (Homo sapiens), gamma isoform [TaxI 82.38
d2al1a1295 Enolase {Baker's yeast (Saccharomyces cerevisiae) 82.38
d2fyma1292 Enolase {Escherichia coli [TaxId: 562]} 81.61
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 80.77
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 80.4
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 80.37
>d2zdra2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: NeuB-like
domain: Capsule biosynthesis protein SiaC, N-terminal domain
species: Neisseria meningitidis [TaxId: 487]

Probab=100.00  E-value=6.4e-65  Score=479.39  Aligned_cols=235  Identities=29%  Similarity=0.487  Sum_probs=220.0

Q ss_pred             CCCCcEEEeecccccccccccccCCCCCCCCCCcccHHHHHHhhcCCHHHHHHHHHHHHHcCCceEeccCChhhHHHHHh
Q psy17999          1 ECGADCVKFQKSCLSTKFTQSALDRPYLSPHAWANTYGQHKQHLEFSQEEYVMLQQCADQVDIMFTASAMDQVSFDFLLS   80 (335)
Q Consensus         1 ~aGaDaVKFQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~el~~e~~~~L~~~~~~~Gi~f~stpfd~~svd~l~~   80 (335)
                      ++||||||||+|.++++++++.....+   ..+..++++++++++|+.+||.+|+++|++.|+.|++||||.++++++.+
T Consensus        45 ~sGadaVKfQ~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~el~~~~~~~l~~~~k~~~i~~~~s~fd~~s~~~~~~  121 (280)
T d2zdra2          45 NAGAEVVKHQTHIVEDEMSDEAKQVIP---GNADVSIYEIMERCALNEEDEIKLKEYVESKGMIFISTPFSRAAALRLQR  121 (280)
T ss_dssp             HHTCSEEEEEECCHHHHCCGGGGGCCC---TTCSSCHHHHHHHHCCCHHHHHHHHHHHHHTTCEEEEEECSHHHHHHHHH
T ss_pred             HhCCCEEEecCcccchhcccccccccc---cccccccccccccccccchhhHHHHHHHHhcCCccccccchhhccccccc
Confidence            379999999999999999887644322   22345788999999999999999999999999999999999999999999


Q ss_pred             CCCCEEEEcCCCCCCHHHHHHHHhcCCcEEEeCCCCCCHHHHHHHHHHHHhcCCCCceeecccCCCCCCCCcccccCceE
Q psy17999         81 ANVPFIKIGSGDSNNIPLIKYAASKQKPLIISTGMLPSIEHVDNIYTTVKQYHSNLSILHCVSAYPTPYPTVKQYHSNLS  160 (335)
Q Consensus        81 l~v~~~KIaS~d~~n~~LL~~~a~~gkPvilStG~~~tl~Ei~~Av~~i~~g~~~~~~~~c~~g~~~~~~~~~~~~~~l~  160 (335)
                      ++++++||||++++|+|||++++++++||||||||+ +++||++|++++...+.                       +++
T Consensus       122 ~~~~~~KIaS~d~~n~~Li~~i~k~~kpiiiStG~s-~~~EI~~av~~~~~~~~-----------------------~~~  177 (280)
T d2zdra2         122 MDIPAYKIGSGECNNYPLIKLVASFGKPIILSTGMN-SIESIKKSVEIIREAGV-----------------------PYA  177 (280)
T ss_dssp             HTCSCEEECGGGTTCHHHHHHHHTTCSCEEEECTTC-CHHHHHHHHHHHHHHTC-----------------------CEE
T ss_pred             ccccceeccchhccccHhhhhhhhccCceeeccccc-chhHhhhhhhhhhhccc-----------------------cce
Confidence            999999999999999999999999999999999999 99999999999887555                       799


Q ss_pred             EeeecCCCCCCccCCCchHHHHHHHHCCCCCeecCCCCCChHHHHHHHHcCCcEEEeccCCCCCCCCCCCCCCCCHHHHH
Q psy17999        161 ILHCVSAYPTPYHDINLNVIHTLRSRYPDIPIGYSGHENGVHVCYAAVAMGAQIIEKHFTLDKSWKGSDHASSLTPPELK  240 (335)
Q Consensus       161 llHC~s~YP~~~~~~nL~~i~~L~~~fp~~pVG~SdHt~g~~~~~aAvalGA~vIEkH~tld~~~~G~Dh~~Sl~p~el~  240 (335)
                      ||||+|+||+|++++||+.|..|+++||+++|||||||.|..++++|+++||++||||||+||++.||||.+|++|+||+
T Consensus       178 llhc~s~YPt~~~~~nL~~i~~lk~~f~~~~iG~SdH~~g~~~~~~Ava~GA~~IEKH~tl~k~~~g~D~~~Sl~p~e~~  257 (280)
T d2zdra2         178 LLHCTNIYPTPYEDVRLGGMNDLSEAFPDAIIGLSDHTLDNYACLGAVALGGSILERHFTDRMDRPGPDIVCSMNPDTFK  257 (280)
T ss_dssp             EEECCCCSSCCGGGCCTTHHHHHHHHCTTSEEEEECCSSSSHHHHHHHHTTCCEEEEEBCSCTTCCSTTGGGCBCHHHHH
T ss_pred             EEEeeccCccccccccccccceeeccccccceeecCcccchhhHHHHHHCCCeEEEEEEEeCCCCCCCchhccCCHHHHH
Confidence            99999999999999999999999999987889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhCCCCccCCc
Q psy17999        241 ALVTGIRDIEQSLGSPTKRMQV  262 (335)
Q Consensus       241 ~lv~~ir~~~~alG~~~k~~~~  262 (335)
                      +||+.+|.++.+||++.|++.+
T Consensus       258 ~~v~~i~~~~~~lG~~~k~i~~  279 (280)
T d2zdra2         258 ELKQGAHALKLARGGKKDTIIA  279 (280)
T ss_dssp             HHHHHHHHHHHHSCCCTTCCCG
T ss_pred             HHHHHHHHHHHHcCCCCceeCC
Confidence            9999999999999999887653
>d1vlia2 c.1.10.6 (A:2-296) Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o60a_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vr6a1 c.1.10.4 (A:1-338) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a21a1 c.1.10.4 (A:1002-1264) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1opsa_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Ocean pout (Macrozoarces americanus), different isoforms [TaxId: 8199]} Back     information, alignment and structure
>d2zdra1 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1vlia1 b.85.1.1 (A:297-368) Spore coat polysaccharide biosynthesis protein SpsE, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ucsa_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Antarctic eel pout (Lycodichthys dearborni), RD1 isoform [TaxId: 8201]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1eyea_ c.1.21.1 (A:) Dihydropteroate synthetase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1sfla_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1w6ta1 c.1.11.1 (A:138-433) Enolase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0ta2 c.1.12.1 (A:1-69,A:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pkla2 c.1.12.1 (A:1-87,A:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2akza1 c.1.11.1 (A:140-433) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d2al1a1 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fyma1 c.1.11.1 (A:140-431) Enolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure