Psyllid ID: psy18075


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------100
MAAALVLEDDEGECSDEEQDEESEEENDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSHNTSNQSHSVSQLKQHSVTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLVPSTTTLQSLTVLSCSLMKSTVSLKTENLVFVLTKNHCAYHVDRYLESMLLAIMKVSSLVPSTTTLPSSSLFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKTLVIKVPISGFLNGEVETFVPPEVLLKLHTIADQEEGWIKVINSMVSVIPIDNPLGPAVIELNHKGRMTDKPNDDVSDILKKLESISVESGQDSTKLSFAGQGLKLDNKEDAKVIVDAINEVKVLVSLNLEGNTLGVNAAKAIADALSKHEHFKRALWKDMFTGRMKTEIPDALRYLGNGLQQAGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLEDDEGECSDEEQDEESEEENDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSHNTSNQSHSVSQLKQHSVTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLVPSTTTLQSPSSSLFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKSRAGIQLDTVIRLCKMFDLSKESSTKGRRTPCQQCNMCIILGLLAEKLAGPSSVAMLTQGTLEYLVANLSCT
ccccccccccccccccHHHcHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccEEEEcccccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHHHHHHHcccccccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHHccccccccccccccccccHHHHccccccccccccccccccccccccHHHccHHHHHccccHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccEEEEccccHHHHHHHccccc
ccEEEEEcccccccccHHHccccHHccccccccccccccccccccccccccccccccccccccccccccHHHHccccHHHHcccccHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHEHHHHHcccEcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccEEcccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccEEEccHHHHHcccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccEEEccccccccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHHcccccHccccccccccccHHHHHccccccccccccccccccccccccccccHHHHHccccHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccc
MAAALVleddegecsdeeqdeeseeendsdaegdnsnlshndsnhshnasnqshnnsnqshntsnqshsvsqlkqhsvtdflaapsvslfnslgpncAQLFLDeinsepedRYLESMLLAIMKVSslvpstttlqSLTVLSCSLMKSTVSLKTENLVFVLTKNHCAYHVDRYLESMLLAIMKVSslvpstttlpssslfECTKVLYRELFNWASNSDKLSTVTNALLVHLGlikcedksfkiNYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKTLVIKVPisgflngevetfvppevLLKLHTIADQEEGWIKVINSMVSVipidnplgpavielnhkgrmtdkpnddVSDILKKLESIsvesgqdstklsfagqglkldnkEDAKVIVDAINEVKVLVSLNLEGNTLGVNAAKAIADALSKHEHFKRALWKDMFTGRMKTEIPDALRYLGNGLQQAGARLVEldlsdnafgpigVEGLADLLRSSCCFALEElklnnnglgitGCKLLSKALHDCyesskkegspLALKVFIAGRNRLENEGAKMLAAVFKKLKTLErvempqngiyhVGITALSDAFEenknlrhlnlndntitykgaiplgqalsklpslAILNLGDCLLKSAGASSIAkyltdnttledvnLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVleddegecsdeeqdeeseeendsdaegdnsnlshndsnhshnasnqshnnsnqshntsnqshsvsqlkqhsvtdflaapsvslfnslgpncAQLFLDeinsepedRYLESMLLAIMKVSslvpstttlqspssslfECTKVLYRELFNWASNSDKLSTVTNALLVHLGlikcedksfkiNYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKSRAGIQLDTVIRLCKMFdlskesstkgrrtpcqqcnMCIILGLLAeklagpssvamLTQGTLEYLVANLSCT
maaalvleddegecsdeeqdeeSEEENDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSHNTSNQSHSVSQLKQHSVTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLVPSTTTLQSLTVLSCSLMKSTVSLKTENLVFVLTKNHCAYHVDRYLESMLLAIMKVSSLVPstttlpsssLFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKTLVIKVPISGFLNGEVETFVPPEVLLKLHTIADQEEGWIKVINSMVSVIPIDNPLGPAVIELNhkgrmtdkpnDDVSDILKKLESisvesgqdstklsfagqglkldnkEDAKVIVDAINEVKVLVSLNLEGNTLGVNAAKAIADALSKHEHFKRALWKDMFTGRMKTEIPDALRYLGNGLQQAGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYEsskkegsplALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTklkqinvsenqfgEEGVEEMEKLMKSFGMAAALVLEDDEGECSDEEQDEESEEENDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSHNTSNQSHSVSQLKQHSVTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLVPStttlqspssslFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKSRAGIQLDTVIRLCKMFDLSkesstkgrrtpcqQCNMCIILGLLAEKLAGPSSVAMLTQGTLEYLVANLSCT
MAAALVLeddegecsdeeqdeeseeendsdaegdnsnlshndsnhshnasnqshnnsnqshntsnqshsvsqLKQHSVTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKvsslvpstttlqsltvlscslMKSTVSLKTENLVFVLTKNHCAYHVDRYLESMLLAIMKvsslvpstttlpssslFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKTLVIKVPISGFLNGEVETFVPPEVLLKLHTIADQEEGWIKVINSMVSVIPIDNPLGPAVIELNHKGRMTDKPNDDVSDILKKLESISVESGQDSTKLSFAGQGLKLDNKEDAKVIVDAINEVKVLVSLNLEGNTLGVNAAKAIADALSKHEHFKRALWKDMFTGRMKTEIPDALRYLGNGLQQAGARLVELDLSDNAFGPIGVEGLADLLRSSCCFAleelklnnnglgITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLeddegecsdeeqdeeseeendsdaegdnsnlshndsnhshnasnqshnnsnqshntsnqshsvsqLKQHSVTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKvsslvpstttlqspssslFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKSRAGIQLDTVIRLCKMFDLSKESSTKGRRTPCQQCNMCIILGLLAEKLAGPSSVAMLTQGTLEYLVANLSCT
******************************************************************************TDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLVPSTTTLQSLTVLSCSLMKSTVSLKTENLVFVLTKNHCAYHVDRYLESMLLAIMKVSSLVPSTTTLPSSSLFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKTLVIKVPISGFLNGEVETFVPPEVLLKLHTIADQEEGWIKVINSMVSVIPIDNPLGPAVIELN**************************************************VIVDAINEVKVLVSLNLEGNTLGVNAAKAIADALSKHEHFKRALWKDMFTGRMKTEIPDALRYLGNGLQQAGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYES*****SPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKN************************************************************************************************************TDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLVPS*********SLFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKSRAGIQLDTVIRLCKMFDLS*********TPCQQCNMCIILGLLAEKLAGPSSVAMLTQGTLEYLVANL***
***ALVL*******************************************************************QHSVTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLVPSTTTLQSLTVLSCSLMKSTVSLKTENLVFVLTKNHCAYHVDRYLESMLLAIMKVSSLVP**********FECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKTLVIKVPISGFLNGEVETFVPPEVLLKLHTIADQEEGWIKVINSMVSVIPIDNPLGPAVIELNHKGRMTDKPNDDVSDILKKLESISVESGQDSTKLSFAGQGLKLDNKEDAKVIVDAINEVKVLVSLNLEGNTLGVNAAKAIADALSKHEHFKRALWKDMFTGRMKTEIPDALRYLGNGLQQAGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLEDDEGECSDEE*************EGDNSNLSHNDSNHS*******************************VTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVS**************SLFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEK********************************CQQCNMCIILGLLAEKLAGPSSVAMLTQGTLEYLVANLSC*
***********************************SNLSHN*********************************QHSVTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLVPSTTTLQSLTVLSCSLMKSTVSLKTENLVFVLTKNHCAYHVDRYLESMLLAIMKVSSLVPSTTTLPSSSLFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKTLVIKVPISGFLNGEVETFVPPEVLLKLHTIADQEEGWIKVINSMVSVIPIDNPLGPAVIELNHKGRMTDKPNDDVSDILKKLESIS********KLSFAGQGLKLDNKEDAKVIVDAINEVKVLVSLNLEGNTLGVNAAKAIADALSKHEHFKRALWKDMFTGRMKTEIPDALRYLGNGLQQAGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDC********SPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLED**************************SNLSHN*********************************QHSVTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLV***********SLFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKSRAGIQLDTVIRLCKMFDLSK********TPCQQCNMCIILGLLAEKLAGPSSVAMLTQGTLEYLVANLSCT
****************************************************************************SVTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLVPSTTTLQSLTVLSCSLMKSTVSLKTENLVFVLTKNHCAYHVDRYLESMLLAIMKVSSLVPSTTTLPSSSLFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKTLVIKVPISGFLNGEVETFVPPEVLLKLHTIADQEEGWIKVINSMVSVIPIDNPLGPAVIELNHKGRMTDKPNDDVSDILKKLESISVESGQDSTKLSFAGQGLKLDNKEDAKVIVDAINEVKVLVSLNLEGNTLGVNAAKAIADALSKHEHFKRALWKDMFTGRMKTEIPDALRYLGNGLQQAGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLEDDEGECSDEEQDEESEEENDSDAEGDN**************************************KQHSVTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLVPSTTTLQSPSSSLFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKSRAGIQLDTVIRLCKMFDLSKES*T*GRRTPCQQCNMCIILGLLAEKLAGPSSVAMLTQGTLEYLVANLSCT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAALVxxxxxxxxxxxxxxxxxxxxxDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSHNTSNQSHSVSQLKQHSVTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLVPSTTTLQSLTVLSCSLMKSTVSLKTENLVFVLTKNHCAYHVDRYLESMLLAIMKVSSLVPSTTTLPSSSLFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKTLVIKVPISGFLNGEVETFVPPEVLLKLHTIADQEEGWIKVINSMVSVIPIDNPLGPAVIELNHKGRMTDKPNDDVSDILKKLESISVESGQDSTKLSFAGQGLKLDNKEDAKVIVDAINEVKVLVSLNLEGNTLGVNAAKAIADALSKHEHFKRALWKDMFTGRMKTEIPDALRYLGNGLQQAGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVxxxxxxxxxxxxxxxxxxxxxDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSHNTSNQSHSVSQLKQHSVTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLVPSTTTLQSPSSSLFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEKKSRAGIQLDTVIRLCKMFDLSKESSTKGRRTPCQQCNMCIILGLLAEKLAGPSSVAMLTQGTLEYLVANLSCT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query999 2.2.26 [Sep-21-2011]
P46060587 Ran GTPase-activating pro yes N/A 0.550 0.936 0.407 2e-97
P46061589 Ran GTPase-activating pro yes N/A 0.549 0.932 0.398 1e-93
O13066580 Ran GTPase-activating pro N/A N/A 0.347 0.598 0.482 3e-90
Q9VIW3596 Ran GTPase-activating pro yes N/A 0.365 0.612 0.455 4e-82
P34342960 Ran GTPase-activating pro yes N/A 0.312 0.325 0.459 2e-66
P41391386 Ran GTPase-activating pro yes N/A 0.320 0.829 0.35 7e-35
P11745407 Ran GTPase-activating pro yes N/A 0.263 0.646 0.350 3e-29
Q7RTR21065 Protein NLRC3 OS=Homo sap no N/A 0.326 0.306 0.273 4e-16
Q5DU561064 Protein NLRC3 OS=Mus musc no N/A 0.233 0.218 0.289 7e-16
Q9LE82535 RAN GTPase-activating pro yes N/A 0.278 0.519 0.248 2e-13
>sp|P46060|RAGP1_HUMAN Ran GTPase-activating protein 1 OS=Homo sapiens GN=RANGAP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  357 bits (917), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 234/574 (40%), Positives = 337/574 (58%), Gaps = 24/574 (4%)

Query: 354 NDDVSDILKKLESISVESGQDSTKLSFAGQGLKLDNKEDAKVIVDAINEVKVLVSLNLEG 413
           ++D++ + + L    V  GQ    LSF G+ LKL+  EDAK ++  I +   L +L LEG
Sbjct: 3   SEDIAKLAETLAKTQVAGGQ----LSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEG 58

Query: 414 NTLGVNAAKAIADALSKHEHFKRALWKDMFTGRMKTEIPDALRYLGNGLQQAGARLVELD 473
           NT+GV AA+ IA AL K    KR  W DMFTGR++TEIP AL  LG GL  AGA+LVELD
Sbjct: 59  NTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELD 118

Query: 474 LSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGS 533
           LSDNAFGP GV+G   LL+SS CF L+ELKLNN G+GI G K+L+ AL +C+  S  +G 
Sbjct: 119 LSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGK 178

Query: 534 PLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNL 593
           PLALKVF+AGRNRLEN+GA  LA  F+ + TLE V MPQNGI H GITAL+ AF  N  L
Sbjct: 179 PLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGINHPGITALAQAFAVNPLL 238

Query: 594 RHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDN-TTLEDV 652
           R +NLNDNT T KGA+ + + L  L  + ++N GDCL++S GA +IA  +      L+++
Sbjct: 239 RVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKEL 298

Query: 653 NLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAAL--VL 710
           NL+  EI     L + +AM +K +L++++++ N  GEEG E+++++++ F MA  L  + 
Sbjct: 299 NLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLS 358

Query: 711 EDDEGECSDEEQDEESEEENDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSH-----N 765
           +D++ E  +E ++EE E E + + + +       +         Q   ++  S      N
Sbjct: 359 DDEDEEEEEEGEEEEEEAEEEEEEDEEEEEEEEEEEEEEPQQRGQGEKSATPSRKILDPN 418

Query: 766 TSNQSHSVSQLKQHSVTDFLAAPSVSLFNSLGPNCAQLFLDEIN-SEPEDRYLESMLLAI 824
           T   +  +S      V+ FLA PS      LGP  + L   + + S+P     E ++ A 
Sbjct: 419 TGEPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDP-----EKVVSAF 473

Query: 825 MKVSSLVPSTTTLQSPSSSLFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDK 884
           +KVSS+     T++    ++ +    L ++ FN  S+S   +T    LLVH+GL+K EDK
Sbjct: 474 LKVSSVFKDEATVR---MAVQDAVDALMQKAFN--SSSFNSNTFLTRLLVHMGLLKSEDK 528

Query: 885 SFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLA 918
             K   NL G + A+  + +    P      LLA
Sbjct: 529 -VKAIANLYGPLMALNHMVQQDYFPKALAPLLLA 561




GTPase activator for the nuclear Ras-related regulatory protein Ran, converting it to the putatively inactive GDP-bound state.
Homo sapiens (taxid: 9606)
>sp|P46061|RAGP1_MOUSE Ran GTPase-activating protein 1 OS=Mus musculus GN=Rangap1 PE=1 SV=2 Back     alignment and function description
>sp|O13066|RAGP1_XENLA Ran GTPase-activating protein 1 OS=Xenopus laevis GN=rangap1 PE=2 SV=1 Back     alignment and function description
>sp|Q9VIW3|RAGP1_DROME Ran GTPase-activating protein OS=Drosophila melanogaster GN=RanGap PE=1 SV=1 Back     alignment and function description
>sp|P34342|RGP2_CAEEL Ran GTPase-activating protein 2 OS=Caenorhabditis elegans GN=ran-2 PE=4 SV=3 Back     alignment and function description
>sp|P41391|RNA1_SCHPO Ran GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rna1 PE=1 SV=1 Back     alignment and function description
>sp|P11745|RNA1_YEAST Ran GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA1 PE=1 SV=2 Back     alignment and function description
>sp|Q7RTR2|NLRC3_HUMAN Protein NLRC3 OS=Homo sapiens GN=NLRC3 PE=2 SV=2 Back     alignment and function description
>sp|Q5DU56|NLRC3_MOUSE Protein NLRC3 OS=Mus musculus GN=Nlrc3 PE=2 SV=2 Back     alignment and function description
>sp|Q9LE82|RAGP1_ARATH RAN GTPase-activating protein 1 OS=Arabidopsis thaliana GN=RANGAP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query999
91078814534 PREDICTED: similar to ran gtpase-activat 0.346 0.647 0.632 1e-117
242019857588 Ran GTPase-activating protein, putative 0.553 0.940 0.416 1e-108
332019511583 Ran GTPase-activating protein 1 [Acromyr 0.544 0.933 0.441 1e-107
157117093583 ran gtpase-activating protein [Aedes aeg 0.499 0.855 0.425 1e-103
328790127598 PREDICTED: ran GTPase-activating protein 0.514 0.859 0.452 1e-102
72003823583 Ran GTPase-activating protein [Aedes aeg 0.499 0.855 0.424 1e-102
350396997595 PREDICTED: ran GTPase-activating protein 0.543 0.912 0.439 1e-102
340716605594 PREDICTED: LOW QUALITY PROTEIN: ran GTPa 0.522 0.878 0.442 1e-102
380018240598 PREDICTED: LOW QUALITY PROTEIN: ran GTPa 0.516 0.862 0.453 1e-101
322796742553 hypothetical protein SINV_13014 [Solenop 0.488 0.882 0.455 1e-101
>gi|91078814|ref|XP_970649.1| PREDICTED: similar to ran gtpase-activating protein [Tribolium castaneum] gi|270003723|gb|EFA00171.1| hypothetical protein TcasGA2_TC002993 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  429 bits (1104), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 222/351 (63%), Positives = 265/351 (75%), Gaps = 5/351 (1%)

Query: 354 NDDVSDILKKLESISVESGQDSTKLSFAGQGLKLDNKEDAKVIVDAINEVKVLVSLNLEG 413
           N +V D+   L+   V      T ++FAGQ LKLD  +DAK +++ I +   L  LNLEG
Sbjct: 3   NTNVDDLTSALQGTRV----SPTGVTFAGQSLKLDTVDDAKSVIEEIEKCTNLQFLNLEG 58

Query: 414 NTLGVNAAKAIADALSKHEHFKRALWKDMFTGRMKTEIPDALRYLGNGLQQAGARLVELD 473
           NTLGV A+K IA AL KH  FKRALWKDMFTGRMKTEIP AL +LG+GL  AGARL ELD
Sbjct: 59  NTLGVEASKGIAKALEKHPEFKRALWKDMFTGRMKTEIPKALEFLGSGLVTAGARLTELD 118

Query: 474 LSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGS 533
           +SDNAFGPIGVEGLA LLRSS C+ALEEL+LNNNGLGITG KLL+ AL DCY SSK+ G 
Sbjct: 119 MSDNAFGPIGVEGLAALLRSSSCYALEELRLNNNGLGITGGKLLASALTDCYNSSKETGK 178

Query: 534 PLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNL 593
           PL LKVFIAGRNRLENEGAK LA VFK + TLE + MPQNGIYHVGI+ALS+AF +NKNL
Sbjct: 179 PLQLKVFIAGRNRLENEGAKALAEVFKMIGTLEEIAMPQNGIYHVGISALSEAFTQNKNL 238

Query: 594 RHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYL-TDNTTLEDV 652
           + LNLNDNTI  KGA  + +AL  L  L  +N GDCLLK+AGA S+A  L T +  LE++
Sbjct: 239 QILNLNDNTIGEKGAEAIAKALPHLQQLKEINFGDCLLKTAGAISLANVLKTGHANLEEL 298

Query: 653 NLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFG 703
            L  NEI ++GGL LVKAM NK+KLK +N++ NQFGE+G +++E  +K  G
Sbjct: 299 TLGHNEIRLKGGLQLVKAMANKSKLKVLNLNGNQFGEDGRKQIETEIKQIG 349




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242019857|ref|XP_002430375.1| Ran GTPase-activating protein, putative [Pediculus humanus corporis] gi|212515499|gb|EEB17637.1| Ran GTPase-activating protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332019511|gb|EGI59990.1| Ran GTPase-activating protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157117093|ref|XP_001658696.1| ran gtpase-activating protein [Aedes aegypti] gi|108876187|gb|EAT40412.1| AAEL007858-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|328790127|ref|XP_395378.4| PREDICTED: ran GTPase-activating protein 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|72003823|gb|AAZ65852.1| Ran GTPase-activating protein [Aedes aegypti] gi|77808099|gb|ABB03731.1| Ran GTPase-activating protein [Aedes aegypti] Back     alignment and taxonomy information
>gi|350396997|ref|XP_003484734.1| PREDICTED: ran GTPase-activating protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340716605|ref|XP_003396787.1| PREDICTED: LOW QUALITY PROTEIN: ran GTPase-activating protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380018240|ref|XP_003693041.1| PREDICTED: LOW QUALITY PROTEIN: ran GTPase-activating protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|322796742|gb|EFZ19175.1| hypothetical protein SINV_13014 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query999
UNIPROTKB|P46060587 RANGAP1 "Ran GTPase-activating 0.351 0.597 0.474 5e-89
UNIPROTKB|F1MFD5585 RANGAP1 "Uncharacterized prote 0.351 0.6 0.469 1.2e-87
UNIPROTKB|F1NIE8579 RANGAP1 "Uncharacterized prote 0.351 0.606 0.463 2.1e-86
UNIPROTKB|F1PVY6628 RANGAP1 "Uncharacterized prote 0.351 0.558 0.463 9.2e-86
UNIPROTKB|J9NZ28641 RANGAP1 "Uncharacterized prote 0.351 0.547 0.463 9.2e-86
MGI|MGI:103071589 Rangap1 "RAN GTPase activating 0.351 0.595 0.471 1.9e-85
UNIPROTKB|F1MAA5586 Rangap1 "Protein Rangap1" [Rat 0.351 0.598 0.463 5.7e-84
UNIPROTKB|O13066580 rangap1 "Ran GTPase-activating 0.350 0.603 0.456 1.2e-83
ZFIN|ZDB-GENE-040426-1921577 rangap1b "Ran GTPase activatin 0.347 0.601 0.461 3.6e-82
RGD|1310380431 Rangap1 "RAN GTPase activating 0.351 0.814 0.466 4.8e-78
UNIPROTKB|P46060 RANGAP1 "Ran GTPase-activating protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 808 (289.5 bits), Expect = 5.0e-89, Sum P(2) = 5.0e-89
 Identities = 169/356 (47%), Positives = 230/356 (64%)

Query:   354 NDDVSDILKKLESISVESGQDSTKLSFAGQGLKLDNKEDAKVIVDAINEVKVLVSLNLEG 413
             ++D++ + + L    V  GQ    LSF G+ LKL+  EDAK ++  I +   L +L LEG
Sbjct:     3 SEDIAKLAETLAKTQVAGGQ----LSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEG 58

Query:   414 NTLGVNAAKAIADALSKHEHFKRALWKDMFTGRMKTEIPDALRYLGNGLQQAGARLVELD 473
             NT+GV AA+ IA AL K    KR  W DMFTGR++TEIP AL  LG GL  AGA+LVELD
Sbjct:    59 NTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELD 118

Query:   474 LSDNAFGPIGVEGLADLLRSSCCFAXXXXXXXXXXXXITGCKLLSKALHDCYESSKKEGS 533
             LSDNAFGP GV+G   LL+SS CF             I G K+L+ AL +C+  S  +G 
Sbjct:   119 LSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGK 178

Query:   534 PLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNL 593
             PLALKVF+AGRNRLEN+GA  LA  F+ + TLE V MPQNGI H GITAL+ AF  N  L
Sbjct:   179 PLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGINHPGITALAQAFAVNPLL 238

Query:   594 RHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTT-LEDV 652
             R +NLNDNT T KGA+ + + L  L  + ++N GDCL++S GA +IA  +      L+++
Sbjct:   239 RVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKEL 298

Query:   653 NLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAAL 708
             NL+  EI     L + +AM +K +L++++++ N  GEEG E+++++++ F MA  L
Sbjct:   299 NLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVL 354


GO:0005098 "Ran GTPase activator activity" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0048471 "perinuclear region of cytoplasm" evidence=IEA
GO:0000777 "condensed chromosome kinetochore" evidence=IEA
GO:0000922 "spindle pole" evidence=IEA
GO:0031965 "nuclear membrane" evidence=IEA
GO:0000776 "kinetochore" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005643 "nuclear pore" evidence=TAS
GO:0005737 "cytoplasm" evidence=TAS
GO:0000087 "M phase of mitotic cell cycle" evidence=TAS
GO:0000236 "mitotic prometaphase" evidence=TAS
GO:0000278 "mitotic cell cycle" evidence=TAS
GO:0005829 "cytosol" evidence=TAS
GO:0046826 "negative regulation of protein export from nucleus" evidence=IDA
GO:0032853 "positive regulation of Ran GTPase activity" evidence=TAS
UNIPROTKB|F1MFD5 RANGAP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIE8 RANGAP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PVY6 RANGAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZ28 RANGAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:103071 Rangap1 "RAN GTPase activating protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAA5 Rangap1 "Protein Rangap1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O13066 rangap1 "Ran GTPase-activating protein 1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1921 rangap1b "Ran GTPase activating protein 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1310380 Rangap1 "RAN GTPase activating protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query999
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-62
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 7e-47
pfam07834169 pfam07834, RanGAP1_C, RanGAP1 C-terminal domain 2e-06
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.003
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
 Score =  212 bits (543), Expect = 7e-62
 Identities = 131/331 (39%), Positives = 185/331 (55%), Gaps = 22/331 (6%)

Query: 386 KLDNKEDAKVIVDAINEVKVLVSLNLEGNTLGVNAAKAIADALSKHEHFKRALWKDMFTG 445
           +L   E A  ++  +  ++VL    LEGNTLG  AAKA+A AL      K        TG
Sbjct: 8   ELLKTERATELLPKLLCLQVL---RLEGNTLGEEAAKALASALRPQPSLKELCLSLNETG 64

Query: 446 RMKTEIPDALRYLGNGLQQAGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLN 505
           R    IP  L+ L  GL   G  L ELDLSDNA GP G   L  LLRSS   +L+ELKLN
Sbjct: 65  R----IPRGLQSLLQGLT-KGCGLQELDLSDNALGPDGCGVLESLLRSS---SLQELKLN 116

Query: 506 NNGLGITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTL 565
           NNGLG  G +LL+K L D          P AL+  + GRNRLE    + LA   +  + L
Sbjct: 117 NNGLGDRGLRLLAKGLKDL---------PPALEKLVLGRNRLEGASCEALAKALRANRDL 167

Query: 566 ERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILN 625
           + + +  NGI   GI AL++  + N NL  L+LN+N +T +GA  L + L+ L SL +LN
Sbjct: 168 KELNLANNGIGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLN 227

Query: 626 LGDCLLKSAGASSIAK-YLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSE 684
           LGD  L  AGA+++A   L+ N +L  ++L+CN+I+  G  DL + +  K  L ++++  
Sbjct: 228 LGDNNLTDAGAAALASALLSPNISLLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRG 287

Query: 685 NQFGEEGVEEMEKLMKSFG-MAAALVLEDDE 714
           N+FGEEG + + + +   G    +L ++DD 
Sbjct: 288 NKFGEEGAQLLAESLLEPGNELESLWVKDDS 318


LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1). Length = 319

>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|203777 pfam07834, RanGAP1_C, RanGAP1 C-terminal domain Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 999
KOG1909|consensus382 100.0
PF07834183 RanGAP1_C: RanGAP1 C-terminal domain; InterPro: IP 100.0
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 99.95
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.94
PF07834183 RanGAP1_C: RanGAP1 C-terminal domain; InterPro: IP 99.94
KOG1909|consensus382 99.92
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.9
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.69
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 99.68
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.67
KOG0444|consensus 1255 99.66
KOG4194|consensus 873 99.63
KOG4308|consensus478 99.62
KOG0444|consensus 1255 99.6
KOG4308|consensus478 99.57
KOG4194|consensus 873 99.56
KOG0618|consensus 1081 99.3
KOG4341|consensus483 99.22
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.11
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.1
KOG0472|consensus565 99.09
KOG0618|consensus 1081 99.07
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.07
KOG0472|consensus565 99.05
KOG3207|consensus505 99.02
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 98.98
KOG3207|consensus505 98.94
KOG2120|consensus419 98.88
PLN032101153 Resistant to P. syringae 6; Provisional 98.86
KOG4237|consensus498 98.85
KOG2120|consensus419 98.83
KOG4237|consensus498 98.81
KOG0617|consensus264 98.78
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.77
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.74
KOG0617|consensus264 98.68
PLN032101153 Resistant to P. syringae 6; Provisional 98.67
KOG4341|consensus483 98.67
KOG1859|consensus 1096 98.37
KOG1259|consensus490 98.29
KOG1259|consensus490 98.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.17
KOG0532|consensus 722 98.14
KOG1947|consensus482 98.04
KOG1947|consensus482 98.03
KOG0532|consensus 722 97.99
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.94
KOG3665|consensus 699 97.94
KOG1859|consensus 1096 97.91
KOG0531|consensus414 97.88
KOG2982|consensus418 97.84
KOG2982|consensus418 97.79
KOG0531|consensus414 97.78
KOG2739|consensus260 97.75
PLN03150623 hypothetical protein; Provisional 97.58
KOG4242|consensus553 97.53
PLN03150623 hypothetical protein; Provisional 97.49
KOG3665|consensus699 97.45
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.31
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.19
KOG2739|consensus260 97.13
KOG4242|consensus553 97.13
KOG1644|consensus233 96.53
KOG4579|consensus177 96.52
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.37
KOG4658|consensus889 96.34
KOG4579|consensus177 96.34
KOG2123|consensus388 96.33
KOG1644|consensus233 96.22
KOG2242|consensus 558 95.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.94
KOG4658|consensus889 95.92
KOG2123|consensus388 95.88
KOG3735|consensus353 95.22
KOG3735|consensus353 95.18
PRK15386426 type III secretion protein GogB; Provisional 95.06
PRK15386426 type III secretion protein GogB; Provisional 94.95
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 94.74
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 93.79
KOG3864|consensus221 92.72
PF04147 840 Nop14: Nop14-like family ; InterPro: IPR007276 Emg 92.39
PF09026101 CENP-B_dimeris: Centromere protein B dimerisation 91.92
KOG3864|consensus221 91.85
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.44
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.23
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 91.1
PF04931784 DNA_pol_phi: DNA polymerase phi; InterPro: IPR0070 90.21
KOG1832|consensus 1516 86.54
KOG1832|consensus1516 85.97
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 83.37
>KOG1909|consensus Back     alignment and domain information
Probab=100.00  E-value=6.9e-43  Score=378.20  Aligned_cols=319  Identities=44%  Similarity=0.690  Sum_probs=303.3

Q ss_pred             EEEeccCCCcCCChhhHHHHHHHHhcCCCcCEEEccCCCCChhHHHHHHHHHhhChhhHHHhhhhcccCCCccccchHHH
Q psy18075        377 KLSFAGQGLKLDNKEDAKVIVDAINEVKVLVSLNLEGNTLGVNAAKAIADALSKHEHFKRALWKDMFTGRMKTEIPDALR  456 (999)
Q Consensus       377 ~LsL~g~~L~~~s~~~~~~L~~aL~~~~~L~~LdLs~N~L~~~~~~~L~~~L~~~~~Lk~ll~~nl~t~rl~~~ip~~l~  456 (999)
                      ..++.|..+++.+.++.+.+...+....++++|+|+||.|+.++++.+++.|++.++|+...|+++++||+..++|.++.
T Consensus         3 ~~s~~gk~lkl~t~ed~~~v~~~~~~~~s~~~l~lsgnt~G~EAa~~i~~~L~~~~~L~~v~~sd~ftGR~~~Ei~e~L~   82 (382)
T KOG1909|consen    3 FFSIGGKSLKLETEEDEKDVEEELEPMDSLTKLDLSGNTFGTEAARAIAKVLASKKELREVNLSDMFTGRLKDEIPEALK   82 (382)
T ss_pred             eeccCCeeeeeehHhhhhhHHHHhcccCceEEEeccCCchhHHHHHHHHHHHhhcccceeeehHhhhcCCcHHHHHHHHH
Confidence            56788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhhhhccCCcccEEEecCCCCCCccHHHHHHHHhccCCCCccEEEccCCccCchhhhHHHHHHhhhccCCcCCCCCCC
Q psy18075        457 YLGNGLQQAGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGSPLA  536 (999)
Q Consensus       457 ~L~~~L~~~~~sL~~LdLS~N~L~~~gv~~L~~~L~s~~c~~L~~L~Ls~n~Lt~~g~~~La~~L~~~~~~s~~~g~~~s  536 (999)
                      .|+.+++.++ +|+.||||+|.|++.|++.|..+|++  |+.|++|.|+||+|++.++..|+++|..++ ..+.++.++.
T Consensus        83 ~l~~aL~~~~-~L~~ldLSDNA~G~~g~~~l~~ll~s--~~~L~eL~L~N~Glg~~ag~~l~~al~~l~-~~kk~~~~~~  158 (382)
T KOG1909|consen   83 MLSKALLGCP-KLQKLDLSDNAFGPKGIRGLEELLSS--CTDLEELYLNNCGLGPEAGGRLGRALFELA-VNKKAASKPK  158 (382)
T ss_pred             HHHHHHhcCC-ceeEeeccccccCccchHHHHHHHHh--ccCHHHHhhhcCCCChhHHHHHHHHHHHHH-HHhccCCCcc
Confidence            9999999755 99999999999999999999999987  789999999999999999999999999998 6778889999


Q ss_pred             ccEEEccCCCCCchhHHHHHHHHhhcccccccccCCCccCchhhhhhhHHhhhcccCceeeccCCCCCcCCccccccccc
Q psy18075        537 LKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALS  616 (999)
Q Consensus       537 Lk~L~Ls~N~L~d~g~~~L~~~L~~~~sLe~LdLs~N~It~~g~~~La~aL~~~~~Lr~LdLS~N~Lsd~G~~~L~~aL~  616 (999)
                      |+++..++|++.+.|+..++..|+.+++|+.+.+++|.|...|+..++.++..|++|++|||.+|.++..|...++.+++
T Consensus       159 Lrv~i~~rNrlen~ga~~~A~~~~~~~~leevr~~qN~I~~eG~~al~eal~~~~~LevLdl~DNtft~egs~~LakaL~  238 (382)
T KOG1909|consen  159 LRVFICGRNRLENGGATALAEAFQSHPTLEEVRLSQNGIRPEGVTALAEALEHCPHLEVLDLRDNTFTLEGSVALAKALS  238 (382)
T ss_pred             eEEEEeeccccccccHHHHHHHHHhccccceEEEecccccCchhHHHHHHHHhCCcceeeecccchhhhHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCcEEEcCCCCCCccchHHHHHhccCC-CCCCEEEccCCCCCCcchhhHHHhhccCCCcCEEEccCCCC--ChhcHH
Q psy18075        617 KLPSLAILNLGDCLLKSAGASSIAKYLTDN-TTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQF--GEEGVE  693 (999)
Q Consensus       617 ~l~sL~~LdLs~N~L~d~g~~~La~aL~~~-~~L~~LdLs~N~I~~~g~~~L~~~L~~~~sL~~LdLs~N~I--s~eg~~  693 (999)
                      .+++|++|++++|.+.+.|+.++..++... ++|+.|.|.+|.|+.+++..++.++...+.|..|+|++|++  .++++.
T Consensus       239 s~~~L~El~l~dcll~~~Ga~a~~~al~~~~p~L~vl~l~gNeIt~da~~~la~~~~ek~dL~kLnLngN~l~e~de~i~  318 (382)
T KOG1909|consen  239 SWPHLRELNLGDCLLENEGAIAFVDALKESAPSLEVLELAGNEITRDAALALAACMAEKPDLEKLNLNGNRLGEKDEGID  318 (382)
T ss_pred             ccchheeecccccccccccHHHHHHHHhccCCCCceeccCcchhHHHHHHHHHHHHhcchhhHHhcCCcccccccchhHH
Confidence            999999999999999999999999999876 99999999999999999999999999999999999999999  445555


Q ss_pred             HHHHHH
Q psy18075        694 EMEKLM  699 (999)
Q Consensus       694 ~L~~~L  699 (999)
                      .+...+
T Consensus       319 ei~~~~  324 (382)
T KOG1909|consen  319 EIASKF  324 (382)
T ss_pred             HHHHhc
Confidence            555444



>PF07834 RanGAP1_C: RanGAP1 C-terminal domain; InterPro: IPR009109 Ran GTPase is a ubiquitous protein required for nuclear transport, spindle assembly, nuclear assembly and mitotic cell cycle regulation Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF07834 RanGAP1_C: RanGAP1 C-terminal domain; InterPro: IPR009109 Ran GTPase is a ubiquitous protein required for nuclear transport, spindle assembly, nuclear assembly and mitotic cell cycle regulation Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4242|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG4242|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG2242|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG3735|consensus Back     alignment and domain information
>KOG3735|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>PF04147 Nop14: Nop14-like family ; InterPro: IPR007276 Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production [] Back     alignment and domain information
>PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>PF04931 DNA_pol_phi: DNA polymerase phi; InterPro: IPR007015 Proteins of this family are predominantly nucleolar Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query999
1k5d_C386 Crystal Structure Of Ran-Gppnhp-Ranbp1-Rangap Compl 5e-30
1yrg_A385 The Crystal Structure Of Rna1p: A New Fold For A Gt 5e-30
>pdb|1K5D|C Chain C, Crystal Structure Of Ran-Gppnhp-Ranbp1-Rangap Complex Length = 386 Back     alignment and structure

Iteration: 1

Score = 130 bits (326), Expect = 5e-30, Method: Compositional matrix adjust. Identities = 112/339 (33%), Positives = 171/339 (50%), Gaps = 20/339 (5%) Query: 377 KLSFAGQGLKLD--NKEDAKVIVDAINEVKVLVSLNLEGNTLGVNAAKAIADALSKHEHF 434 + S G+ LKLD ED K + + E + + L GNT+G AA+ +++ ++ + Sbjct: 3 RFSIEGKSLKLDAITTEDEKSVFAVLLEDDSVKEIVLSGNTIGTEAARWLSENIASKKDL 62 Query: 435 KRALWKDMFTGRMKTEIPDALRYLGNGLQQAGARLVELDLSDNAFGPIGVEGLADLLRSS 494 + A + D+FTGR+K EIP+ALR L L + +L + LSDNAFGP E L D L Sbjct: 63 EIAEFSDIFTGRVKDEIPEALRLLLQALLKC-PKLHTVRLSDNAFGPTAQEPLIDFLSKH 121 Query: 495 CCFAXXXXXXXXXXXXITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKM 554 G K +++AL + + K + +P L+ I GRNRLEN K Sbjct: 122 TPLEHLYLHNNGLGPQ-AGAK-IARALQELAVNKKAKNAP-PLRSIICGRNRLENGSMKE 178 Query: 555 LAAVFKKLKTLERVEMPQNGIYHVGITA-LSDAFEENKNLRHLNLNDNTITYKGAIPLGQ 613 A F+ + L V+M QNGI GI L + + L+ L+L DNT T+ G+ L Sbjct: 179 WAKTFQSHRLLHTVKMVQNGIRPEGIEHLLLEGLAYCQELKVLDLQDNTFTHLGSSALAI 238 Query: 614 ALSKLPSLAILNLGDCLLKSAGASSIAKYLT--DNTTLEDVNLTCNEISVQGGLDLVKAM 671 AL P+L L L DCLL + GA+++ + +N L+ + L NEI LD V+ + Sbjct: 239 ALKSWPNLRELGLNDCLLSARGAAAVVDAFSKLENIGLQTLRLQYNEIE----LDAVRTL 294 Query: 672 KNKTKLKQ-----INVSENQFGEEG--VEEMEKLMKSFG 703 K K + ++ N+F EE V+E+ ++ + G Sbjct: 295 KTVIDEKMPDLLFLELNGNRFSEEDDVVDEIREVFSTRG 333
>pdb|1YRG|A Chain A, The Crystal Structure Of Rna1p: A New Fold For A Gtpase- Activating Protein Length = 385 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query999
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-43
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-23
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-42
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-38
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-38
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-36
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-31
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-31
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-30
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-30
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-18
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-15
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-12
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 1e-21
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 5e-21
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 3e-19
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 9e-11
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 3e-08
2grr_B170 RAN GTPase-activating protein 1; ubiquitin, conjug 2e-19
2grr_B170 RAN GTPase-activating protein 1; ubiquitin, conjug 2e-11
2grr_B170 RAN GTPase-activating protein 1; ubiquitin, conjug 2e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 1e-17
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 6e-15
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 8e-15
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 2e-08
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 9e-06
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-14
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-05
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-04
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
 Score =  284 bits (729), Expect = 3e-87
 Identities = 128/366 (34%), Positives = 191/366 (52%), Gaps = 12/366 (3%)

Query: 376 TKLSFAGQGLKLDN--KEDAKVIVDAINEVKVLVSLNLEGNTLGVNAAKAIADALSKHEH 433
            + S  G+ LKLD    ED K +   + E   +  + L GNT+G  AA+ +++ ++  + 
Sbjct: 2   ARFSIEGKSLKLDAITTEDEKSVFAVLLEDDSVKEIVLSGNTIGTEAARWLSENIASKKD 61

Query: 434 FKRALWKDMFTGRMKTEIPDALRYLGNGLQQAGARLVELDLSDNAFGPIGVEGLADLLRS 493
            + A + D+FTGR+K EIP+ALR L   L +   +L  + LSDNAFGP   E L D L  
Sbjct: 62  LEIAEFSDIFTGRVKDEIPEALRLLLQALLKC-PKLHTVRLSDNAFGPTAQEPLIDFLSK 120

Query: 494 SCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAK 553
                LE L L+NNGLG      +++AL +   + K + +P  L+  I GRNRLEN   K
Sbjct: 121 HTP--LEHLYLHNNGLGPQAGAKIARALQELAVNKKAKNAP-PLRSIICGRNRLENGSMK 177

Query: 554 MLAAVFKKLKTLERVEMPQNGIYHVGIT-ALSDAFEENKNLRHLNLNDNTITYKGAIPLG 612
             A  F+  + L  V+M QNGI   GI   L +     + L+ L+L DNT T+ G+  L 
Sbjct: 178 EWAKTFQSHRLLHTVKMVQNGIRPEGIEHLLLEGLAYCQELKVLDLQDNTFTHLGSSALA 237

Query: 613 QALSKLPSLAILNLGDCLLKSAGASSIAKYLTD--NTTLEDVNLTCNEISVQGGLDLVKA 670
            AL   P+L  L L DCLL + GA+++    +   N  L+ + L  NEI +     L   
Sbjct: 238 IALKSWPNLRELGLNDCLLSARGAAAVVDAFSKLENIGLQTLRLQYNEIELDAVRTLKTV 297

Query: 671 MKNK-TKLKQINVSENQFGEEG--VEEMEKLMKSFGMAAALVLEDDEGECSDEEQDEESE 727
           +  K   L  + ++ N+F EE   V+E+ ++  + G      L+D E    +EE+DEE E
Sbjct: 298 IDEKMPDLLFLELNGNRFSEEDDVVDEIREVFSTRGRGELDELDDMEELTDEEEEDEEEE 357

Query: 728 EENDSD 733
            E+ S 
Sbjct: 358 AESQSP 363


>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2grr_B RAN GTPase-activating protein 1; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} SCOP: a.118.12.1 PDB: 2grn_B 2grp_B 2grq_B 2gro_B 1z5s_C 3uip_C* 3uio_C 3uin_C* 2io2_C 2io3_C 2iy0_C 1kps_B Length = 170 Back     alignment and structure
>2grr_B RAN GTPase-activating protein 1; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} SCOP: a.118.12.1 PDB: 2grn_B 2grp_B 2grq_B 2gro_B 1z5s_C 3uip_C* 3uio_C 3uin_C* 2io2_C 2io3_C 2iy0_C 1kps_B Length = 170 Back     alignment and structure
>2grr_B RAN GTPase-activating protein 1; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} SCOP: a.118.12.1 PDB: 2grn_B 2grp_B 2grq_B 2gro_B 1z5s_C 3uip_C* 3uio_C 3uin_C* 2io2_C 2io3_C 2iy0_C 1kps_B Length = 170 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query999
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 100.0
2grr_B170 RAN GTPase-activating protein 1; ubiquitin, conjug 100.0
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.95
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.95
2grr_B170 RAN GTPase-activating protein 1; ubiquitin, conjug 99.88
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.86
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.86
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.77
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.77
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.74
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.72
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.72
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.71
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.71
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.71
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.71
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.7
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.69
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.69
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.69
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.69
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.69
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.69
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.69
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.69
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.68
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.68
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.68
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.68
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.67
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.67
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.66
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.66
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.66
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.66
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.66
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.66
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.65
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.65
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.65
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.65
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.64
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.64
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.63
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.63
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.63
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.63
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.63
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.63
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.63
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.63
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.63
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.63
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.63
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 99.63
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.62
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.62
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.62
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.61
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.61
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.61
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.61
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.61
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.61
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.61
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 99.6
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.6
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.6
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.6
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.6
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.58
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.58
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.56
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.55
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.55
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.55
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.55
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.54
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.53
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.52
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.5
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.49
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.48
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.48
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.47
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.47
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.45
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.43
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.42
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.41
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.41
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.39
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.38
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.36
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.36
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.35
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.34
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.33
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.31
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.31
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.31
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.31
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.31
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.28
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.26
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.22
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.17
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.15
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.1
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.08
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.99
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 98.93
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.92
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.92
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.9
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.88
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.83
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 98.81
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.78
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.75
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.73
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.73
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.66
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.63
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.59
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.55
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.52
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.51
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.41
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.29
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.0
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.98
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.98
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.88
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.83
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.58
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.44
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.37
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 93.07
4gt6_A394 Cell surface protein; leucine rich repeats, putati 91.89
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 84.24
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
Probab=100.00  E-value=3.7e-38  Score=358.89  Aligned_cols=322  Identities=36%  Similarity=0.536  Sum_probs=283.1

Q ss_pred             EEeccCCCcCC--ChhhHHHHHHHHhcCCCcCEEEccCCCCChhHHHHHHHHHhhChhhHHHhhhhcccCCCccccchHH
Q psy18075        378 LSFAGQGLKLD--NKEDAKVIVDAINEVKVLVSLNLEGNTLGVNAAKAIADALSKHEHFKRALWKDMFTGRMKTEIPDAL  455 (999)
Q Consensus       378 LsL~g~~L~~~--s~~~~~~L~~aL~~~~~L~~LdLs~N~L~~~~~~~L~~~L~~~~~Lk~ll~~nl~t~rl~~~ip~~l  455 (999)
                      +++.+..++++  ++.++..++.++..+++|++|+|++|.|+..++..|+.++..+++|+.+...+...+++...+|.++
T Consensus         4 ~s~~~~~L~~~~l~~~~~~~l~~~l~~~~~L~~L~L~~n~i~~~~~~~l~~~l~~~~~L~~L~Ls~~~~~~l~~~~~~~~   83 (386)
T 2ca6_A            4 FSIEGKSLKLDAITTEDEKSVFAVLLEDDSVKEIVLSGNTIGTEAARWLSENIASKKDLEIAEFSDIFTGRVKDEIPEAL   83 (386)
T ss_dssp             EECTTCCCEESSCCSHHHHTTSHHHHHCSCCCEEECTTSEECHHHHHHHHHTTTTCTTCCEEECCSCCTTSCGGGSHHHH
T ss_pred             EEecCcccccCCCCHHHHHHHHHHHhcCCCccEEECCCCCCCHHHHHHHHHHHHhCCCccEEeCcccccCccccchhHHH
Confidence            45566666555  8899999999999999999999999999999999999999999999877777777788888899999


Q ss_pred             HHhhhhhhccCCcccEEEecCCCCCCccHHHHHHHHhccCCCCccEEEccCCccCchhhhHHHHHHhhhccCCcCCCCCC
Q psy18075        456 RYLGNGLQQAGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGSPL  535 (999)
Q Consensus       456 ~~L~~~L~~~~~sL~~LdLS~N~L~~~gv~~L~~~L~s~~c~~L~~L~Ls~n~Lt~~g~~~La~~L~~~~~~s~~~g~~~  535 (999)
                      ..++.++. .+++|++|+|++|.|++.++..+...+..  |++|++|+|++|+|+..+...++..+..+.... ..+..+
T Consensus        84 ~~l~~~l~-~~~~L~~L~Ls~n~l~~~~~~~l~~~l~~--~~~L~~L~L~~n~l~~~~~~~l~~~l~~l~~~~-~~~~~~  159 (386)
T 2ca6_A           84 RLLLQALL-KCPKLHTVRLSDNAFGPTAQEPLIDFLSK--HTPLEHLYLHNNGLGPQAGAKIARALQELAVNK-KAKNAP  159 (386)
T ss_dssp             HHHHHHHT-TCTTCCEEECCSCCCCTTTHHHHHHHHHH--CTTCCEEECCSSCCHHHHHHHHHHHHHHHHHHH-HHHTCC
T ss_pred             HHHHHHHh-hCCcccEEECCCCcCCHHHHHHHHHHHHh--CCCCCEEECcCCCCCHHHHHHHHHHHHHHhhhh-hcccCC
Confidence            98887665 57899999999999999999989888854  579999999999999888889998887651000 000113


Q ss_pred             CccEEEccCCCCCchhHHHHHHHHhhcccccccccCCCccCchhhhhhhH-HhhhcccCceeeccCCCCCcCCccccccc
Q psy18075        536 ALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSD-AFEENKNLRHLNLNDNTITYKGAIPLGQA  614 (999)
Q Consensus       536 sLk~L~Ls~N~L~d~g~~~L~~~L~~~~sLe~LdLs~N~It~~g~~~La~-aL~~~~~Lr~LdLS~N~Lsd~G~~~L~~a  614 (999)
                      +|++|+|++|++++.++..++..+..+++|++|+|++|+|++.|+..+.. .+..+++|+.|+|++|.+++.|+..++..
T Consensus       160 ~L~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n~l~~~g~~~l~~~~l~~~~~L~~L~Ls~n~l~~~g~~~l~~~  239 (386)
T 2ca6_A          160 PLRSIICGRNRLENGSMKEWAKTFQSHRLLHTVKMVQNGIRPEGIEHLLLEGLAYCQELKVLDLQDNTFTHLGSSALAIA  239 (386)
T ss_dssp             CCCEEECCSSCCTGGGHHHHHHHHHHCTTCCEEECCSSCCCHHHHHHHHHTTGGGCTTCCEEECCSSCCHHHHHHHHHHH
T ss_pred             CCcEEECCCCCCCcHHHHHHHHHHHhCCCcCEEECcCCCCCHhHHHHHHHHHhhcCCCccEEECcCCCCCcHHHHHHHHH
Confidence            59999999999999999999999999999999999999999999988888 99999999999999999999888899999


Q ss_pred             ccCCCCCcEEEcCCCCCCccchHHHHHhccC--CCCCCEEEccCCCCCCcchhhHHHhh-ccCCCcCEEEccCCCCChhc
Q psy18075        615 LSKLPSLAILNLGDCLLKSAGASSIAKYLTD--NTTLEDVNLTCNEISVQGGLDLVKAM-KNKTKLKQINVSENQFGEEG  691 (999)
Q Consensus       615 L~~l~sL~~LdLs~N~L~d~g~~~La~aL~~--~~~L~~LdLs~N~I~~~g~~~L~~~L-~~~~sL~~LdLs~N~Is~eg  691 (999)
                      +..+++|+.|+|++|.+++.|+..++.++..  +++|++|+|++|.|+..|+..++..+ .++++|++|+|++|+|+..+
T Consensus       240 l~~~~~L~~L~L~~n~i~~~~~~~l~~~l~~~~~~~L~~L~L~~n~i~~~g~~~l~~~l~~~l~~L~~L~l~~N~l~~~~  319 (386)
T 2ca6_A          240 LKSWPNLRELGLNDCLLSARGAAAVVDAFSKLENIGLQTLRLQYNEIELDAVRTLKTVIDEKMPDLLFLELNGNRFSEED  319 (386)
T ss_dssp             GGGCTTCCEEECTTCCCCHHHHHHHHHHHHTCSSCCCCEEECCSSCCBHHHHHHHHHHHHHHCTTCCEEECTTSBSCTTS
T ss_pred             HccCCCcCEEECCCCCCchhhHHHHHHHHhhccCCCeEEEECcCCcCCHHHHHHHHHHHHhcCCCceEEEccCCcCCcch
Confidence            9999999999999999999999999999965  89999999999999999999999988 55899999999999999988


Q ss_pred             --HHHHHHHHhcCC
Q psy18075        692 --VEEMEKLMKSFG  703 (999)
Q Consensus       692 --~~~L~~~L~~l~  703 (999)
                        +..+...+..++
T Consensus       320 ~~~~~l~~~l~~~~  333 (386)
T 2ca6_A          320 DVVDEIREVFSTRG  333 (386)
T ss_dssp             HHHHHHHHHHHHHT
T ss_pred             hHHHHHHHHhhhcC
Confidence              577887777766



>2grr_B RAN GTPase-activating protein 1; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} SCOP: a.118.12.1 PDB: 2grn_B 2grp_B 2grq_B 2gro_B 1z5s_C 3uip_C* 3uio_C 3uin_C* 2io2_C 2io3_C 2iy0_C 1kps_B Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2grr_B RAN GTPase-activating protein 1; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} SCOP: a.118.12.1 PDB: 2grn_B 2grp_B 2grq_B 2gro_B 1z5s_C 3uip_C* 3uio_C 3uin_C* 2io2_C 2io3_C 2iy0_C 1kps_B Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 999
d2grrb1157 a.118.12.1 (B:431-587) Ran-GTPase activating prote 6e-20
d2grrb1157 a.118.12.1 (B:431-587) Ran-GTPase activating prote 4e-13
d2grrb1157 a.118.12.1 (B:431-587) Ran-GTPase activating prote 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-19
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 7e-10
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 0.001
d1io0a_166 c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic 6e-05
>d2grrb1 a.118.12.1 (B:431-587) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 157 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain
family: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain
domain: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 85.3 bits (211), Expect = 6e-20
 Identities = 40/140 (28%), Positives = 64/140 (45%), Gaps = 10/140 (7%)

Query: 781 VTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLVPSTTTLQSP 840
           V+ FLA PS      LGP  + L   + ++   ++ +     A +KVSS+     T++  
Sbjct: 4   VSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVS----AFLKVSSVFKDEATVRMA 59

Query: 841 SSSLFECTKVLYRELFNWASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVR 900
                +    L ++ FN +S     +T    LLVH+GL+K EDK  K   NL G + A+ 
Sbjct: 60  V---QDAVDALMQKAFNSSSF--NSNTFLTRLLVHMGLLKSEDK-VKAIANLYGPLMALN 113

Query: 901 LLSEAKLLPSLTESQLLACM 920
            + +    P      LLA +
Sbjct: 114 HMVQQDYFPKALAPLLLAFV 133


>d2grrb1 a.118.12.1 (B:431-587) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d2grrb1 a.118.12.1 (B:431-587) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query999
d2grrb1157 Ran-GTPase activating protein 1 (RanGAP1), C-termi 100.0
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.97
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.94
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.93
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.92
d2grrb1157 Ran-GTPase activating protein 1 (RanGAP1), C-termi 99.9
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.63
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.53
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.49
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.46
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.42
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.42
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.41
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.39
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.38
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.37
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.36
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.33
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.32
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.29
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.26
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.23
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.23
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.23
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.23
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.22
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.21
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.98
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.97
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.92
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.91
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.81
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.66
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.55
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.49
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.09
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.08
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.03
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.03
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.8
>d2grrb1 a.118.12.1 (B:431-587) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain
family: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain
domain: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=8.9e-37  Score=294.22  Aligned_cols=139  Identities=29%  Similarity=0.399  Sum_probs=129.8

Q ss_pred             cccccccccCCcHHHHhccCcchHHHHHHHhhcCccchhHHHHHHHHHHhhccccCCCCcCCCCchhHHHHHHHHHHHhh
Q psy18075        778 QHSVTDFLAAPSVSLFNSLGPNCAQLFLDEINSEPEDRYLESMLLAIMKVSSLVPSTTTLQSPSSSLFECTKVLYRELFN  857 (999)
Q Consensus       778 ~~~~~~f~~~Ps~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~l~~~~f~  857 (999)
                      |+++++|+++||+++|++||++| +.+|.|+++   +.|.++++.+||||||+|+++++++.   ||++++|+|||++|+
T Consensus         1 p~d~~~FL~~PS~ekl~~lg~kr-s~li~qq~d---~~d~e~~~~af~kIssv~~dd~~vk~---aald~~daL~k~aF~   73 (157)
T d2grrb1           1 PADVSTFLAFPSPEKLLRLGPKS-SVLIAQQTD---TSDPEKVVSAFLKVSSVFKDEATVRM---AVQDAVDALMQKAFN   73 (157)
T ss_dssp             CCCHHHHHHSCCHHHHHHTCTTH-HHHHHHTSC---TTCHHHHHHHHHHHHTTCCSSHHHHH---HHHHHHHHHHHHHHT
T ss_pred             CcCHHHHhcCCCHHHHHHhCchH-HHHHHHhhc---cccHHHHHHHHHHHHHHhcccHHHHH---HHHHHHHHHHHHHHh
Confidence            57899999999999999999999 888889876   88999999999999999999988775   999999999999997


Q ss_pred             hhhccCcchhhhHHHHHHhccccccccccccccCcccHHHHHHHHHhcCCCCCcCHHHHHHHhhcCCcc
Q psy18075        858 WASNSDKLSTVTNALLVHLGLIKCEDKSFKINYNLNGCMTAVRLLSEAKLLPSLTESQLLACMKLMDEK  926 (999)
Q Consensus       858 ~~~~~~~~~~~~~~llv~lgllk~e~k~~k~~~~~~g~~~~l~~~~~~~~fp~~~~~~l~~fl~~~~~~  926 (999)
                      ++.  .+.+.+.|+||||||||||||| ||++||++||++||+||++|+|||++++++|++|++|+.-.
T Consensus        74 ~~~--~q~~~~~n~LLV~lGLLKSEdK-~k~~~~l~g~~~aL~~av~q~yFp~~~~~~l~aF~~kp~~~  139 (157)
T d2grrb1          74 SSS--FNSNTFLTRLLVHMGLLKSEDK-VKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSA  139 (157)
T ss_dssp             STT--CCHHHHHHHHHHHTTSSCCSSC-CCCCSCCHHHHHHHHHHTTSTTSCGGGHHHHHHHHHSCCHH
T ss_pred             ccc--ccHHHHHHHHHHHHhchhhhhh-ccCCCCchHHHHHHHHHHhcccccHHHHHHHHHHHhCcccc
Confidence            774  6678899999999999999996 99999999999999999999999999999999999999433



>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2grrb1 a.118.12.1 (B:431-587) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure