Psyllid ID: psy18106


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70------
MSSFGNFSSDKVKKKYGSLGPDLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSASKTGSVLVGDELLEI
cccccccHHHHHHHHHccccccEEEEEEEEcccccEEEEEcccccccccEEEEEEccccccccccccccccEEEEc
ccccccccHHHHHHHHccccccEEEEEEEccccccEEEEEccccccccEEEEEEEcccccccccccEEEccEEEcc
mssfgnfssdkvkkkygslgpdLVVVTLERShtglgislaghkdrtKMAVFVCglnpsgsasktgsvlvgdellei
mssfgnfssdkvkkkygslgPDLVVVTLERSHTGLgislaghkdrTKMAVFVCGLnpsgsasktgsvlvgdellei
MSSFGNFSSDKVKKKYGSLGPDLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSASKTGSVLVGDELLEI
****************GSLGPDLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLN********************
**SFGNFSSDKVKKKYGSLGPDLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSASKTGSVLVGDELLEI
**********KVKKKYGSLGPDLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSASKTGSVLVGDELLEI
***FGNFSSDKVKKKYGSLGPDLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSASKTGSVLVGDELLEI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSFGNFSSDKVKKKYGSLGPDLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSASKTGSVLVGDELLEI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query76 2.2.26 [Sep-21-2011]
O75970 2070 Multiple PDZ domain prote yes N/A 0.947 0.034 0.479 3e-15
O55164 2054 Multiple PDZ domain prote yes N/A 0.947 0.035 0.479 3e-15
Q8NI35 1801 InaD-like protein OS=Homo no N/A 0.868 0.036 0.471 2e-14
Q8VBX6 2055 Multiple PDZ domain prote yes N/A 0.881 0.032 0.485 5e-14
Q63ZW7 1834 InaD-like protein OS=Mus no N/A 0.921 0.038 0.457 1e-13
Q24008 674 Inactivation-no-after-pot yes N/A 0.894 0.100 0.421 2e-06
>sp|O75970|MPDZ_HUMAN Multiple PDZ domain protein OS=Homo sapiens GN=MPDZ PE=1 SV=2 Back     alignment and function desciption
 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 58/73 (79%), Gaps = 1/73 (1%)

Query: 4    FGNFSSDKVKKKYGSLGPDLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSASK 63
            FG +S   ++++YG+L  +L ++ LE+ H+GLG+SLAG+KDR++M+VF+ G++P+G+A K
Sbjct: 1330 FG-YSWKNIRERYGTLTGELHMIELEKGHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGK 1388

Query: 64   TGSVLVGDELLEI 76
             G + + DELLEI
Sbjct: 1389 DGRLQIADELLEI 1401




Interacts with HTR2C and provokes its clustering at the cell surface (By similarity). Member of the NMDAR signaling complex that may play a role in control of AMPAR potentiation and synaptic plasticity in excitatory synapses.
Homo sapiens (taxid: 9606)
>sp|O55164|MPDZ_RAT Multiple PDZ domain protein OS=Rattus norvegicus GN=Mpdz PE=1 SV=1 Back     alignment and function description
>sp|Q8NI35|INADL_HUMAN InaD-like protein OS=Homo sapiens GN=INADL PE=1 SV=3 Back     alignment and function description
>sp|Q8VBX6|MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus GN=Mpdz PE=1 SV=2 Back     alignment and function description
>sp|Q63ZW7|INADL_MOUSE InaD-like protein OS=Mus musculus GN=Inadl PE=1 SV=2 Back     alignment and function description
>sp|Q24008|INAD_DROME Inactivation-no-after-potential D protein OS=Drosophila melanogaster GN=inaD PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query76
242021699 560 Inactivation-no-after-potential D protei 0.960 0.130 0.657 6e-21
189239282 723 PREDICTED: similar to AGAP002145-PA [Tri 0.947 0.099 0.643 1e-19
270010410 482 hypothetical protein TcasGA2_TC009802 [T 0.868 0.136 0.681 1e-18
350409834 1692 PREDICTED: hypothetical protein LOC10074 0.947 0.042 0.616 2e-18
380028134 740 PREDICTED: multiple PDZ domain protein-l 0.960 0.098 0.594 3e-18
340718529 2578 PREDICTED: hypothetical protein LOC10064 0.934 0.027 0.625 7e-18
345492877 1279 PREDICTED: hypothetical protein LOC10011 0.960 0.057 0.608 2e-17
328781287 1701 PREDICTED: hypothetical protein LOC40902 0.921 0.041 0.6 3e-17
35761987382 putative Inactivation-no-after- D protei 0.947 0.878 0.602 5e-17
307168151 1622 Inactivation-no-after-potential D protei 0.921 0.043 0.557 5e-17
>gi|242021699|ref|XP_002431281.1| Inactivation-no-after-potential D protein, putative [Pediculus humanus corporis] gi|212516538|gb|EEB18543.1| Inactivation-no-after-potential D protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 48/73 (65%), Positives = 60/73 (82%)

Query: 4  FGNFSSDKVKKKYGSLGPDLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSASK 63
          F   +S KVKKKYG+LG  ++V+ LE+SH GLGISLAGHKDR +MAVFVCG+NP+G A K
Sbjct: 24 FKKNTSRKVKKKYGNLGDTILVINLEKSHRGLGISLAGHKDRNRMAVFVCGINPNGPAFK 83

Query: 64 TGSVLVGDELLEI 76
          TG + VGDE+LE+
Sbjct: 84 TGGIKVGDEILEV 96




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189239282|ref|XP_001810643.1| PREDICTED: similar to AGAP002145-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270010410|gb|EFA06858.1| hypothetical protein TcasGA2_TC009802 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350409834|ref|XP_003488859.1| PREDICTED: hypothetical protein LOC100743377 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380028134|ref|XP_003697764.1| PREDICTED: multiple PDZ domain protein-like [Apis florea] Back     alignment and taxonomy information
>gi|340718529|ref|XP_003397718.1| PREDICTED: hypothetical protein LOC100647267 [Bombus terrestris] Back     alignment and taxonomy information
>gi|345492877|ref|XP_003426946.1| PREDICTED: hypothetical protein LOC100114281 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328781287|ref|XP_392550.4| PREDICTED: hypothetical protein LOC409020 [Apis mellifera] Back     alignment and taxonomy information
>gi|357619873|gb|EHJ72279.1| putative Inactivation-no-after- D protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|307168151|gb|EFN61430.1| Inactivation-no-after-potential D protein [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query76
UNIPROTKB|F1N9G0 1999 F1N9G0 "Uncharacterized protei 0.973 0.037 0.506 4e-14
UNIPROTKB|O75970 2070 MPDZ "Multiple PDZ domain prot 0.947 0.034 0.479 8.7e-14
RGD|3105 2054 Mpdz "multiple PDZ domain prot 0.947 0.035 0.479 1.4e-13
UNIPROTKB|D4A2W4 2068 Mpdz "Multiple PDZ domain prot 0.947 0.034 0.479 1.4e-13
MGI|MGI:1343489 2055 Mpdz "multiple PDZ domain prot 0.947 0.035 0.493 2.3e-13
UNIPROTKB|E1BLF1 1794 Bt.110063 "Uncharacterized pro 0.921 0.039 0.471 3.2e-13
UNIPROTKB|Q8NI35 1801 INADL "InaD-like protein" [Hom 0.921 0.038 0.471 3.2e-13
UNIPROTKB|F1SMP5 1588 MPDZ "Uncharacterized protein" 0.947 0.045 0.465 4.5e-13
UNIPROTKB|F1MMT3 2056 F1MMT3 "Uncharacterized protei 0.947 0.035 0.465 4.8e-13
UNIPROTKB|F1MAD2 1833 Inadl2 "Protein Inadl2" [Rattu 0.868 0.036 0.5 1.4e-12
UNIPROTKB|F1N9G0 F1N9G0 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 198 (74.8 bits), Expect = 4.0e-14, P = 4.0e-14
 Identities = 38/75 (50%), Positives = 58/75 (77%)

Query:     2 SSFGNFSSDKVKKKYGSLGPDLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSA 61
             + FG +S  K+ ++YGSL  +L ++ LE+  TGLG+SLAG+KDR++M+VFV G++P+G+A
Sbjct:  1333 NEFG-YSWKKITQRYGSLPGELHMIELEKGRTGLGLSLAGNKDRSRMSVFVVGIDPNGAA 1391

Query:    62 SKTGSVLVGDELLEI 76
              K G + + DELLEI
Sbjct:  1392 GKDGRLQIADELLEI 1406




GO:0005923 "tight junction" evidence=IEA
GO:0007155 "cell adhesion" evidence=IEA
GO:0008022 "protein C-terminus binding" evidence=IEA
GO:0016324 "apical plasma membrane" evidence=IEA
GO:0016327 "apicolateral plasma membrane" evidence=IEA
GO:0031410 "cytoplasmic vesicle" evidence=IEA
GO:0043220 "Schmidt-Lanterman incisure" evidence=IEA
UNIPROTKB|O75970 MPDZ "Multiple PDZ domain protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|3105 Mpdz "multiple PDZ domain protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A2W4 Mpdz "Multiple PDZ domain protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1343489 Mpdz "multiple PDZ domain protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BLF1 Bt.110063 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NI35 INADL "InaD-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMP5 MPDZ "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMT3 F1MMT3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAD2 Inadl2 "Protein Inadl2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 1e-06
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 2e-06
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
 Score = 41.2 bits (97), Expect = 1e-06
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 23 LVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSASKTGSVLVGDELLEI 76
            +V LE+   GLG SL G KD     V V  + P   A+K G + VGD +LE+
Sbjct: 2  PRLVELEKGGGGLGFSLVGGKD-EGGGVVVSSVVPGSPAAKAG-LRVGDVILEV 53


Also called DHR (Dlg homologous region) or GLGF (relatively well conserved tetrapeptide in these domains). Some PDZs have been shown to bind C-terminal polypeptides; others appear to bind internal (non-C-terminal) polypeptides. Different PDZs possess different binding specificities. Length = 85

>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 76
KOG3550|consensus207 99.39
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.28
KOG3209|consensus984 99.25
KOG1892|consensus 1629 99.12
KOG3209|consensus 984 98.96
KOG3571|consensus 626 98.83
KOG3580|consensus 1027 98.73
KOG3651|consensus 429 98.69
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.66
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.65
KOG3551|consensus 506 98.65
KOG3553|consensus124 98.61
KOG3549|consensus 505 98.59
KOG3580|consensus 1027 98.46
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.29
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.05
KOG3606|consensus 358 98.01
KOG0609|consensus 542 97.67
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 97.66
KOG3542|consensus 1283 97.57
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 97.45
KOG3552|consensus 1298 97.31
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 97.23
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.17
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 97.15
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 96.86
PLN00049 389 carboxyl-terminal processing protease; Provisional 96.84
PRK11186 667 carboxy-terminal protease; Provisional 96.83
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 96.71
KOG3605|consensus 829 96.62
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 96.57
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 96.46
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 96.04
KOG3605|consensus829 95.74
KOG3129|consensus231 95.69
PRK10139455 serine endoprotease; Provisional 95.62
PRK10139 455 serine endoprotease; Provisional 95.3
PRK10779 449 zinc metallopeptidase RseP; Provisional 95.26
PRK10898353 serine endoprotease; Provisional 95.2
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 95.16
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 95.02
PRK10942 473 serine endoprotease; Provisional 95.01
KOG3938|consensus 334 94.87
PRK10779 449 zinc metallopeptidase RseP; Provisional 94.64
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 94.54
PRK10942473 serine endoprotease; Provisional 94.4
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 93.89
TIGR01713259 typeII_sec_gspC general secretion pathway protein 93.42
COG3975558 Predicted protease with the C-terminal PDZ domain 93.35
KOG1738|consensus 638 89.81
COG0265347 DegQ Trypsin-like serine proteases, typically peri 89.35
KOG4371|consensus1332 87.74
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 81.97
>KOG3550|consensus Back     alignment and domain information
Probab=99.39  E-value=4.4e-13  Score=90.33  Aligned_cols=54  Identities=30%  Similarity=0.628  Sum_probs=50.4

Q ss_pred             cEEEEEEecCCCcccEEEecCCCCCCCcEEEEEeCCCChhcccCCCCCCCEEEEC
Q psy18106         22 DLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSASKTGSVLVGDELLEI   76 (76)
Q Consensus        22 e~~~v~L~k~~~gLG~si~Gg~~~~~~~I~V~~V~~gg~A~~dG~L~~GD~ileV   76 (76)
                      ..+.|+|.|...||||.++||++. +.+|||++|+|||.|++-|.|+.||++|.|
T Consensus        90 hprvvelpktdeglgfnvmggkeq-nspiyisriipggvadrhgglkrgdqllsv  143 (207)
T KOG3550|consen   90 HPRVVELPKTDEGLGFNVMGGKEQ-NSPIYISRIIPGGVADRHGGLKRGDQLLSV  143 (207)
T ss_pred             CCceeecCccccccceeeccCccc-CCceEEEeecCCccccccCcccccceeEee
Confidence            357899999999999999999996 789999999999999999999999999976



>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
2daz_A124 Solution Structure Of The 7th Pdz Domain Of Inad-Li 2e-16
2r4h_B112 Crystal Structure Of A C1190s Mutant Of The 6th Pdz 3e-05
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 4e-04
3gsl_A 196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 6e-04
2ka9_A 189 Solution Structure Of Psd-95 Pdz12 Complexed With C 6e-04
1rgr_A99 Cyclic Peptides Targeting Pdz Domains Of Psd-95: St 6e-04
1kef_A93 Pdz1 Of Sap90 Length = 93 6e-04
1iu0_A91 The First Pdz Domain Of Psd-95 Length = 91 6e-04
3zrt_A 199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 7e-04
>pdb|2DAZ|A Chain A, Solution Structure Of The 7th Pdz Domain Of Inad-Like Protein Length = 124 Back     alignment and structure

Iteration: 1

Score = 80.9 bits (198), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 33/70 (47%), Positives = 52/70 (74%) Query: 7 FSSDKVKKKYGSLGPDLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSASKTGS 66 F+ K++++Y L +L ++ LE+ GLG+SLAG+KDR++M++FV G+NP G A+ G Sbjct: 10 FTDQKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRSRMSIFVVGINPEGPAAADGR 69 Query: 67 VLVGDELLEI 76 + +GDELLEI Sbjct: 70 MRIGDELLEI 79
>pdb|2R4H|B Chain B, Crystal Structure Of A C1190s Mutant Of The 6th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 112 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|1RGR|A Chain A, Cyclic Peptides Targeting Pdz Domains Of Psd-95: Structural Basis For Enhanced Affinity And Enzymatic Stability Length = 99 Back     alignment and structure
>pdb|1KEF|A Chain A, Pdz1 Of Sap90 Length = 93 Back     alignment and structure
>pdb|1IU0|A Chain A, The First Pdz Domain Of Psd-95 Length = 91 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 2e-19
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 5e-12
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-11
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 1e-09
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 3e-11
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 4e-11
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 6e-11
2opg_A98 Multiple PDZ domain protein; structural protein, s 8e-11
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 3e-10
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 4e-10
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 7e-10
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 7e-10
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 1e-09
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 1e-09
2fne_A117 Multiple PDZ domain protein; structural protein, s 1e-09
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 2e-09
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 2e-09
3gsl_A 196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-09
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 3e-06
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-09
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 2e-09
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 2e-09
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 2e-09
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 3e-09
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 3e-09
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 3e-09
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 3e-09
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 3e-09
3r0h_A 206 INAD, inactivation-NO-after-potential D protein; p 4e-09
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-05
2qt5_A 200 Glutamate receptor-interacting protein 1; PDZ-pept 4e-09
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-07
2awx_A105 Synapse associated protein 97; membrane protein, s 4e-09
2djt_A104 Unnamed protein product; PDZ domain, structural ge 5e-09
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 5e-09
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 6e-09
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 6e-09
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 8e-09
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 8e-09
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 1e-08
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 1e-08
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 1e-08
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 1e-08
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 1e-08
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 2e-08
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 2e-08
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 2e-08
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 2e-08
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 3e-08
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 3e-08
1p1d_A 196 PDZ45, glutamate receptor interacting protein; PDZ 3e-08
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 1e-06
2byg_A117 Channel associated protein of synapse-110; DLG2, P 4e-08
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 5e-08
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 5e-08
2o2t_A117 Multiple PDZ domain protein; structural protein, s 6e-08
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 6e-08
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 6e-08
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 7e-08
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 8e-08
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 8e-08
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 9e-08
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 9e-08
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 1e-07
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 1e-07
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 1e-07
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-07
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 2e-07
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 3e-07
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 3e-07
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 3e-07
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 3e-07
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 4e-07
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 4e-07
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 4e-07
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 5e-07
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 6e-07
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 6e-07
3k1r_A192 Harmonin; protein-protein complex, alternative spl 6e-07
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 7e-07
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 7e-07
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 7e-07
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 8e-07
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 9e-07
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 1e-06
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 1e-06
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 1e-06
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 2e-06
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 2e-06
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 2e-06
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 2e-06
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 2e-06
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 3e-06
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 3e-06
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 3e-06
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-06
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 4e-06
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 6e-06
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 6e-06
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 6e-06
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 1e-05
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 1e-05
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 1e-05
1z87_A 263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 2e-05
2eei_A106 PDZ domain-containing protein 1; regulatory factor 2e-05
2eeh_A100 PDZ domain-containing protein 7; structural genomi 2e-05
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 2e-05
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 3e-05
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 3e-05
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 3e-05
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 4e-05
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 4e-05
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 4e-05
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 5e-05
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 6e-05
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 7e-05
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 7e-05
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 7e-05
2v90_A96 PDZ domain-containing protein 3; membrane, protein 7e-05
2d90_A102 PDZ domain containing protein 1; structural genomi 7e-05
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 7e-05
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 9e-05
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 9e-05
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 1e-04
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 1e-04
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 1e-04
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 1e-04
3suz_A 388 Amyloid beta A4 precursor protein-binding family 2 2e-04
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 4e-04
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 4e-04
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 6e-04
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 7e-04
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 7e-04
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 7e-04
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
 Score = 74.8 bits (184), Expect = 2e-19
 Identities = 35/75 (46%), Positives = 54/75 (72%)

Query: 2  SSFGNFSSDKVKKKYGSLGPDLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSA 61
          SS   F+  K++++Y  L  +L ++ LE+   GLG+SLAG+KDR++M++FV G+NP G A
Sbjct: 5  SSGDAFTDQKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRSRMSIFVVGINPEGPA 64

Query: 62 SKTGSVLVGDELLEI 76
          +  G + +GDELLEI
Sbjct: 65 AADGRMRIGDELLEI 79


>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query76
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.66
2awx_A105 Synapse associated protein 97; membrane protein, s 99.48
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.48
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.46
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.44
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.44
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.43
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.43
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.42
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.41
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.41
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.41
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.41
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.41
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.4
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.4
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.4
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.4
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.4
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.39
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.38
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.38
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.38
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.37
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.37
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.37
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.37
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.35
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.35
3gsl_A 196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.35
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.35
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.35
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.34
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.34
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.34
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.34
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.34
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.34
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.33
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.33
3r0h_A 206 INAD, inactivation-NO-after-potential D protein; p 99.33
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.33
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.32
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.31
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.31
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.31
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.3
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.3
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.3
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.3
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.29
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.29
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.27
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.27
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.27
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.27
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.27
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.26
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.26
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.25
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.25
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.24
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.23
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.23
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.23
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.23
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.22
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.22
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.22
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.21
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.21
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.2
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.2
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.2
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.2
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.19
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.19
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.19
1z87_A 263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.19
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.19
2ego_A96 General receptor for phosphoinositides 1- associat 99.18
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.18
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.18
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.18
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.18
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.17
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.17
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.16
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.16
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.16
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.15
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.14
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.14
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.14
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.14
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.13
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.13
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.12
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.12
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.12
2d90_A102 PDZ domain containing protein 1; structural genomi 99.12
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.12
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.11
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.11
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.1
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.1
1p1d_A 196 PDZ45, glutamate receptor interacting protein; PDZ 99.1
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.09
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.09
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.08
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.08
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.07
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.07
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.07
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.06
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.64
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.06
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.05
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.05
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.05
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.05
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.05
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.04
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.04
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.03
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.02
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.01
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.0
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.99
2qt5_A 200 Glutamate receptor-interacting protein 1; PDZ-pept 98.98
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.98
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.97
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.95
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.95
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.95
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.94
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.92
2qbw_A 195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.88
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.87
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.86
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.82
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.82
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.81
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.81
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.8
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.8
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.79
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.79
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.78
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.77
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.74
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.73
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.71
3suz_A 388 Amyloid beta A4 precursor protein-binding family 2 98.7
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.69
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.68
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.67
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.66
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.66
1w9e_A 166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.65
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.65
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.65
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.53
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.45
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.43
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.39
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.23
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 97.98
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 97.73
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 97.62
3rle_A 209 Golgi reassembly-stacking protein 2; PDZ, tether, 97.5
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 97.48
2kl1_A94 YLBL protein; structure genomics, structural genom 97.48
3k50_A 403 Putative S41 protease; structural genomics, joint 97.34
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 97.32
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 97.29
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 97.21
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 97.16
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 97.1
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 97.0
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 96.94
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 96.91
2hga_A125 Conserved protein MTH1368; GFT structural genomics 96.9
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 96.84
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 96.7
4fgm_A597 Aminopeptidase N family protein; structural genomi 96.66
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 96.51
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 96.48
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 96.45
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 96.39
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 96.35
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 96.24
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 96.2
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 95.76
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 95.66
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 95.59
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 95.26
1k32_A 1045 Tricorn protease; protein degradation, substrate g 94.46
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 94.43
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 94.08
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
Probab=99.66  E-value=3.1e-16  Score=97.79  Aligned_cols=70  Identities=47%  Similarity=0.942  Sum_probs=66.3

Q ss_pred             CchhhhhhhcCCCCCcEEEEEEecCCCcccEEEecCCCCCCCcEEEEEeCCCChhcccCCCCCCCEEEEC
Q psy18106          7 FSSDKVKKKYGSLGPDLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSASKTGSVLVGDELLEI   76 (76)
Q Consensus         7 ~~~~~~~~~~~~~~~e~~~v~L~k~~~gLG~si~Gg~~~~~~~I~V~~V~~gg~A~~dG~L~~GD~ileV   76 (76)
                      |+...+.++|..+++++++|+|.|+..+|||++.++.+....+++|..|.|++||++.|+|++||+|++|
T Consensus        10 ~~~~~~~~~~~~~~~~~~~v~l~k~~~glG~~l~~~~~~~~~gv~V~~V~~~spA~~aG~L~~GD~Il~I   79 (124)
T 2daz_A           10 FTDQKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLEI   79 (124)
T ss_dssp             GSHHHHHHHSTTSSSEEEEEEEECCSSCCCEEEECBSSTTSCCEEEEEECTTSHHHHHTCCCTTCEECEE
T ss_pred             cchhhHHHhhccCCCceEEEEEEeCCCccCEEEeccCCCCcCCEEEEEECCCCHHHHcCCCCCCCEEEEE
Confidence            8899999999999999999999999889999999998866689999999999999999999999999986



>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 76
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 7e-10
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 9e-09
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 1e-08
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 2e-08
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 2e-08
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 3e-08
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 8e-08
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-07
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 1e-07
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 3e-07
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 4e-07
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-07
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 6e-07
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 1e-06
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 2e-06
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 4e-06
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 5e-06
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 6e-06
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 8e-06
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 8e-06
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 9e-06
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 1e-05
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 1e-05
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 2e-05
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 2e-05
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 2e-05
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 2e-05
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 3e-05
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 6e-05
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 6e-05
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 7e-05
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 8e-05
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 9e-05
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 9e-05
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 1e-04
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 1e-04
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 2e-04
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 2e-04
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-04
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 4e-04
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 4e-04
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 5e-04
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 7e-04
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 8e-04
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 0.002
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: KIAA1526 protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 48.8 bits (116), Expect = 7e-10
 Identities = 17/60 (28%), Positives = 30/60 (50%)

Query: 17 GSLGPDLVVVTLERSHTGLGISLAGHKDRTKMAVFVCGLNPSGSASKTGSVLVGDELLEI 76
          GS G    +V +++S   LGI++ G  +  +    +  +   GSA   G + VG  +LE+
Sbjct: 1  GSSGSSGTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEV 60


>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query76
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.66
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.65
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.65
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.65
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.64
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.63
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.63
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.6
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.59
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.59
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.58
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.58
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.57
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.56
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.56
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.56
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.56
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.55
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.54
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.54
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.53
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.53
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.52
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.52
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.52
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.52
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.51
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.5
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.5
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.49
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.48
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.47
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.47
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.47
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.46
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.45
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.43
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.41
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.41
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.4
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.39
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.38
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.34
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.34
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.32
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.31
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.29
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.26
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.26
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.24
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.22
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.12
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.11
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.06
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.9
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.72
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.49
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 97.59
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 97.55
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 97.54
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 97.46
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 97.4
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 96.66
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 95.66
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Synaptic protein PSD-95
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.66  E-value=5.5e-17  Score=96.28  Aligned_cols=55  Identities=35%  Similarity=0.655  Sum_probs=50.2

Q ss_pred             cEEEEEEecCCCcccEEEecCCCC----CCCcEEEEEeCCCChhcccCCCCCCCEEEEC
Q psy18106         22 DLVVVTLERSHTGLGISLAGHKDR----TKMAVFVCGLNPSGSASKTGSVLVGDELLEI   76 (76)
Q Consensus        22 e~~~v~L~k~~~gLG~si~Gg~~~----~~~~I~V~~V~~gg~A~~dG~L~~GD~ileV   76 (76)
                      |+++|+|.|+..||||+|.||.+.    ...+|||++|.|+|||+++|+|++||+|++|
T Consensus         1 E~~~V~l~k~~~glG~~i~gg~~~~~~~~~~gi~I~~V~~gg~A~~~G~L~~GD~Il~V   59 (93)
T d1rgra_           1 EYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFV   59 (93)
T ss_dssp             CEEEEEEECCSSCCSEEECCCSSSCSCTTCCCCCEEEECTTSHHHHHCCCCTTCEEEEE
T ss_pred             CCEEEEEEeCCCcCCEEEEeecCCCCcCCCCCEEEEEECCCChHHhcCCCCcCcEEEEE
Confidence            578999999988999999999874    2569999999999999999999999999986



>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure