Psyllid ID: psy18223

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MKGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLVHSILSDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFLNEAKSKRNRRKRKFEKEEKLFEKEKAKDERRKKSGVRNSGADSSMDLIAAIQSKNATRESGFIGGIANLEAKYELTKFARRS
cccHHHHHHHHcccccccHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccccHHHccccccHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccc
cccHHHHHHHHHccccHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHccccccccHHHHHHHHHHHHHcccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
MKGLLQLCEKYYKTKDLYEVlnvdktatpEQIRKAFYKLSLvvhpdrvteedKEVATEKFKILGLVHSILSDVEkrkvydqtgtlededdeaifksdidWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFElvpfthpseedRYRQIIQDLidkeevpaFDKFLNEAKSKRNRRKRKFEKEEKLFEKEKAKderrkksgvrnsgadsSMDLIAAIQSknatresgfigGIANLEAKYELTKFARRS
MKGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLvhsilsdvekrkvydqtgtlededdeaifksdidwtMYWKSLYKDVTEEDIINYEtkykgsaeeiNDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIdkeevpafdkflneakskrnrrkrkfekeeklfekekakderrkksgvrnsgadssmdLIAAIQsknatresgfiggianleakyeltkfarrs
MKGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLVHSILSDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFLneakskrnrrkrkfekeeklfekekakderrkkSGVRNSGADSSMDLIAAIQSKNATRESGFIGGIANLEAKYELTKFARRS
***LLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLVHSILSDVEKRKVYDQTGTLE***DEAIFKSDIDWTMYW************INYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFD***************************************************************GFIGGIANLEAKYEL*******
**GL*QLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPD**********TEKFKILGLVHSILSDVEKRKVYDQTGTLE*********SDIDWTMYWKSLYKDVTEEDIIN****************RAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKF***********************************************************************************
MKGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDR********ATEKFKILGLVHSILSDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFLNEAK**********EKEEKLFE******************ADSSMDLIAAIQSKNATRESGFIGGIANLEAKYELTKFARRS
*KGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLVHSILSDVEKRKVYDQT*T********IFKSDIDWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFLNEAKSKRNRRKRKFEKEEKLFEKEKAKDERRKK*********SSMDLIAAIQSKNATRESGFIGGIANLEAKYEL*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLVHSILSDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKKSGVRNSGADSSMDLIAAIQSKNATRESGFIGGIANLEAKYELTKFARRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query264 2.2.26 [Sep-21-2011]
Q8WXX5260 DnaJ homolog subfamily C yes N/A 0.912 0.926 0.458 1e-52
Q91WN1259 DnaJ homolog subfamily C yes N/A 0.912 0.930 0.438 3e-51
Q9VGR7299 J domain-containing prote yes N/A 0.939 0.829 0.388 4e-44
Q9UTQ5282 Uncharacterized J domain- yes N/A 0.912 0.854 0.329 2e-23
Q9FL54284 Chaperone protein dnaJ 6 no N/A 0.613 0.570 0.383 8e-21
Q9HJ83 365 Chaperone protein DnaJ OS yes N/A 0.484 0.350 0.350 2e-11
Q5R6H3379 DnaJ homolog subfamily B yes N/A 0.507 0.353 0.295 2e-11
Q9QYI4376 DnaJ homolog subfamily B no N/A 0.507 0.356 0.285 2e-11
Q8TBM8379 DnaJ homolog subfamily B no N/A 0.507 0.353 0.295 3e-11
Q58DR2370 DnaJ homolog subfamily B no N/A 0.507 0.362 0.285 7e-11
>sp|Q8WXX5|DNJC9_HUMAN DnaJ homolog subfamily C member 9 OS=Homo sapiens GN=DNAJC9 PE=1 SV=1 Back     alignment and function desciption
 Score =  206 bits (524), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 116/253 (45%), Positives = 161/253 (63%), Gaps = 12/253 (4%)

Query: 3   GLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKI 62
           GLL LCE+ + T DLY VL V + A+  ++R+ ++K+SL VHPDRV E DKE AT +F+I
Sbjct: 2   GLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQI 61

Query: 63  LGLVHSILSDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETK 122
           LG V+S+LSD E+R VYD+ GT+++  D  +   D DW  YW+ L+K ++ EDI  +E  
Sbjct: 62  LGKVYSVLSDREQRAVYDEQGTVDE--DSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKT 119

Query: 123 YKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFL 182
           YKGS EE+ D K+AY+  +GDMD I E V     +EE R R IIQ  ID  EVP+++ F+
Sbjct: 120 YKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFV 179

Query: 183 NEAKSKRNRRKRKFEKEEKLFEKEKAKDERRKKSGVRNSGADSSMDLIAAIQSKNATRES 242
            E+K K N RKR+ ++E K  E        RK+ G+ + G DS   L AAIQS+   R+ 
Sbjct: 180 KESKQKMNARKRRAQEEAKEAEMS------RKELGL-DEGVDS---LKAAIQSRQKDRQK 229

Query: 243 GFIGGIANLEAKY 255
                +A +EAKY
Sbjct: 230 EMDNFLAQMEAKY 242

Homo sapiens (taxid: 9606)
>sp|Q91WN1|DNJC9_MOUSE DnaJ homolog subfamily C member 9 OS=Mus musculus GN=Dnajc9 PE=2 SV=2 Back     alignment and function description
>sp|Q9VGR7|Y6693_DROME J domain-containing protein CG6693 OS=Drosophila melanogaster GN=CG6693 PE=1 SV=1 Back     alignment and function description
>sp|Q9UTQ5|YL39_SCHPO Uncharacterized J domain-containing protein C1071.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1071.09c PE=3 SV=1 Back     alignment and function description
>sp|Q9FL54|DNAJ6_ARATH Chaperone protein dnaJ 6 OS=Arabidopsis thaliana GN=ATJ6 PE=1 SV=1 Back     alignment and function description
>sp|Q9HJ83|DNAJ_THEAC Chaperone protein DnaJ OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q5R6H3|DJB14_PONAB DnaJ homolog subfamily B member 14 OS=Pongo abelii GN=DNAJB14 PE=2 SV=1 Back     alignment and function description
>sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=2 SV=2 Back     alignment and function description
>sp|Q8TBM8|DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens GN=DNAJB14 PE=2 SV=1 Back     alignment and function description
>sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query264
156554683268 PREDICTED: J domain-containing protein C 0.875 0.861 0.508 2e-55
332019850268 DnaJ-like protein subfamily C member 9 [ 0.871 0.858 0.497 2e-54
307175358271 J domain-containing protein CG6693 [Camp 0.878 0.856 0.469 9e-53
242011852265 conserved hypothetical protein [Pediculu 0.75 0.747 0.522 4e-52
403298065260 PREDICTED: dnaJ homolog subfamily C memb 0.912 0.926 0.462 1e-51
322791137 813 hypothetical protein SINV_08437 [Solenop 0.685 0.222 0.543 2e-51
328778256284 PREDICTED: dnaJ homolog subfamily C memb 0.685 0.637 0.543 3e-51
380020963284 PREDICTED: dnaJ homolog subfamily C memb 0.685 0.637 0.543 4e-51
410214900260 DnaJ (Hsp40) homolog, subfamily C, membe 0.912 0.926 0.458 4e-51
355562498259 hypothetical protein EGK_19735 [Macaca m 0.912 0.930 0.454 6e-51
>gi|156554683|ref|XP_001601586.1| PREDICTED: J domain-containing protein CG6693-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 122/240 (50%), Positives = 165/240 (68%), Gaps = 9/240 (3%)

Query: 3   GLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKI 62
           GLL LCE+Y+  +D Y+VLN+DKTA  +Q++KA++KLSL+VHPDRV E  KE ATEKFK+
Sbjct: 4   GLLDLCEQYFGARDFYDVLNIDKTANEKQVKKAYHKLSLLVHPDRVEEAVKEEATEKFKV 63

Query: 63  LGLVHSILSDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETK 122
           LG +HSILSD +KRK+YD+TG  +++ +E + ++   W+ YW++L+K++T +DI NYE  
Sbjct: 64  LGRIHSILSDNDKRKIYDETGQFDEDSEEVVMRN---WSDYWRTLFKEITVQDINNYEKN 120

Query: 123 YKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFL 182
           YKGS  EI D KRAY+  +GDMD I E VPFT   EE R  +II DLI+K EVP F+ F 
Sbjct: 121 YKGSEIEIKDLKRAYMDSKGDMDYILESVPFTSCEEEPRLHKIINDLIEKGEVPEFESFT 180

Query: 183 NEAKSKRNRRKRKFEKEEKLFEKEKAKDERRKKSGVRNSGADSSMDLIAAIQSKNATRES 242
            E + KR RRKRK+ KE K  E+        K   +    A+ + DL  AI +KN +R S
Sbjct: 181 KEDERKRMRRKRKWAKEAKEAER------LEKMRAIEKEDAEKNGDLALAILNKNKSRAS 234

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332019850|gb|EGI60311.1| DnaJ-like protein subfamily C member 9 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307175358|gb|EFN65377.1| J domain-containing protein CG6693 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|242011852|ref|XP_002426658.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212510822|gb|EEB13920.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|403298065|ref|XP_003939858.1| PREDICTED: dnaJ homolog subfamily C member 9 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|322791137|gb|EFZ15699.1| hypothetical protein SINV_08437 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|328778256|ref|XP_393383.3| PREDICTED: dnaJ homolog subfamily C member 9-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380020963|ref|XP_003694344.1| PREDICTED: dnaJ homolog subfamily C member 9-like [Apis florea] Back     alignment and taxonomy information
>gi|410214900|gb|JAA04669.1| DnaJ (Hsp40) homolog, subfamily C, member 9 [Pan troglodytes] gi|410261010|gb|JAA18471.1| DnaJ (Hsp40) homolog, subfamily C, member 9 [Pan troglodytes] gi|410307744|gb|JAA32472.1| DnaJ (Hsp40) homolog, subfamily C, member 9 [Pan troglodytes] Back     alignment and taxonomy information
>gi|355562498|gb|EHH19092.1| hypothetical protein EGK_19735 [Macaca mulatta] gi|355782838|gb|EHH64759.1| hypothetical protein EGM_18067 [Macaca fascicularis] gi|380810980|gb|AFE77365.1| dnaJ homolog subfamily C member 9 [Macaca mulatta] gi|383416921|gb|AFH31674.1| dnaJ homolog subfamily C member 9 [Macaca mulatta] gi|384946024|gb|AFI36617.1| dnaJ homolog subfamily C member 9 [Macaca mulatta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query264
UNIPROTKB|F1MTK0261 DNAJC9 "Uncharacterized protei 0.674 0.681 0.488 6.8e-47
UNIPROTKB|Q8WXX5260 DNAJC9 "DnaJ homolog subfamily 0.674 0.684 0.488 2.3e-46
RGD|1305009259 Dnajc9 "DnaJ (Hsp40) homolog, 0.674 0.687 0.483 6e-46
ZFIN|ZDB-GENE-040718-130252 dnajc9 "DnaJ (Hsp40) homolog, 0.662 0.694 0.446 3.2e-43
MGI|MGI:1915326259 Dnajc9 "DnaJ (Hsp40) homolog, 0.912 0.930 0.395 1.9e-42
UNIPROTKB|E1C8S9260 DNAJC9 "Uncharacterized protei 0.674 0.684 0.444 5.9e-42
FB|FBgn0037878299 CG6693 [Drosophila melanogaste 0.662 0.585 0.429 1.4e-40
POMBASE|SPAC1071.09c282 SPAC1071.09c "DNAJ domain prot 0.659 0.617 0.370 2.9e-29
TAIR|locus:2082189262 AT3G12170 [Arabidopsis thalian 0.594 0.599 0.432 2.2e-27
UNIPROTKB|G4NCV1324 MGG_01016 "Chaperone dnaJ 6" [ 0.621 0.506 0.391 9.4e-27
UNIPROTKB|F1MTK0 DNAJC9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 453 (164.5 bits), Expect = 6.8e-47, Sum P(2) = 6.8e-47
 Identities = 88/180 (48%), Positives = 125/180 (69%)

Query:     3 GLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKI 62
             GLL+LCE+ + T DLY+VL V + A+  +IR+ ++K+SL VHPDRV E DKE AT +F+I
Sbjct:     3 GLLELCEELFGTADLYQVLGVRREASDGEIRRGYHKVSLQVHPDRVGEGDKEDATRRFQI 62

Query:    63 LGLVHSILSDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETK 122
             LG V+S+LSD E+R +YD+ GT++++ D  +   D DW  YW+ L+K ++ EDI  +E  
Sbjct:    63 LGKVYSVLSDKEQRTLYDEQGTVDEDSD--VLSQDRDWEAYWRLLFKKISLEDIQAFEKT 120

Query:   123 YKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFL 182
             YKGS EE+ D K+AY+  +GDMD I E V     +EE R R IIQ  ID  EVP+++ F+
Sbjct:   121 YKGSEEELTDIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRHIIQQAIDAGEVPSYNAFV 180
GO:0035176 "social behavior" evidence=IEA
UNIPROTKB|Q8WXX5 DNAJC9 "DnaJ homolog subfamily C member 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1305009 Dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-130 dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1915326 Dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8S9 DNAJC9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0037878 CG6693 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
POMBASE|SPAC1071.09c SPAC1071.09c "DNAJ domain protein, DNAJC9 family (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:2082189 AT3G12170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4NCV1 MGG_01016 "Chaperone dnaJ 6" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8WXX5DNJC9_HUMANNo assigned EC number0.45840.91280.9269yesN/A
Q9VGR7Y6693_DROMENo assigned EC number0.38880.93930.8294yesN/A
Q91WN1DNJC9_MOUSENo assigned EC number0.43870.91280.9305yesN/A
Q9UTQ5YL39_SCHPONo assigned EC number0.32960.91280.8546yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query264
pfam0022663 pfam00226, DnaJ, DnaJ domain 5e-18
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 1e-16
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 9e-15
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 1e-14
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 2e-14
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 7e-14
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 8e-14
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 2e-13
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 6e-13
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 8e-13
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 1e-12
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 1e-12
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-12
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-12
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 4e-12
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 5e-12
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 1e-11
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 2e-11
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 2e-11
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 2e-11
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 3e-11
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 4e-11
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 1e-10
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 1e-10
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 1e-10
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 3e-10
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 5e-10
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 9e-10
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 6e-09
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 9e-09
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 2e-08
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-08
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 6e-08
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 2e-06
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 3e-06
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 4e-05
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 1e-04
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 0.003
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 75.3 bits (186), Expect = 5e-18
 Identities = 29/65 (44%), Positives = 41/65 (63%), Gaps = 2/65 (3%)

Query: 16 DLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLVHSILSDVEK 75
          D YE+L V + A+ E+I+KA+ KL+L  HPD+        A EKFK +   + +LSD EK
Sbjct: 1  DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNP--GDPAAEEKFKEINEAYEVLSDPEK 58

Query: 76 RKVYD 80
          R +YD
Sbjct: 59 RAIYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 264
KOG0719|consensus264 100.0
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.95
KOG0713|consensus336 99.92
KOG0712|consensus337 99.91
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.89
PRK14286372 chaperone protein DnaJ; Provisional 99.88
PRK14288369 chaperone protein DnaJ; Provisional 99.87
PRK14296372 chaperone protein DnaJ; Provisional 99.86
PRK14285365 chaperone protein DnaJ; Provisional 99.86
PRK14294366 chaperone protein DnaJ; Provisional 99.85
PRK14287371 chaperone protein DnaJ; Provisional 99.85
PRK14301373 chaperone protein DnaJ; Provisional 99.84
KOG0717|consensus 508 99.84
PRK10767371 chaperone protein DnaJ; Provisional 99.84
PRK14298377 chaperone protein DnaJ; Provisional 99.83
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.82
PRK14290 365 chaperone protein DnaJ; Provisional 99.82
PRK14276380 chaperone protein DnaJ; Provisional 99.81
KOG0718|consensus 546 99.81
PRK14281 397 chaperone protein DnaJ; Provisional 99.81
PRK14297 380 chaperone protein DnaJ; Provisional 99.81
PRK14295389 chaperone protein DnaJ; Provisional 99.8
PRK14278 378 chaperone protein DnaJ; Provisional 99.8
KOG0691|consensus296 99.8
PRK14282369 chaperone protein DnaJ; Provisional 99.8
PRK14299291 chaperone protein DnaJ; Provisional 99.8
PRK14277386 chaperone protein DnaJ; Provisional 99.8
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.8
PRK14280376 chaperone protein DnaJ; Provisional 99.8
PRK14279 392 chaperone protein DnaJ; Provisional 99.79
PRK14291 382 chaperone protein DnaJ; Provisional 99.78
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.76
PRK14283 378 chaperone protein DnaJ; Provisional 99.76
KOG0716|consensus279 99.75
PRK14293 374 chaperone protein DnaJ; Provisional 99.75
PRK14289 386 chaperone protein DnaJ; Provisional 99.75
PRK14292 371 chaperone protein DnaJ; Provisional 99.75
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.74
PRK14284 391 chaperone protein DnaJ; Provisional 99.74
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.73
PRK14300372 chaperone protein DnaJ; Provisional 99.73
KOG0715|consensus288 99.7
PHA03102153 Small T antigen; Reviewed 99.67
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.65
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.63
PHA02624 647 large T antigen; Provisional 99.62
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.62
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.6
KOG0721|consensus230 99.58
KOG0624|consensus504 99.5
PRK01356166 hscB co-chaperone HscB; Provisional 99.48
KOG0550|consensus486 99.48
PRK05014171 hscB co-chaperone HscB; Provisional 99.47
KOG0722|consensus329 99.43
PRK00294173 hscB co-chaperone HscB; Provisional 99.42
PRK03578176 hscB co-chaperone HscB; Provisional 99.4
KOG0720|consensus490 99.4
KOG0714|consensus306 99.39
PTZ00100116 DnaJ chaperone protein; Provisional 99.28
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.26
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.16
KOG1150|consensus250 99.09
PRK01773173 hscB co-chaperone HscB; Provisional 99.05
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.91
KOG0568|consensus342 98.1
KOG1789|consensus 2235 98.09
KOG0723|consensus112 97.74
KOG3192|consensus168 96.47
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.98
KOG0431|consensus453 95.77
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.39
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 92.92
KOG0724|consensus335 89.92
>KOG0719|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.6e-57  Score=391.50  Aligned_cols=237  Identities=41%  Similarity=0.642  Sum_probs=215.0

Q ss_pred             cchhhHHHHhcCCCCcccccccCCCCCHHHHHHHHHHHHHhhCCCCCCChhhHHHHHHHHHHHHHHHhhchhhhhhhccc
Q psy18223          2 KGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLVHSILSDVEKRKVYDQ   81 (264)
Q Consensus         2 m~l~~~~~~~~~~~d~Y~vLgv~~~as~~eIkkaYrkl~l~~HPDk~~~~~~~~a~~~F~~i~~Ay~iLsd~~kR~~YD~   81 (264)
                      |..|..|...|.+.|+|+||||.++||..+|++|||+|+|.||||++++....+++++||+|+.||+||||.++|++||.
T Consensus         1 ~~~l~~~~~~f~~~d~YevLGVer~a~~~eIrkAY~klal~~HPDk~~eed~~ea~~kFq~l~k~y~iLsDeekR~~YDe   80 (264)
T KOG0719|consen    1 QFSLEECTGSFNKKDLYEVLGVERDATDKEIRKAYHKLALRLHPDKNHEEDKVEATEKFQQLQKAYQILSDEEKRAVYDE   80 (264)
T ss_pred             CcchhhccccccccCHHHHhhhcccCCHHHHHHHHHHHHHHhCCCcchhhhHHHHHHHHHHHHHHHHHhhHHHHHHHHhc
Confidence            34567799999999999999999999999999999999999999999877788899999999999999999999999999


Q ss_pred             cCCCCCCCchhhccCCCCHHHHHHhhccCCCHHHHHhHHHhhcCcHHHHHHHHHHHhcCCCChhhhhhccCCCCCchHHH
Q psy18223         82 TGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDR  161 (264)
Q Consensus        82 ~G~~~~~~~~~~~~~~~~~~~~f~~~F~~vt~edi~~f~~~y~gs~eE~~dl~~~y~~~~g~~~~i~~~v~~~~~~d~~R  161 (264)
                      +|.+++.+    .+-..+|-++|+.+|..||.++|++|...|+||++|+.||..+|++++|+|..|++.++|+.++|++|
T Consensus        81 tG~idd~~----~d~~~~~~e~~~~iyk~VteedIeef~a~Y~gSEeEk~Dl~~~Y~k~kG~m~~i~~~~l~~d~~De~R  156 (264)
T KOG0719|consen   81 TGSIDDES----GDIDEDWLEFWRAIYKKVTEEDIEEFEANYQGSEEEKKDLLKLYNKFKGKMNRILESVLCSDPKDEDR  156 (264)
T ss_pred             cCCCCCcc----chhhhHHHHHHHHHHhhcccccHHHHHHHhcccHHHHHHHHHHHHhcCChHHHHHHhhhcCCcccHHH
Confidence            99998542    22358999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhcCCCCchhhhcchhHHHHHHHhhHHHHHHhHHHHHHhhHHHHHhccCCCCCCCChHHHHHHHHHHHhchh
Q psy18223        162 YRQIIQDLIDKEEVPAFDKFLNEAKSKRNRRKRKFEKEEKLFEKEKAKDERRKKSGVRNSGADSSMDLIAAIQSKNATRE  241 (264)
Q Consensus       162 ~~~ii~~~i~~~~~~~~~~~~~e~k~~k~~r~kk~~~e~k~~eae~~~~e~~ke~~~~~~~~~~~~~L~~~i~~r~~~r~  241 (264)
                      |++||+.||.+|+|+.|++|..++++. +.|..+..+|.+  +|+.+.      ++      .+..+|.++|++|+..|.
T Consensus       157 ~keiid~~I~~Gev~~yK~y~~~~~~~-K~r~~~~~re~r--~ak~~~------~~------~~~~DL~~~i~~r~~eRk  221 (264)
T KOG0719|consen  157 FKEIIDEAIADGEVKKYKAYEKWASEK-KMRAPKKAREKR--EAKVLA------AK------DNGIDLDAMIEKRGGERK  221 (264)
T ss_pred             HHHHHHHHHhcCCchhhhhcccchhhh-hhccccchHHHH--HHHHHH------HH------hcCccHHHHHHHHhhhhh
Confidence            999999999999999999999998766 566666667766  666643      12      134689999999999999


Q ss_pred             hchhhHHHHHHHhccC
Q psy18223        242 SGFIGGIANLEAKYEL  257 (264)
Q Consensus       242 ~~~~~~~~~le~ky~~  257 (264)
                      ..+++||++|++||++
T Consensus       222 ~~~~sl~~SL~~kY~~  237 (264)
T KOG0719|consen  222 GKFDSLLDSLEEKYGG  237 (264)
T ss_pred             hhHHHHHHHHHHHhcc
Confidence            9999999999999986

>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713|consensus Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718|consensus Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691|consensus Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716|consensus Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0721|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722|consensus Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720|consensus Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1150|consensus Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG0568|consensus Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>KOG0723|consensus Back     alignment and domain information
>KOG3192|consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431|consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>KOG0724|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query264
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 2e-11
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 7e-11
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 2e-10
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 9e-10
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 9e-10
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-09
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 2e-09
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 1e-08
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 3e-08
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 4e-08
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 5e-08
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 2e-07
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 4e-07
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 4e-07
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 6e-07
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 3e-06
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 4e-06
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 2e-05
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 7e-04
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure 
Iteration: 1

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 48/69 (69%), Gaps = 1/69 (1%)
Query: 16 DLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLVHSILSDVEK 75
          + YEVL V  +A+PE I+KA+ KL+L  HPD+   ++KE A +KFK++   + +LSD +K
Sbjct: 10 NYYEVLGVQASASPEDIKKAYRKLALRWHPDK-NPDNKEEAEKKFKLVSEAYEVLSDSKK 68
Query: 76 RKVYDQTGT 84
          R +YD+ G 
Sbjct: 69 RSLYDRAGC 77
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query264
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 9e-18
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 2e-17
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 4e-17
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 1e-16
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 1e-16
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 1e-16
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 2e-16
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 6e-16
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 8e-16
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-15
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 2e-15
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 3e-15
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 3e-15
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 3e-15
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 6e-15
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 6e-15
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 8e-15
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-14
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 1e-14
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 1e-14
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 1e-14
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 2e-14
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 2e-12
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-12
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 1e-07
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 1e-07
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 2e-06
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 9e-06
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 1e-05
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 3e-05
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 6e-05
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 2e-04
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
 Score = 77.2 bits (190), Expect = 9e-18
 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 4/90 (4%)

Query: 15  KDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDR----VTEEDKEVATEKFKILGLVHSIL 70
           KD Y +L  D +A    +++ + KL L+ HPD+    V     E   +KF  +     IL
Sbjct: 10  KDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKIL 69

Query: 71  SDVEKRKVYDQTGTLEDEDDEAIFKSDIDW 100
            + E ++ YD     +D  +     + +  
Sbjct: 70  GNEETKREYDLQRCEDDLRNVGPVDAQVYL 99
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query264
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.86
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.85
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.84
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.84
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.83
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.83
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.83
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.82
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.82
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.81
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.81
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.8
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.8
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.8
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.8
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.8
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.79
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.78
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.78
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.76
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.74
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.73
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.7
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.7
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.7
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.69
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.68
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.68
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.68
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.67
2guz_A71 Mitochondrial import inner membrane translocase su 99.61
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.6
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.59
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.14
2guz_B65 Mitochondrial import inner membrane translocase su 98.79
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 86.88
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
Probab=99.86  E-value=2.2e-22  Score=156.54  Aligned_cols=94  Identities=34%  Similarity=0.536  Sum_probs=67.2

Q ss_pred             CCCcccccccCCCCCHHHHHHHHHHHHHhhCCCCCCChhhHHHHHHHHHHHHHHHhhchhhhhhhccccCCCCCCCch--
Q psy18223         14 TKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLVHSILSDVEKRKVYDQTGTLEDEDDE--   91 (264)
Q Consensus        14 ~~d~Y~vLgv~~~as~~eIkkaYrkl~l~~HPDk~~~~~~~~a~~~F~~i~~Ay~iLsd~~kR~~YD~~G~~~~~~~~--   91 (264)
                      ..|||+||||+++||.++||+|||+|+++||||+++..+  .+.+.|+.|++||+||+||.+|..||..|..+...+.  
T Consensus         2 ~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~~~~--~a~~~f~~i~~Ay~~L~d~~~R~~YD~~~~~~~~~~~~~   79 (103)
T 1bq0_A            2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDK--EAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMG   79 (103)
T ss_dssp             CCCSTTTTSSCSSCCHHHHHHHHHHHHTTTCTTTCTTTC--THHHHHHHHTTTTTSTTCSHHHHHTTTSTTTSSCSCC--
T ss_pred             CCCHHHHcCcCCCCCHHHHHHHHHHHHHHHCcCCCCCcH--HHHHHHHHHHHHHHHHCCHHHHHHHHHHhhhhhcccCcC
Confidence            469999999999999999999999999999999997543  3789999999999999999999999999986654211  


Q ss_pred             -hhccCCCCHHHHHHhhcc
Q psy18223         92 -AIFKSDIDWTMYWKSLYK  109 (264)
Q Consensus        92 -~~~~~~~~~~~~f~~~F~  109 (264)
                       ..++...++.++|..+|+
T Consensus        80 ~~~~~~~~~~~~~f~~~f~   98 (103)
T 1bq0_A           80 GGGFGGGADFSDIFGDVFG   98 (103)
T ss_dssp             -------------------
T ss_pred             CCCCCCCCCHHHHHHHHHH
Confidence             111111244556666654
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 264
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 9e-12
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 4e-11
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 7e-11
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 9e-11
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 1e-09
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 9e-09
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 1e-07
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 9e-07
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 57.8 bits (139), Expect = 9e-12
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 7  LCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDR----VTEEDKEVATEKFKI 62
          +  +    KD Y +L  D +A    +++ + KL L+ HPD+    V     E   +KF  
Sbjct: 8  MALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIE 67

Query: 63 LGLVHSILSDVEKRKVYDQTG 83
          +     IL + E +K YD   
Sbjct: 68 IDQAWKILGNEETKKKYDLQR 88
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query264
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.88
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.86
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.8
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.73
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.7
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.67
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.65
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.88  E-value=1.1e-23  Score=153.47  Aligned_cols=71  Identities=41%  Similarity=0.649  Sum_probs=65.2

Q ss_pred             CCCcccccccCCCCCHHHHHHHHHHHHHhhCCCCCCChhhHHHHHHHHHHHHHHHhhchhhhhhhccccCCCC
Q psy18223         14 TKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLVHSILSDVEKRKVYDQTGTLE   86 (264)
Q Consensus        14 ~~d~Y~vLgv~~~as~~eIkkaYrkl~l~~HPDk~~~~~~~~a~~~F~~i~~Ay~iLsd~~kR~~YD~~G~~~   86 (264)
                      ..|||+||||+++||.++||+|||+++++||||+++.++.  +.+.|+.|+.||+||+||.+|..||.+|..+
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~--~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~   72 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKE--AEAKFKEIKEAYEVLTDSQKRAAYDQYGHAA   72 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCH--HHHHHHHHHHHHHHTTSSHHHHHHHHHTTSS
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChH--HHHHHHHHHHHHHhcCCHHHHHHHHHhCccc
Confidence            4799999999999999999999999999999999875543  7788999999999999999999999999654
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure