Psyllid ID: psy18223
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 264 | ||||||
| 156554683 | 268 | PREDICTED: J domain-containing protein C | 0.875 | 0.861 | 0.508 | 2e-55 | |
| 332019850 | 268 | DnaJ-like protein subfamily C member 9 [ | 0.871 | 0.858 | 0.497 | 2e-54 | |
| 307175358 | 271 | J domain-containing protein CG6693 [Camp | 0.878 | 0.856 | 0.469 | 9e-53 | |
| 242011852 | 265 | conserved hypothetical protein [Pediculu | 0.75 | 0.747 | 0.522 | 4e-52 | |
| 403298065 | 260 | PREDICTED: dnaJ homolog subfamily C memb | 0.912 | 0.926 | 0.462 | 1e-51 | |
| 322791137 | 813 | hypothetical protein SINV_08437 [Solenop | 0.685 | 0.222 | 0.543 | 2e-51 | |
| 328778256 | 284 | PREDICTED: dnaJ homolog subfamily C memb | 0.685 | 0.637 | 0.543 | 3e-51 | |
| 380020963 | 284 | PREDICTED: dnaJ homolog subfamily C memb | 0.685 | 0.637 | 0.543 | 4e-51 | |
| 410214900 | 260 | DnaJ (Hsp40) homolog, subfamily C, membe | 0.912 | 0.926 | 0.458 | 4e-51 | |
| 355562498 | 259 | hypothetical protein EGK_19735 [Macaca m | 0.912 | 0.930 | 0.454 | 6e-51 |
| >gi|156554683|ref|XP_001601586.1| PREDICTED: J domain-containing protein CG6693-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 221 bits (563), Expect = 2e-55, Method: Compositional matrix adjust.
Identities = 122/240 (50%), Positives = 165/240 (68%), Gaps = 9/240 (3%)
Query: 3 GLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKI 62
GLL LCE+Y+ +D Y+VLN+DKTA +Q++KA++KLSL+VHPDRV E KE ATEKFK+
Sbjct: 4 GLLDLCEQYFGARDFYDVLNIDKTANEKQVKKAYHKLSLLVHPDRVEEAVKEEATEKFKV 63
Query: 63 LGLVHSILSDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETK 122
LG +HSILSD +KRK+YD+TG +++ +E + ++ W+ YW++L+K++T +DI NYE
Sbjct: 64 LGRIHSILSDNDKRKIYDETGQFDEDSEEVVMRN---WSDYWRTLFKEITVQDINNYEKN 120
Query: 123 YKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFL 182
YKGS EI D KRAY+ +GDMD I E VPFT EE R +II DLI+K EVP F+ F
Sbjct: 121 YKGSEIEIKDLKRAYMDSKGDMDYILESVPFTSCEEEPRLHKIINDLIEKGEVPEFESFT 180
Query: 183 NEAKSKRNRRKRKFEKEEKLFEKEKAKDERRKKSGVRNSGADSSMDLIAAIQSKNATRES 242
E + KR RRKRK+ KE K E+ K + A+ + DL AI +KN +R S
Sbjct: 181 KEDERKRMRRKRKWAKEAKEAER------LEKMRAIEKEDAEKNGDLALAILNKNKSRAS 234
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332019850|gb|EGI60311.1| DnaJ-like protein subfamily C member 9 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307175358|gb|EFN65377.1| J domain-containing protein CG6693 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|242011852|ref|XP_002426658.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212510822|gb|EEB13920.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|403298065|ref|XP_003939858.1| PREDICTED: dnaJ homolog subfamily C member 9 [Saimiri boliviensis boliviensis] | Back alignment and taxonomy information |
|---|
| >gi|322791137|gb|EFZ15699.1| hypothetical protein SINV_08437 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|328778256|ref|XP_393383.3| PREDICTED: dnaJ homolog subfamily C member 9-like isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380020963|ref|XP_003694344.1| PREDICTED: dnaJ homolog subfamily C member 9-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|410214900|gb|JAA04669.1| DnaJ (Hsp40) homolog, subfamily C, member 9 [Pan troglodytes] gi|410261010|gb|JAA18471.1| DnaJ (Hsp40) homolog, subfamily C, member 9 [Pan troglodytes] gi|410307744|gb|JAA32472.1| DnaJ (Hsp40) homolog, subfamily C, member 9 [Pan troglodytes] | Back alignment and taxonomy information |
|---|
| >gi|355562498|gb|EHH19092.1| hypothetical protein EGK_19735 [Macaca mulatta] gi|355782838|gb|EHH64759.1| hypothetical protein EGM_18067 [Macaca fascicularis] gi|380810980|gb|AFE77365.1| dnaJ homolog subfamily C member 9 [Macaca mulatta] gi|383416921|gb|AFH31674.1| dnaJ homolog subfamily C member 9 [Macaca mulatta] gi|384946024|gb|AFI36617.1| dnaJ homolog subfamily C member 9 [Macaca mulatta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 264 | ||||||
| UNIPROTKB|F1MTK0 | 261 | DNAJC9 "Uncharacterized protei | 0.674 | 0.681 | 0.488 | 6.8e-47 | |
| UNIPROTKB|Q8WXX5 | 260 | DNAJC9 "DnaJ homolog subfamily | 0.674 | 0.684 | 0.488 | 2.3e-46 | |
| RGD|1305009 | 259 | Dnajc9 "DnaJ (Hsp40) homolog, | 0.674 | 0.687 | 0.483 | 6e-46 | |
| ZFIN|ZDB-GENE-040718-130 | 252 | dnajc9 "DnaJ (Hsp40) homolog, | 0.662 | 0.694 | 0.446 | 3.2e-43 | |
| MGI|MGI:1915326 | 259 | Dnajc9 "DnaJ (Hsp40) homolog, | 0.912 | 0.930 | 0.395 | 1.9e-42 | |
| UNIPROTKB|E1C8S9 | 260 | DNAJC9 "Uncharacterized protei | 0.674 | 0.684 | 0.444 | 5.9e-42 | |
| FB|FBgn0037878 | 299 | CG6693 [Drosophila melanogaste | 0.662 | 0.585 | 0.429 | 1.4e-40 | |
| POMBASE|SPAC1071.09c | 282 | SPAC1071.09c "DNAJ domain prot | 0.659 | 0.617 | 0.370 | 2.9e-29 | |
| TAIR|locus:2082189 | 262 | AT3G12170 [Arabidopsis thalian | 0.594 | 0.599 | 0.432 | 2.2e-27 | |
| UNIPROTKB|G4NCV1 | 324 | MGG_01016 "Chaperone dnaJ 6" [ | 0.621 | 0.506 | 0.391 | 9.4e-27 |
| UNIPROTKB|F1MTK0 DNAJC9 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 453 (164.5 bits), Expect = 6.8e-47, Sum P(2) = 6.8e-47
Identities = 88/180 (48%), Positives = 125/180 (69%)
Query: 3 GLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKI 62
GLL+LCE+ + T DLY+VL V + A+ +IR+ ++K+SL VHPDRV E DKE AT +F+I
Sbjct: 3 GLLELCEELFGTADLYQVLGVRREASDGEIRRGYHKVSLQVHPDRVGEGDKEDATRRFQI 62
Query: 63 LGLVHSILSDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETK 122
LG V+S+LSD E+R +YD+ GT++++ D + D DW YW+ L+K ++ EDI +E
Sbjct: 63 LGKVYSVLSDKEQRTLYDEQGTVDEDSD--VLSQDRDWEAYWRLLFKKISLEDIQAFEKT 120
Query: 123 YKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFL 182
YKGS EE+ D K+AY+ +GDMD I E V +EE R R IIQ ID EVP+++ F+
Sbjct: 121 YKGSEEELTDIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRHIIQQAIDAGEVPSYNAFV 180
|
|
| UNIPROTKB|Q8WXX5 DNAJC9 "DnaJ homolog subfamily C member 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1305009 Dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040718-130 dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915326 Dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C8S9 DNAJC9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037878 CG6693 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1071.09c SPAC1071.09c "DNAJ domain protein, DNAJC9 family (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082189 AT3G12170 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NCV1 MGG_01016 "Chaperone dnaJ 6" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 264 | |||
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 5e-18 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 1e-16 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 9e-15 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 1e-14 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 2e-14 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 7e-14 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 8e-14 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 2e-13 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 6e-13 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 8e-13 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 1e-12 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 1e-12 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 2e-12 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 2e-12 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 4e-12 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 5e-12 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 1e-11 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 2e-11 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 2e-11 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 2e-11 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 3e-11 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 4e-11 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 1e-10 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 1e-10 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 1e-10 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 3e-10 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 5e-10 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 9e-10 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 6e-09 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 9e-09 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 2e-08 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 2e-08 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 6e-08 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 2e-06 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 3e-06 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 4e-05 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 1e-04 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 0.003 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
Score = 75.3 bits (186), Expect = 5e-18
Identities = 29/65 (44%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
Query: 16 DLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLVHSILSDVEK 75
D YE+L V + A+ E+I+KA+ KL+L HPD+ A EKFK + + +LSD EK
Sbjct: 1 DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNP--GDPAAEEKFKEINEAYEVLSDPEK 58
Query: 76 RKVYD 80
R +YD
Sbjct: 59 RAIYD 63
|
DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63 |
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 264 | |||
| KOG0719|consensus | 264 | 100.0 | ||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.95 | |
| KOG0713|consensus | 336 | 99.92 | ||
| KOG0712|consensus | 337 | 99.91 | ||
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.89 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.88 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.87 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.86 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.86 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.85 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.85 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.84 | |
| KOG0717|consensus | 508 | 99.84 | ||
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.84 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.83 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 99.82 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.82 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.81 | |
| KOG0718|consensus | 546 | 99.81 | ||
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.81 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.81 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.8 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.8 | |
| KOG0691|consensus | 296 | 99.8 | ||
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.8 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.8 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.8 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.8 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.8 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.79 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.78 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.76 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.76 | |
| KOG0716|consensus | 279 | 99.75 | ||
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.75 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.75 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.74 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.74 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.73 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.73 | |
| KOG0715|consensus | 288 | 99.7 | ||
| PHA03102 | 153 | Small T antigen; Reviewed | 99.67 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.65 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.63 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.62 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.62 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.6 | |
| KOG0721|consensus | 230 | 99.58 | ||
| KOG0624|consensus | 504 | 99.5 | ||
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.48 | |
| KOG0550|consensus | 486 | 99.48 | ||
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.47 | |
| KOG0722|consensus | 329 | 99.43 | ||
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.42 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.4 | |
| KOG0720|consensus | 490 | 99.4 | ||
| KOG0714|consensus | 306 | 99.39 | ||
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.28 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.26 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.16 | |
| KOG1150|consensus | 250 | 99.09 | ||
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 99.05 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.91 | |
| KOG0568|consensus | 342 | 98.1 | ||
| KOG1789|consensus | 2235 | 98.09 | ||
| KOG0723|consensus | 112 | 97.74 | ||
| KOG3192|consensus | 168 | 96.47 | ||
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 95.98 | |
| KOG0431|consensus | 453 | 95.77 | ||
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 95.39 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 92.92 | |
| KOG0724|consensus | 335 | 89.92 |
| >KOG0719|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.6e-57 Score=391.50 Aligned_cols=237 Identities=41% Similarity=0.642 Sum_probs=215.0
Q ss_pred cchhhHHHHhcCCCCcccccccCCCCCHHHHHHHHHHHHHhhCCCCCCChhhHHHHHHHHHHHHHHHhhchhhhhhhccc
Q psy18223 2 KGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLVHSILSDVEKRKVYDQ 81 (264)
Q Consensus 2 m~l~~~~~~~~~~~d~Y~vLgv~~~as~~eIkkaYrkl~l~~HPDk~~~~~~~~a~~~F~~i~~Ay~iLsd~~kR~~YD~ 81 (264)
|..|..|...|.+.|+|+||||.++||..+|++|||+|+|.||||++++....+++++||+|+.||+||||.++|++||.
T Consensus 1 ~~~l~~~~~~f~~~d~YevLGVer~a~~~eIrkAY~klal~~HPDk~~eed~~ea~~kFq~l~k~y~iLsDeekR~~YDe 80 (264)
T KOG0719|consen 1 QFSLEECTGSFNKKDLYEVLGVERDATDKEIRKAYHKLALRLHPDKNHEEDKVEATEKFQQLQKAYQILSDEEKRAVYDE 80 (264)
T ss_pred CcchhhccccccccCHHHHhhhcccCCHHHHHHHHHHHHHHhCCCcchhhhHHHHHHHHHHHHHHHHHhhHHHHHHHHhc
Confidence 34567799999999999999999999999999999999999999999877788899999999999999999999999999
Q ss_pred cCCCCCCCchhhccCCCCHHHHHHhhccCCCHHHHHhHHHhhcCcHHHHHHHHHHHhcCCCChhhhhhccCCCCCchHHH
Q psy18223 82 TGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDR 161 (264)
Q Consensus 82 ~G~~~~~~~~~~~~~~~~~~~~f~~~F~~vt~edi~~f~~~y~gs~eE~~dl~~~y~~~~g~~~~i~~~v~~~~~~d~~R 161 (264)
+|.+++.+ .+-..+|-++|+.+|..||.++|++|...|+||++|+.||..+|++++|+|..|++.++|+.++|++|
T Consensus 81 tG~idd~~----~d~~~~~~e~~~~iyk~VteedIeef~a~Y~gSEeEk~Dl~~~Y~k~kG~m~~i~~~~l~~d~~De~R 156 (264)
T KOG0719|consen 81 TGSIDDES----GDIDEDWLEFWRAIYKKVTEEDIEEFEANYQGSEEEKKDLLKLYNKFKGKMNRILESVLCSDPKDEDR 156 (264)
T ss_pred cCCCCCcc----chhhhHHHHHHHHHHhhcccccHHHHHHHhcccHHHHHHHHHHHHhcCChHHHHHHhhhcCCcccHHH
Confidence 99998542 22358999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhhcCCCCchhhhcchhHHHHHHHhhHHHHHHhHHHHHHhhHHHHHhccCCCCCCCChHHHHHHHHHHHhchh
Q psy18223 162 YRQIIQDLIDKEEVPAFDKFLNEAKSKRNRRKRKFEKEEKLFEKEKAKDERRKKSGVRNSGADSSMDLIAAIQSKNATRE 241 (264)
Q Consensus 162 ~~~ii~~~i~~~~~~~~~~~~~e~k~~k~~r~kk~~~e~k~~eae~~~~e~~ke~~~~~~~~~~~~~L~~~i~~r~~~r~ 241 (264)
|++||+.||.+|+|+.|++|..++++. +.|..+..+|.+ +|+.+. ++ .+..+|.++|++|+..|.
T Consensus 157 ~keiid~~I~~Gev~~yK~y~~~~~~~-K~r~~~~~re~r--~ak~~~------~~------~~~~DL~~~i~~r~~eRk 221 (264)
T KOG0719|consen 157 FKEIIDEAIADGEVKKYKAYEKWASEK-KMRAPKKAREKR--EAKVLA------AK------DNGIDLDAMIEKRGGERK 221 (264)
T ss_pred HHHHHHHHHhcCCchhhhhcccchhhh-hhccccchHHHH--HHHHHH------HH------hcCccHHHHHHHHhhhhh
Confidence 999999999999999999999998766 566666667766 666643 12 134689999999999999
Q ss_pred hchhhHHHHHHHhccC
Q psy18223 242 SGFIGGIANLEAKYEL 257 (264)
Q Consensus 242 ~~~~~~~~~le~ky~~ 257 (264)
..+++||++|++||++
T Consensus 222 ~~~~sl~~SL~~kY~~ 237 (264)
T KOG0719|consen 222 GKFDSLLDSLEEKYGG 237 (264)
T ss_pred hhHHHHHHHHHHHhcc
Confidence 9999999999999986
|
|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0713|consensus | Back alignment and domain information |
|---|
| >KOG0712|consensus | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0717|consensus | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0718|consensus | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0691|consensus | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0716|consensus | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0715|consensus | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0721|consensus | Back alignment and domain information |
|---|
| >KOG0624|consensus | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0550|consensus | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0722|consensus | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0720|consensus | Back alignment and domain information |
|---|
| >KOG0714|consensus | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1150|consensus | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >KOG0568|consensus | Back alignment and domain information |
|---|
| >KOG1789|consensus | Back alignment and domain information |
|---|
| >KOG0723|consensus | Back alignment and domain information |
|---|
| >KOG3192|consensus | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0431|consensus | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >KOG0724|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 264 | ||||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 2e-11 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 7e-11 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 2e-10 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 9e-10 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 9e-10 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 1e-09 | ||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 2e-09 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 1e-08 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 3e-08 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 4e-08 | ||
| 2lgw_A | 99 | Solution Structure Of The J Domain Of Hsj1a Length | 5e-08 | ||
| 2yua_A | 99 | Solution Structure Of The Dnaj Domain From Human Wi | 2e-07 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 4e-07 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 4e-07 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 6e-07 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 3e-06 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 4e-06 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 2e-05 | ||
| 2ctq_A | 112 | Solution Structure Of J-Domain From Human Dnaj Subf | 7e-04 |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
|
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 | Back alignment and structure |
| >pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 264 | |||
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 9e-18 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 2e-17 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 4e-17 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 1e-16 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 1e-16 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 1e-16 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 2e-16 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 6e-16 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 8e-16 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 2e-15 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 2e-15 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 3e-15 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 3e-15 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 3e-15 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 6e-15 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 6e-15 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 8e-15 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 1e-14 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 1e-14 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 1e-14 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 1e-14 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 2e-14 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 2e-12 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 2e-12 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 1e-07 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 1e-07 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 2e-06 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 9e-06 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 1e-05 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 3e-05 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 6e-05 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 2e-04 |
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
Score = 77.2 bits (190), Expect = 9e-18
Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 4/90 (4%)
Query: 15 KDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDR----VTEEDKEVATEKFKILGLVHSIL 70
KD Y +L D +A +++ + KL L+ HPD+ V E +KF + IL
Sbjct: 10 KDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKIL 69
Query: 71 SDVEKRKVYDQTGTLEDEDDEAIFKSDIDW 100
+ E ++ YD +D + + +
Sbjct: 70 GNEETKREYDLQRCEDDLRNVGPVDAQVYL 99
|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 264 | |||
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.86 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.85 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.84 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.84 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.83 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.83 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.83 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.82 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.82 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.81 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.81 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.8 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.8 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.8 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.8 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.8 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.79 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.78 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.78 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.76 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.74 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.73 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.7 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.7 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.7 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.69 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.68 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.68 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.68 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.67 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.61 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.6 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.59 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.14 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.79 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 86.88 |
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
Probab=99.86 E-value=2.2e-22 Score=156.54 Aligned_cols=94 Identities=34% Similarity=0.536 Sum_probs=67.2
Q ss_pred CCCcccccccCCCCCHHHHHHHHHHHHHhhCCCCCCChhhHHHHHHHHHHHHHHHhhchhhhhhhccccCCCCCCCch--
Q psy18223 14 TKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLVHSILSDVEKRKVYDQTGTLEDEDDE-- 91 (264)
Q Consensus 14 ~~d~Y~vLgv~~~as~~eIkkaYrkl~l~~HPDk~~~~~~~~a~~~F~~i~~Ay~iLsd~~kR~~YD~~G~~~~~~~~-- 91 (264)
..|||+||||+++||.++||+|||+|+++||||+++..+ .+.+.|+.|++||+||+||.+|..||..|..+...+.
T Consensus 2 ~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~~~~--~a~~~f~~i~~Ay~~L~d~~~R~~YD~~~~~~~~~~~~~ 79 (103)
T 1bq0_A 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDK--EAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMG 79 (103)
T ss_dssp CCCSTTTTSSCSSCCHHHHHHHHHHHHTTTCTTTCTTTC--THHHHHHHHTTTTTSTTCSHHHHHTTTSTTTSSCSCC--
T ss_pred CCCHHHHcCcCCCCCHHHHHHHHHHHHHHHCcCCCCCcH--HHHHHHHHHHHHHHHHCCHHHHHHHHHHhhhhhcccCcC
Confidence 469999999999999999999999999999999997543 3789999999999999999999999999986654211
Q ss_pred -hhccCCCCHHHHHHhhcc
Q psy18223 92 -AIFKSDIDWTMYWKSLYK 109 (264)
Q Consensus 92 -~~~~~~~~~~~~f~~~F~ 109 (264)
..++...++.++|..+|+
T Consensus 80 ~~~~~~~~~~~~~f~~~f~ 98 (103)
T 1bq0_A 80 GGGFGGGADFSDIFGDVFG 98 (103)
T ss_dssp -------------------
T ss_pred CCCCCCCCCHHHHHHHHHH
Confidence 111111244556666654
|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 264 | ||||
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 9e-12 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 4e-11 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 7e-11 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 9e-11 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 1e-09 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 9e-09 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 1e-07 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 9e-07 |
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 57.8 bits (139), Expect = 9e-12
Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 4/81 (4%)
Query: 7 LCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDR----VTEEDKEVATEKFKI 62
+ + KD Y +L D +A +++ + KL L+ HPD+ V E +KF
Sbjct: 8 MALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIE 67
Query: 63 LGLVHSILSDVEKRKVYDQTG 83
+ IL + E +K YD
Sbjct: 68 IDQAWKILGNEETKKKYDLQR 88
|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 264 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.88 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.86 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.8 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.73 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.7 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.67 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.65 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.88 E-value=1.1e-23 Score=153.47 Aligned_cols=71 Identities=41% Similarity=0.649 Sum_probs=65.2
Q ss_pred CCCcccccccCCCCCHHHHHHHHHHHHHhhCCCCCCChhhHHHHHHHHHHHHHHHhhchhhhhhhccccCCCC
Q psy18223 14 TKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATEKFKILGLVHSILSDVEKRKVYDQTGTLE 86 (264)
Q Consensus 14 ~~d~Y~vLgv~~~as~~eIkkaYrkl~l~~HPDk~~~~~~~~a~~~F~~i~~Ay~iLsd~~kR~~YD~~G~~~ 86 (264)
..|||+||||+++||.++||+|||+++++||||+++.++. +.+.|+.|+.||+||+||.+|..||.+|..+
T Consensus 2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~--~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~ 72 (75)
T d1xbla_ 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKE--AEAKFKEIKEAYEVLTDSQKRAAYDQYGHAA 72 (75)
T ss_dssp CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCH--HHHHHHHHHHHHHHTTSSHHHHHHHHHTTSS
T ss_pred CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChH--HHHHHHHHHHHHHhcCCHHHHHHHHHhCccc
Confidence 4799999999999999999999999999999999875543 7788999999999999999999999999654
|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|