Psyllid ID: psy18239


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
MRIDRCQHSRKNSQTWISFGLFYSSLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFAVGYQLQIKFPPTTQQNIKWFVAAYLKGNTRRLGSICSSL
ccHHHHHHHHHHcccccEEEEEcccHHHHHHHHccEEEEEccEEEEEcccHHHHHcccccEEEEEEEccccHHHHHHHHHHHccccEEEEEEccccc
cccHHHHHHHHccccccEEEEEcccHHHHHHHHcHHEEEEcccEEEcccHHHHHHHccccEEEEEEEcccccHHHHHHHHHHccccEEEcccccccc
mridrcqhsrknsqtWISFGLFYSSLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFAVGyqlqikfppttqQNIKWFVAAYLKGNTRRLGSICSSL
mridrcqhsrknsqtwiSFGLFYSSLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFAVGYQLQIKFPPTTQQNIKWFVAAYLKGNtrrlgsicssl
MRIDRCQHSRKNSQTWISFGLFYSSLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFAVGYQLQIKFPPTTQQNIKWFVAAYLKGNTRRLGSICSSL
**************TWISFGLFYSSLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFAVGYQLQIKFPPTTQQNIKWFVAAYLKGNTRRLG******
****RCQHSRKNSQTWISFGLFYSSLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFAVGYQLQIKFPPTTQQNIKWFVAAYLKGNT*****I****
***********NSQTWISFGLFYSSLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFAVGYQLQIKFPPTTQQNIKWFVAAYLKGNTRRLGSICSSL
*RIDRCQHSRKNSQTWISFGLFYSSLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFAVGYQLQIKFPPTTQQNIKWFVAAYLKGNTRRL*******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIDRCQHSRKNSQTWISFGLFYSSLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFAVGYQLQIKFPPTTQQNIKWFVAAYLKGNTRRLGSICSSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query97 2.2.26 [Sep-21-2011]
Q8IZY22146 ATP-binding cassette sub- yes N/A 0.639 0.028 0.553 5e-15
Q7TNJ22170 ATP-binding cassette sub- yes N/A 0.402 0.017 0.666 6e-14
Q91V242159 ATP-binding cassette sub- yes N/A 0.670 0.030 0.507 1e-13
P41234 2434 ATP-binding cassette sub- no N/A 0.546 0.021 0.618 1e-13
Q9ESR9 2434 ATP-binding cassette sub- no N/A 0.515 0.020 0.615 4e-13
Q9BZC7 2435 ATP-binding cassette sub- no N/A 0.432 0.017 0.714 4e-13
P412332261 ATP-binding cassette sub- no N/A 0.432 0.018 0.690 2e-12
O954772261 ATP-binding cassette sub- no N/A 0.432 0.018 0.690 2e-12
Q8R4201704 ATP-binding cassette sub- no N/A 0.639 0.036 0.530 2e-11
Q997581704 ATP-binding cassette sub- no N/A 0.649 0.036 0.522 2e-11
>sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 Back     alignment and function desciption
 Score = 79.7 bits (195), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 43/65 (66%)

Query: 25   SLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFAVGYQLQIKFPPTTQQNIKWFVAAYLK 84
            S+EECEALC+RLA+MVNGR  CLGS QHLK +FA G+ L ++ P    Q    FVAA   
Sbjct: 1984 SMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVPAARSQPAAAFVAAEFP 2043

Query: 85   GNTRR 89
            G   R
Sbjct: 2044 GAELR 2048




Plays a role in phagocytosis by macrophages of apoptotic cells. Binds APOA1 and may function in apolipoprotein-mediated phospholipid efflux from cells. May also mediate cholesterol efflux. May regulate cellular ceramide homeostasis during keratinocytes differentiation.
Homo sapiens (taxid: 9606)
>sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 Back     alignment and function description
>sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 Back     alignment and function description
>sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 Back     alignment and function description
>sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 Back     alignment and function description
>sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 Back     alignment and function description
>sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 Back     alignment and function description
>sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 Back     alignment and function description
>sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=2 SV=3 Back     alignment and function description
>sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query97
193683404 1635 PREDICTED: ATP-binding cassette sub-fami 0.670 0.039 0.630 7e-16
395831604 2144 PREDICTED: LOW QUALITY PROTEIN: ATP-bind 0.670 0.030 0.584 5e-15
340382714 1875 PREDICTED: ATP-binding cassette sub-fami 0.639 0.033 0.6 4e-14
9211112 2146 macrophage ABC transporter [Homo sapiens 0.639 0.028 0.553 1e-13
15042034 2008 ABCA-SSN [Homo sapiens] 0.639 0.030 0.553 1e-13
12656651 2146 ABC transporter member 7 [Homo sapiens] 0.639 0.028 0.553 1e-13
426386409 2146 PREDICTED: ATP-binding cassette sub-fami 0.639 0.028 0.553 2e-13
402903531 2012 PREDICTED: ATP-binding cassette sub-fami 0.721 0.034 0.528 2e-13
109122716 2148 PREDICTED: ATP-binding cassette sub-fami 0.690 0.031 0.528 2e-13
395750079 2147 PREDICTED: ATP-binding cassette sub-fami 0.639 0.028 0.553 2e-13
>gi|193683404|ref|XP_001944057.1| PREDICTED: ATP-binding cassette sub-family A member 1-like isoform 1 [Acyrthosiphon pisum] gi|328717121|ref|XP_003246127.1| PREDICTED: ATP-binding cassette sub-family A member 1-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 87.8 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 47/65 (72%)

Query: 25   SLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFAVGYQLQIKFPPTTQQNIKWFVAAYLK 84
            SLEECEALC+RLA+MV+GRL C+GSVQHLKNKF+VGYQL IKF P      K +V     
Sbjct: 1512 SLEECEALCSRLAIMVDGRLCCIGSVQHLKNKFSVGYQLHIKFHPDNYTRAKDYVMKSFV 1571

Query: 85   GNTRR 89
            G   R
Sbjct: 1572 GANLR 1576




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|395831604|ref|XP_003788885.1| PREDICTED: LOW QUALITY PROTEIN: ATP-binding cassette sub-family A member 7 [Otolemur garnettii] Back     alignment and taxonomy information
>gi|340382714|ref|XP_003389863.1| PREDICTED: ATP-binding cassette sub-family A member 3-like [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|9211112|gb|AAF85794.1|AF250238_1 macrophage ABC transporter [Homo sapiens] Back     alignment and taxonomy information
>gi|15042034|dbj|BAB62294.1| ABCA-SSN [Homo sapiens] Back     alignment and taxonomy information
>gi|12656651|gb|AAK00959.1|AF328787_1 ABC transporter member 7 [Homo sapiens] Back     alignment and taxonomy information
>gi|426386409|ref|XP_004059677.1| PREDICTED: ATP-binding cassette sub-family A member 7 [Gorilla gorilla gorilla] Back     alignment and taxonomy information
>gi|402903531|ref|XP_003914618.1| PREDICTED: ATP-binding cassette sub-family A member 7 [Papio anubis] Back     alignment and taxonomy information
>gi|109122716|ref|XP_001093459.1| PREDICTED: ATP-binding cassette sub-family A member 7 isoform 1 [Macaca mulatta] Back     alignment and taxonomy information
>gi|395750079|ref|XP_002828412.2| PREDICTED: ATP-binding cassette sub-family A member 7 [Pongo abelii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query97
UNIPROTKB|H0YCN5591 ABCA7 "ATP-binding cassette su 0.628 0.103 0.573 5e-13
UNIPROTKB|E2R5S8 2346 ABCA2 "Uncharacterized protein 0.515 0.021 0.634 8.5e-13
MGI|MGI:99606 2434 Abca2 "ATP-binding cassette, s 0.515 0.020 0.634 1.2e-12
ZFIN|ZDB-GENE-030131-98262282 abca1b "ATP-binding cassette, 0.649 0.027 0.553 2.3e-12
RGD|620238 2434 Abca2 "ATP-binding cassette, s 0.515 0.020 0.615 2.4e-12
UNIPROTKB|Q8IZY22146 ABCA7 "ATP-binding cassette su 0.628 0.028 0.573 2.8e-12
UNIPROTKB|Q9BZC7 2435 ABCA2 "ATP-binding cassette su 0.515 0.020 0.615 3.9e-12
UNIPROTKB|J3QSS3 2436 ABCA2 "ATP-binding cassette su 0.515 0.020 0.615 3.9e-12
RGD|1561491556 Abca14 "ATP-binding cassette, 0.639 0.111 0.545 4.2e-12
UNIPROTKB|F1NYP5 2275 F1NYP5 "Uncharacterized protei 0.432 0.018 0.714 1e-11
UNIPROTKB|H0YCN5 ABCA7 "ATP-binding cassette sub-family A member 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 181 (68.8 bits), Expect = 5.0e-13, P = 5.0e-13
 Identities = 35/61 (57%), Positives = 42/61 (68%)

Query:    25 SLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFAVGYQLQIKFPPTTQQNIKWFVAAYLK 84
             S+EECEALC+RLA+MVNGR  CLGS QHLK +FA G+ L ++ P    Q    FVAA   
Sbjct:   429 SMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVPAARSQPAAAFVAAEFP 488

Query:    85 G 85
             G
Sbjct:   489 G 489




GO:0016887 "ATPase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|E2R5S8 ABCA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:99606 Abca2 "ATP-binding cassette, sub-family A (ABC1), member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9826 abca1b "ATP-binding cassette, sub-family A (ABC1), member 1B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|620238 Abca2 "ATP-binding cassette, subfamily A (ABC1), member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IZY2 ABCA7 "ATP-binding cassette sub-family A member 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BZC7 ABCA2 "ATP-binding cassette sub-family A member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3QSS3 ABCA2 "ATP-binding cassette sub-family A member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1561491 Abca14 "ATP-binding cassette, subfamily A (ABC1), member 14" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYP5 F1NYP5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q91V24ABCA7_MOUSENo assigned EC number0.50760.67010.0301yesN/A
Q8IZY2ABCA7_HUMANNo assigned EC number0.55380.63910.0288yesN/A
Q7TNJ2ABCA7_RATNo assigned EC number0.66660.40200.0179yesN/A
Q54BT5ABCA3_DICDINo assigned EC number0.51160.41230.0235yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query97
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 2e-14
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 2e-10
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 5e-04
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 0.002
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 0.003
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
 Score = 67.0 bits (163), Expect = 2e-14
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 2/46 (4%)

Query: 25   SLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFAVGY--QLQIKFP 68
            S+EECEALCTRLA+MV G   CLG++QHLK+KF  GY   ++IK P
Sbjct: 2129 SMEECEALCTRLAIMVKGAFQCLGTIQHLKSKFGDGYIVTMKIKSP 2174


This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease [Transport and binding proteins, Other]. Length = 2272

>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 97
KOG0059|consensus885 99.12
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.04
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.02
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 98.97
COG1126240 GlnQ ABC-type polar amino acid transport system, A 98.96
PRK13537306 nodulation ABC transporter NodI; Provisional 98.93
COG1123 539 ATPase components of various ABC-type transport sy 98.92
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 98.91
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.89
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 98.89
COG4586325 ABC-type uncharacterized transport system, ATPase 98.87
PRK13536340 nodulation factor exporter subunit NodI; Provision 98.86
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 98.84
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 98.81
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 98.8
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 98.79
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 98.79
PRK09473330 oppD oligopeptide transporter ATP-binding componen 98.79
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 98.78
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 98.76
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 98.76
COG1123539 ATPase components of various ABC-type transport sy 98.75
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 98.75
COG1127263 Ttg2A ABC-type transport system involved in resist 98.75
COG4152300 ABC-type uncharacterized transport system, ATPase 98.74
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 98.73
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 98.73
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 98.73
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 98.73
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 98.73
COG0411250 LivG ABC-type branched-chain amino acid transport 98.72
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 98.71
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 98.71
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 98.71
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 98.7
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 98.69
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 98.68
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 98.68
COG3842352 PotA ABC-type spermidine/putrescine transport syst 98.67
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 98.66
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 98.66
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 98.65
COG4172534 ABC-type uncharacterized transport system, duplica 98.63
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 98.63
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 98.63
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 98.62
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 98.62
COG4172 534 ABC-type uncharacterized transport system, duplica 98.61
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 98.6
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 98.6
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 98.6
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 98.59
PRK11607377 potG putrescine transporter ATP-binding subunit; P 98.58
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 98.58
PRK10619257 histidine/lysine/arginine/ornithine transporter su 98.57
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 98.57
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 98.57
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 98.57
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 98.56
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 98.55
PRK11153343 metN DL-methionine transporter ATP-binding subunit 98.55
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 98.55
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 98.55
PRK10261623 glutathione transporter ATP-binding protein; Provi 98.55
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 98.54
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 98.54
COG4559259 ABC-type hemin transport system, ATPase component 98.54
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 98.53
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 98.52
PRK03695248 vitamin B12-transporter ATPase; Provisional 98.52
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 98.52
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 98.51
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 98.51
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 98.51
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.51
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 98.5
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 98.5
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 98.5
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 98.5
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 98.49
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 98.49
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 98.48
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 98.48
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 98.48
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 98.47
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 98.47
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 98.47
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 98.46
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 98.46
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 98.46
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 98.46
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 98.46
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 98.45
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 98.45
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 98.45
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 98.45
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 98.44
PRK14239252 phosphate transporter ATP-binding protein; Provisi 98.44
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 98.44
PRK10253265 iron-enterobactin transporter ATP-binding protein; 98.44
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 98.44
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 98.43
COG1117253 PstB ABC-type phosphate transport system, ATPase c 98.43
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 98.43
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 98.43
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 98.43
PRK13546264 teichoic acids export protein ATP-binding subunit; 98.42
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 98.42
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 98.42
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 98.41
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 98.41
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 98.41
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 98.41
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 98.41
COG3638258 ABC-type phosphate/phosphonate transport system, A 98.4
PRK10261 623 glutathione transporter ATP-binding protein; Provi 98.4
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 98.4
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 98.4
PRK14242253 phosphate transporter ATP-binding protein; Provisi 98.4
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 98.4
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 98.4
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 98.4
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 98.39
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 98.39
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 98.39
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 98.39
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 98.39
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 98.38
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 98.38
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 98.38
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 98.38
PRK14238271 phosphate transporter ATP-binding protein; Provisi 98.37
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 98.37
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 98.37
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 98.36
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 98.36
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 98.36
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 98.36
PRK14240250 phosphate transporter ATP-binding protein; Provisi 98.36
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 98.36
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 98.36
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 98.36
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 98.35
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 98.35
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 98.35
PRK09984262 phosphonate/organophosphate ester transporter subu 98.35
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 98.35
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 98.34
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 98.34
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 98.34
cd03299235 ABC_ModC_like Archeal protein closely related to M 98.33
COG4598256 HisP ABC-type histidine transport system, ATPase c 98.33
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 98.33
PRK10938 490 putative molybdenum transport ATP-binding protein 98.32
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 98.32
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 98.32
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 98.31
PRK14235267 phosphate transporter ATP-binding protein; Provisi 98.31
PRK14236272 phosphate transporter ATP-binding protein; Provisi 98.31
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 98.3
PRK14237267 phosphate transporter ATP-binding protein; Provisi 98.3
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 98.3
PRK11288501 araG L-arabinose transporter ATP-binding protein; 98.3
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 98.3
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 98.3
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 98.3
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 98.3
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 98.3
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 98.29
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 98.27
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 98.27
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 98.27
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 98.27
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 98.26
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 98.26
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 98.26
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 98.26
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 98.26
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 98.26
COG0410237 LivF ABC-type branched-chain amino acid transport 98.26
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 98.26
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 98.25
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 98.25
PRK09580248 sufC cysteine desulfurase ATPase component; Review 98.25
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 98.25
PRK10762501 D-ribose transporter ATP binding protein; Provisio 98.25
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 98.25
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 98.24
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 98.24
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 98.24
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 98.24
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 98.24
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 98.24
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 98.23
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 98.23
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 98.23
cd03216163 ABC_Carb_Monos_I This family represents the domain 98.23
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 98.23
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 98.23
PRK14243264 phosphate transporter ATP-binding protein; Provisi 98.22
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 98.22
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 98.21
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 98.21
cd03269210 ABC_putative_ATPase This subfamily is involved in 98.21
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 98.2
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 98.2
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 98.2
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 98.2
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 98.19
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 98.18
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 98.17
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 98.17
PRK14241258 phosphate transporter ATP-binding protein; Provisi 98.17
COG4148352 ModC ABC-type molybdate transport system, ATPase c 98.17
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 98.16
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 98.15
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 98.13
PRK09700510 D-allose transporter ATP-binding protein; Provisio 98.13
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 98.12
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 98.12
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 98.11
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 98.11
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 98.11
PLN03211 659 ABC transporter G-25; Provisional 98.11
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 98.1
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 98.1
PRK10908222 cell division protein FtsE; Provisional 98.1
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 98.09
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 98.09
cd03234226 ABCG_White The White subfamily represents ABC tran 98.09
COG4987573 CydC ABC-type transport system involved in cytochr 98.08
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 98.07
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 98.06
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 98.06
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 98.06
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 98.06
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 98.04
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 98.04
cd03215182 ABC_Carb_Monos_II This family represents domain II 98.04
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 98.04
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 98.03
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 98.01
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 98.01
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 98.0
COG4674249 Uncharacterized ABC-type transport system, ATPase 98.0
PRK15064 530 ABC transporter ATP-binding protein; Provisional 98.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 97.99
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 97.94
PRK15064530 ABC transporter ATP-binding protein; Provisional 97.94
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.94
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 97.93
COG4988559 CydD ABC-type transport system involved in cytochr 97.9
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 97.89
cd03246173 ABCC_Protease_Secretion This family represents the 97.89
COG1136226 SalX ABC-type antimicrobial peptide transport syst 97.88
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 97.88
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 97.88
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 97.86
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 97.86
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 97.86
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 97.85
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 97.84
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 97.84
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 97.83
COG4181228 Predicted ABC-type transport system involved in ly 97.82
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 97.82
COG3845 501 ABC-type uncharacterized transport systems, ATPase 97.8
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 97.79
COG1129500 MglA ABC-type sugar transport system, ATPase compo 97.79
PRK10790592 putative multidrug transporter membrane\ATP-bindin 97.78
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 97.77
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 97.76
PRK10636638 putative ABC transporter ATP-binding protein; Prov 97.75
PLN032321495 ABC transporter C family member; Provisional 97.75
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 97.75
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 97.75
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 97.74
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 97.74
PLN03130 1622 ABC transporter C family member; Provisional 97.73
COG1101263 PhnK ABC-type uncharacterized transport system, AT 97.72
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 97.72
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 97.71
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 97.7
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 97.7
COG4167267 SapF ABC-type antimicrobial peptide transport syst 97.7
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.69
PTZ002431560 ABC transporter; Provisional 97.69
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 97.67
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 97.67
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 97.66
PRK10789569 putative multidrug transporter membrane\ATP-bindin 97.66
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 97.66
COG2884223 FtsE Predicted ATPase involved in cell division [C 97.66
PLN03073718 ABC transporter F family; Provisional 97.65
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 97.65
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 97.65
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 97.64
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 97.63
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 97.62
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 97.61
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.61
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 97.59
COG4161242 ArtP ABC-type arginine transport system, ATPase co 97.59
PLN03140 1470 ABC transporter G family member; Provisional 97.58
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.58
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 97.57
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 97.56
PRK10535 648 macrolide transporter ATP-binding /permease protei 97.56
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 97.55
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.54
COG3845501 ABC-type uncharacterized transport systems, ATPase 97.54
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 97.54
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.51
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 97.5
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 97.5
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 97.49
KOG0055|consensus 1228 97.48
PRK11147 635 ABC transporter ATPase component; Reviewed 97.48
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 97.45
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 97.44
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 97.44
PLN03073 718 ABC transporter F family; Provisional 97.42
PRK00635 1809 excinuclease ABC subunit A; Provisional 97.42
PRK10938490 putative molybdenum transport ATP-binding protein 97.42
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 97.38
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 97.37
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 97.33
COG4618580 ArpD ABC-type protease/lipase transport system, AT 97.32
PRK11819556 putative ABC transporter ATP-binding protein; Revi 97.3
PLN03140 1470 ABC transporter G family member; Provisional 97.3
KOG0054|consensus 1381 97.29
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.29
PRK00635 1809 excinuclease ABC subunit A; Provisional 97.28
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.26
PRK13409590 putative ATPase RIL; Provisional 97.25
KOG0057|consensus591 97.23
COG4170330 SapD ABC-type antimicrobial peptide transport syst 97.22
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 97.2
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 97.19
PTZ00243 1560 ABC transporter; Provisional 97.17
PLN03232 1495 ABC transporter C family member; Provisional 97.17
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 97.16
KOG0055|consensus1228 97.13
PLN03130 1622 ABC transporter C family member; Provisional 97.11
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 97.05
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 97.05
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 96.97
PRK11147635 ABC transporter ATPase component; Reviewed 96.97
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 96.91
PTZ002651466 multidrug resistance protein (mdr1); Provisional 96.85
PRK13409 590 putative ATPase RIL; Provisional 96.8
KOG0061|consensus 613 96.77
KOG0058|consensus716 96.77
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 96.76
KOG0054|consensus1381 96.66
COG4525259 TauB ABC-type taurine transport system, ATPase com 96.61
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, 96.56
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 96.54
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 96.49
PRK10522547 multidrug transporter membrane component/ATP-bindi 96.4
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 96.38
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 96.17
COG1119257 ModF ABC-type molybdenum transport system, ATPase 96.15
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 96.09
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 95.89
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 95.8
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 95.71
COG0488 530 Uup ATPase components of ABC transporters with dup 95.68
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 95.66
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 95.34
COG0488530 Uup ATPase components of ABC transporters with dup 95.27
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 95.24
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 95.12
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 95.1
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 94.91
TIGR00634563 recN DNA repair protein RecN. All proteins in this 94.86
cd03239178 ABC_SMC_head The structural maintenance of chromos 94.78
KOG0056|consensus790 94.72
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 94.59
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 94.33
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 94.27
PRK07721438 fliI flagellum-specific ATP synthase; Validated 94.22
COG4619223 ABC-type uncharacterized transport system, ATPase 94.05
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 94.04
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 93.95
KOG0062|consensus582 93.68
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 93.53
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 93.52
KOG2355|consensus291 93.51
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 93.48
COG4615546 PvdE ABC-type siderophore export system, fused ATP 93.15
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 93.05
PRK13830818 conjugal transfer protein TrbE; Provisional 92.97
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 92.49
PRK10869553 recombination and repair protein; Provisional 92.41
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 91.56
PRK03918880 chromosome segregation protein; Provisional 91.06
PRK13695174 putative NTPase; Provisional 90.93
cd01124187 KaiC KaiC is a circadian clock protein primarily f 90.39
KOG0059|consensus 885 89.62
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 88.79
PHA02562562 46 endonuclease subunit; Provisional 88.67
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 88.54
KOG0065|consensus 1391 87.71
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 87.44
PRK02224880 chromosome segregation protein; Provisional 86.73
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 85.72
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 85.21
KOG0927|consensus 614 84.16
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 83.82
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 83.81
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 83.46
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 82.52
KOG0065|consensus 1391 81.09
>KOG0059|consensus Back     alignment and domain information
Probab=99.12  E-value=3.1e-10  Score=87.19  Aligned_cols=84  Identities=30%  Similarity=0.502  Sum_probs=74.2

Q ss_pred             hhhhhhhccCCcEEEEEeCCHHHHHhhcCeEEEEeCCEEeEecChHHHHHhhcCceEEEEEeCCCch-hHHHHHHHhhhc
Q psy18239          6 CQHSRKNSQTWISFGLFYSSLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFAVGYQLQIKFPPTTQ-QNIKWFVAAYLK   84 (97)
Q Consensus         6 ~~~~~~~~~~~~tiii~tH~~~~~~~~~d~i~~l~~G~i~~~g~~~~l~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~   84 (97)
                      +......+++|+++|++||.|++++.+|||+++|.+|++.+.|+++++..+++..|.+.+.+....+ ..+..+++..+|
T Consensus       738 W~ii~~~~k~g~aiiLTSHsMeE~EaLCtR~aImv~G~l~ciGs~q~LKsrfG~gy~l~~~~~~~~~~~~v~~~~~~~~p  817 (885)
T KOG0059|consen  738 WDIIARLRKNGKAIILTSHSMEEAEALCTRTAIMVIGQLRCIGSPQELKSRYGSGYTLTVRIKELPEVSEVEKLLQNRFP  817 (885)
T ss_pred             HHHHHHHHhcCCEEEEEcCCHHHHHHHhhhhheeecCeeEEecChHHHHhhcCCcEEEEEEECCCcccchHHHHHHHhCC
Confidence            3345556666669999999999999999999999999999999999999999999999999998776 588889999999


Q ss_pred             cceee
Q psy18239         85 GNTRR   89 (97)
Q Consensus        85 ~~~~~   89 (97)
                      ++..+
T Consensus       818 ~a~~~  822 (885)
T KOG0059|consen  818 GAVLK  822 (885)
T ss_pred             Ccchh
Confidence            98754



>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>KOG0061|consensus Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>KOG2355|consensus Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>PRK13830 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>KOG0059|consensus Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query97
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 3e-07
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
 Score = 45.2 bits (108), Expect = 3e-07
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 22  FYSS--LEECEALCTRLAVMVNGRLSCLGSVQHLKNKF 57
             SS  + E E LC R+A++ NG +   G+V+ LK ++
Sbjct: 200 LVSSHNMLEVEFLCDRIALIHNGTIVETGTVEELKERY 237


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query97
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 98.88
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 98.87
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 98.82
1b0u_A262 Histidine permease; ABC transporter, transport pro 98.8
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 98.79
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 98.78
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 98.76
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 98.76
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 98.75
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 98.75
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 98.75
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 98.75
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 98.74
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 98.73
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 98.73
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 98.72
1ji0_A240 ABC transporter; ATP binding protein, structural g 98.72
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 98.63
1g6h_A257 High-affinity branched-chain amino acid transport 98.62
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 98.62
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 98.57
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 98.53
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 98.51
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 98.47
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 98.47
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 98.45
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 98.43
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 98.43
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 98.43
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 98.42
2ghi_A260 Transport protein; multidrug resistance protein, M 98.34
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 98.33
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 98.26
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 98.25
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 98.23
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 98.21
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 98.2
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 98.18
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 98.16
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 98.15
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 98.14
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 98.14
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 98.13
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 98.12
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 98.11
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 98.09
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 98.06
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 98.05
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 97.97
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 97.95
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 97.95
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 97.95
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 97.89
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 97.89
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 97.87
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.79
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 97.75
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 97.72
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 97.7
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 97.64
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 97.64
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 97.54
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 97.45
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 97.38
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 97.36
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 97.36
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 97.21
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 97.16
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.14
4aby_A415 DNA repair protein RECN; hydrolase, double strand 97.14
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.94
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 96.61
1sgw_A214 Putative ABC transporter; structural genomics, P p 96.44
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 96.4
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 96.37
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 96.09
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 95.71
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 95.68
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 95.55
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.46
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 95.44
4a74_A231 DNA repair and recombination protein RADA; hydrola 94.99
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 94.77
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.73
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 94.37
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 94.16
1e69_A322 Chromosome segregation SMC protein; structural mai 93.76
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 93.68
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 91.31
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 91.17
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 90.33
2cvh_A220 DNA repair and recombination protein RADB; filamen 89.5
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 86.03
3kta_B173 Chromosome segregation protein SMC; structural mai 85.14
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 84.68
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 84.36
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 83.0
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 82.94
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 82.92
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 82.39
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
Probab=98.88  E-value=2.2e-09  Score=74.57  Aligned_cols=51  Identities=16%  Similarity=0.244  Sum_probs=44.1

Q ss_pred             hhhhhhhcc-CCcEEEEEeCCHHHHHhhcCeEEEEeCCEEeEecChHHHHHh
Q psy18239          6 CQHSRKNSQ-TWISFGLFYSSLEECEALCTRLAVMVNGRLSCLGSVQHLKNK   56 (97)
Q Consensus         6 ~~~~~~~~~-~~~tiii~tH~~~~~~~~~d~i~~l~~G~i~~~g~~~~l~~~   56 (97)
                      ...++++.+ .|.|+|++||+++++..+|||+++|++|+++..|++.+++..
T Consensus       203 ~~lL~~l~~~~g~Tii~vTHdl~~~~~~aDrv~vl~~G~iv~~g~~~ev~~~  254 (366)
T 3tui_C          203 LELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSEVFSH  254 (366)
T ss_dssp             HHHHHHHHHHSCCEEEEEESCHHHHHHHCSEEEEEETTEEEECCBHHHHHSS
T ss_pred             HHHHHHHHHhCCCEEEEEecCHHHHHHhCCEEEEEECCEEEEEcCHHHHHhC
Confidence            445566654 489999999999999999999999999999999999998654



>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 97
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 1e-05
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 0.004
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative ABC transporter TM0544
species: Thermotoga maritima [TaxId: 2336]
 Score = 39.6 bits (92), Expect = 1e-05
 Identities = 14/58 (24%), Positives = 31/58 (53%)

Query: 1   MRIDRCQHSRKNSQTWISFGLFYSSLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFA 58
              +  +  ++ SQ  ++  +   ++ E E LC R+A++ NG +   G+V+ LK ++ 
Sbjct: 168 NAREVRKILKQASQEGLTILVSSHNMLEVEFLCDRIALIHNGTIVETGTVEELKERYK 225


>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query97
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.26
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.25
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.25
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.21
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.21
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.2
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.19
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.15
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.15
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.07
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.07
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.04
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 98.88
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 98.85
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 98.84
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 98.82
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 98.82
d2hyda1255 Putative multidrug export ATP-binding/permease pro 98.68
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 98.67
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.48
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.97
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 83.79
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 83.45
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: ATP-binding subunit of the histidine permease
species: Salmonella typhimurium [TaxId: 90371]
Probab=99.26  E-value=3.9e-12  Score=83.15  Aligned_cols=53  Identities=4%  Similarity=0.053  Sum_probs=47.1

Q ss_pred             hhhhhhhccCCcEEEEEeCCHHHHHhhcCeEEEEeCCEEeEecChHHHHHhhc
Q psy18239          6 CQHSRKNSQTWISFGLFYSSLEECEALCTRLAVMVNGRLSCLGSVQHLKNKFA   58 (97)
Q Consensus         6 ~~~~~~~~~~~~tiii~tH~~~~~~~~~d~i~~l~~G~i~~~g~~~~l~~~~~   58 (97)
                      ...++++.++|.|+|++|||++++..+|||+++|.+|++++.|++++++.++.
T Consensus       189 ~~ll~~l~~~g~til~vtHdl~~~~~~adri~vm~~G~iv~~g~~~ev~~~P~  241 (258)
T d1b0ua_         189 LRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVFGNPQ  241 (258)
T ss_dssp             HHHHHHHHHTTCCEEEECSCHHHHHHHCSEEEEEETTEEEEEECHHHHHHSCC
T ss_pred             HHhhhhhcccCCceEEEeCCHHHHHHhCCEEEEEECCEEEEEcCHHHHHhCCC
Confidence            44566677779999999999999999999999999999999999999987654



>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure