Psyllid ID: psy1895

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MTSGGLKRSFDDHVKMNKIAEHVKDNVSDDKYKESELALEELGAQLSKSKLQVSDLMEEHQIAKRATEAQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVEKLTVVNS
cccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccc
ccHHHccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHccHHcccccccHHHccEccccccEcccccccEEccccccEEcHHHccEEEccccccccEEEcHHHHHHHccccccccc
mtsgglkrsfddHVKMNKIAEHvkdnvsddkykESELALEELGAQLSKSKLQVSDLMEEHQIAKRATEAQWAKDKeaitcracdkeftvtrrrhhcrncgeifcnmcsdnkmalpsaakpvrvcdECNVKLVEKLTVVNS
mtsgglkrsfddhVKMNKIaehvkdnvsddkYKESELALEELGAQLSKSKLQVSDLMEEHQIAKRateaqwakdkeaitcracdkeftvtrrrhhCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVekltvvns
MTSGGLKRSFDDHVKMNKIAEHVKDNVSDDKYKESELALEELGAQLSKSKLQVSDLMEEHQIAKRATEAQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVEKLTVVNS
********************************************************************AQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVEKLTV***
************************DN****KYKE**LAL*******************************WAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNK******AK**RVCDECNV***********
MTSGGLKRSFDDHVKMNKIAEHVKDNVSDDKYKESELALEELGAQLSKSKLQVSDLMEEHQIAKRATEAQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVEKLTVVNS
*****LKRSFDDHVKMNKIAEHVKDNVSDDKYKESELALEELGAQLSKSKLQVSDLMEEHQIAKRATEAQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVE*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSGGLKRSFDDHVKMNKIAEHVKDNVSDDKYKESELAxxxxxxxxxxxxxxxxxxxxxHQIAKRATEAQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVEKLTVVNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query140 2.2.26 [Sep-21-2011]
Q8WXA3655 RUN and FYVE domain-conta yes N/A 0.707 0.151 0.548 2e-29
Q5R5R4606 RUN and FYVE domain-conta yes N/A 0.707 0.163 0.548 2e-29
Q8R4C2606 RUN and FYVE domain-conta yes N/A 0.707 0.163 0.528 8e-29
Q96T51708 RUN and FYVE domain-conta no N/A 0.707 0.139 0.539 9e-28
Q8BIJ7712 RUN and FYVE domain-conta no N/A 0.707 0.139 0.519 8e-27
Q150751411 Early endosome antigen 1 no N/A 0.407 0.040 0.596 4e-16
Q8BL661411 Early endosome antigen 1 no N/A 0.407 0.040 0.578 3e-15
B4JHI71115 Lateral signaling target N/A N/A 0.457 0.057 0.484 2e-13
B3MT31985 Lateral signaling target N/A N/A 0.442 0.062 0.5 2e-13
Q7ZUV1247 Pleckstrin homology domai no N/A 0.607 0.344 0.443 4e-13
>sp|Q8WXA3|RUFY2_HUMAN RUN and FYVE domain-containing protein 2 OS=Homo sapiens GN=RUFY2 PE=1 SV=2 Back     alignment and function desciption
 Score =  127 bits (319), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 57/104 (54%), Positives = 79/104 (75%), Gaps = 5/104 (4%)

Query: 32  YKESELALEELGAQLSKSKLQVSDLMEEHQIAKRATEAQ-WAKDKEAITCRACDKEFTVT 90
           Y E E AL+ELG +LS+SKL++ D+ E    A +A +   W KDKEA  C+ C+KEF+++
Sbjct: 550 YHEQEQALQELGNKLSESKLKIEDIKE----ANKALQGLVWLKDKEATHCKLCEKEFSLS 605

Query: 91  RRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVEK 134
           +R+HHCRNCGEIFCN CSDN++ LPS+ KPVRVCD C+  L+++
Sbjct: 606 KRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDSCHALLIQR 649

Homo sapiens (taxid: 9606)
>sp|Q5R5R4|RUFY2_PONAB RUN and FYVE domain-containing protein 2 OS=Pongo abelii GN=RUFY2 PE=2 SV=1 Back     alignment and function description
>sp|Q8R4C2|RUFY2_MOUSE RUN and FYVE domain-containing protein 2 OS=Mus musculus GN=Rufy2 PE=1 SV=2 Back     alignment and function description
>sp|Q96T51|RUFY1_HUMAN RUN and FYVE domain-containing protein 1 OS=Homo sapiens GN=RUFY1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BIJ7|RUFY1_MOUSE RUN and FYVE domain-containing protein 1 OS=Mus musculus GN=Rufy1 PE=1 SV=1 Back     alignment and function description
>sp|Q15075|EEA1_HUMAN Early endosome antigen 1 OS=Homo sapiens GN=EEA1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BL66|EEA1_MOUSE Early endosome antigen 1 OS=Mus musculus GN=Eea1 PE=1 SV=2 Back     alignment and function description
>sp|B4JHI7|LST2_DROGR Lateral signaling target protein 2 homolog OS=Drosophila grimshawi GN=GH18624 PE=3 SV=1 Back     alignment and function description
>sp|B3MT31|LST2_DROAN Lateral signaling target protein 2 homolog OS=Drosophila ananassae GN=GF22946 PE=3 SV=1 Back     alignment and function description
>sp|Q7ZUV1|PKHF2_DANRE Pleckstrin homology domain-containing family F member 2 OS=Danio rerio GN=plekhf2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
270001487203 hypothetical protein TcasGA2_TC000322 [T 0.764 0.527 0.642 3e-33
189234819 668 PREDICTED: similar to CG31064 CG31064-PB 0.778 0.163 0.621 7e-33
242022089 875 RUN and FYVE domain-containing protein, 0.907 0.145 0.560 1e-32
427792271 643 Putative run domain-containing protein, 0.935 0.203 0.522 2e-30
443713932171 hypothetical protein CAPTEDRAFT_90657 [C 0.721 0.590 0.625 3e-29
328710229 653 PREDICTED: RUN and FYVE domain-containin 0.75 0.160 0.558 9e-28
431904170 615 RUN and FYVE domain-containing protein 2 0.707 0.160 0.548 1e-27
395501408 622 PREDICTED: RUN and FYVE domain-containin 0.707 0.159 0.528 1e-27
354477696 683 PREDICTED: RUN and FYVE domain-containin 0.75 0.153 0.508 1e-27
332218599 488 PREDICTED: RUN and FYVE domain-containin 0.707 0.202 0.548 1e-27
>gi|270001487|gb|EEZ97934.1| hypothetical protein TcasGA2_TC000322 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 82/109 (75%), Gaps = 2/109 (1%)

Query: 30  DKYKESELALEELGAQLSKSKLQVSDLMEEHQIAKRATEAQWAKDKEAITCRACDKEFTV 89
           DK  E E  LEELG QLSKSKLQ+SDL EE    K  T+  W +DK A  C+AC KEF +
Sbjct: 97  DKCLEQEQTLEELGTQLSKSKLQISDLKEEASRGK--TDGAWVQDKTATHCKACSKEFNL 154

Query: 90  TRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVEKLTVV 138
           TRRRHHCRNCG+IFCN CSDN M+LPS+AKPVRVCD+C+  L+ K TV+
Sbjct: 155 TRRRHHCRNCGDIFCNACSDNSMSLPSSAKPVRVCDDCHTMLMGKYTVM 203

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189234819|ref|XP_970297.2| PREDICTED: similar to CG31064 CG31064-PB [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242022089|ref|XP_002431474.1| RUN and FYVE domain-containing protein, putative [Pediculus humanus corporis] gi|212516762|gb|EEB18736.1| RUN and FYVE domain-containing protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|427792271|gb|JAA61587.1| Putative run domain-containing protein, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|443713932|gb|ELU06545.1| hypothetical protein CAPTEDRAFT_90657 [Capitella teleta] Back     alignment and taxonomy information
>gi|328710229|ref|XP_001949954.2| PREDICTED: RUN and FYVE domain-containing protein 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|431904170|gb|ELK09592.1| RUN and FYVE domain-containing protein 2 [Pteropus alecto] Back     alignment and taxonomy information
>gi|395501408|ref|XP_003755087.1| PREDICTED: RUN and FYVE domain-containing protein 2, partial [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|354477696|ref|XP_003501055.1| PREDICTED: RUN and FYVE domain-containing protein 2-like [Cricetulus griseus] Back     alignment and taxonomy information
>gi|332218599|ref|XP_003258442.1| PREDICTED: RUN and FYVE domain-containing protein 2 [Nomascus leucogenys] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
UNIPROTKB|F1PXC3606 RUFY2 "Uncharacterized protein 0.892 0.206 0.462 1.7e-28
UNIPROTKB|F1PXD5641 RUFY2 "Uncharacterized protein 0.892 0.195 0.462 2.1e-28
UNIPROTKB|H0YD93620 RUFY2 "RUN and FYVE domain-con 0.707 0.159 0.548 2.4e-28
UNIPROTKB|Q8WXA3655 RUFY2 "RUN and FYVE domain-con 0.707 0.151 0.548 2.8e-28
UNIPROTKB|F1SUI7656 RUFY2 "Uncharacterized protein 0.707 0.150 0.548 2.9e-28
MGI|MGI:1917682606 Rufy2 "RUN and FYVE domain-con 0.707 0.163 0.528 3.6e-28
UNIPROTKB|F1MEH0550 RUFY2 "Uncharacterized protein 0.728 0.185 0.533 5.2e-28
UNIPROTKB|F1P364607 RUFY2 "Uncharacterized protein 0.7 0.161 0.533 6e-28
ZFIN|ZDB-GENE-070424-66698 rufy2 "RUN and FYVE domain con 0.714 0.143 0.539 7.2e-28
UNIPROTKB|H9KZT3332 Gga.53772 "Uncharacterized pro 0.707 0.298 0.529 1.3e-27
UNIPROTKB|F1PXC3 RUFY2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 324 (119.1 bits), Expect = 1.7e-28, P = 1.7e-28
 Identities = 61/132 (46%), Positives = 89/132 (67%)

Query:     6 LKRSFDDHVKMNKIAEHVKDNVSDDK--YKESELALEELGAQLSKSKLQVSDLMEEHQIA 63
             L+      + + K   +++D     K  Y E E AL+ELG +LS+SKL++ D+ E    A
Sbjct:   473 LRNETQQIISLKKEFLNIQDENQQLKKIYHEQEQALQELGNKLSESKLKIEDIKE----A 528

Query:    64 KRATEAQ-WAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVR 122
              +A +   W KDKEA  C+ C+KEF++++R+HHCRNCGEIFCN CSDN++ LPS+ KPVR
Sbjct:   529 NKALQGLVWLKDKEATHCKLCEKEFSLSKRKHHCRNCGEIFCNACSDNELPLPSSPKPVR 588

Query:   123 VCDECNVKLVEK 134
             VCD C+  L+++
Sbjct:   589 VCDSCHALLIQR 600
GO:0046872 "metal ion binding" evidence=IEA
UNIPROTKB|F1PXD5 RUFY2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H0YD93 RUFY2 "RUN and FYVE domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WXA3 RUFY2 "RUN and FYVE domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SUI7 RUFY2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1917682 Rufy2 "RUN and FYVE domain-containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MEH0 RUFY2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P364 RUFY2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070424-66 rufy2 "RUN and FYVE domain containing 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZT3 Gga.53772 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5R5R4RUFY2_PONABNo assigned EC number0.54800.70710.1633yesN/A
Q8WXA3RUFY2_HUMANNo assigned EC number0.54800.70710.1511yesN/A
Q8R4C2RUFY2_MOUSENo assigned EC number0.52880.70710.1633yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
pfam0136368 pfam01363, FYVE, FYVE zinc finger 3e-23
smart0006468 smart00064, FYVE, Protein present in Fab1, YOTB, V 1e-22
cd0006557 cd00065, FYVE, FYVE domain; Zinc-binding domain; t 4e-19
PTZ00303 1374 PTZ00303, PTZ00303, phosphatidylinositol kinase; P 9e-05
>gnl|CDD|216454 pfam01363, FYVE, FYVE zinc finger Back     alignment and domain information 
 Score = 85.9 bits (213), Expect = 3e-23
 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 69  AQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAA---KPVRVCD 125
            +W  D +   C  C K F+  RRRHHCRNCG++FC+ CS  K+AL       KPVRVCD
Sbjct: 1   PRWVPDSDVTNCMGCGKPFSFFRRRHHCRNCGKVFCSSCSSKKIALLPKLGINKPVRVCD 60

Query: 126 ECNVKL 131
           +C  KL
Sbjct: 61  DCYDKL 66

The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn++ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. We have included members which do not conserve these histidine residues but are clearly related. Length = 68
>gnl|CDD|214499 smart00064, FYVE, Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
>gnl|CDD|238022 cd00065, FYVE, FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; Back     alignment and domain information
>gnl|CDD|140324 PTZ00303, PTZ00303, phosphatidylinositol kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 140
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 99.85
smart0006468 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 99.79
KOG1729|consensus288 99.71
KOG1818|consensus 634 99.6
cd0006557 FYVE FYVE domain; Zinc-binding domain; targets pro 99.58
PTZ00303 1374 phosphatidylinositol kinase; Provisional 99.56
KOG1819|consensus990 99.52
KOG1842|consensus 505 99.38
KOG1841|consensus 1287 99.1
KOG1843|consensus 473 98.58
KOG1409|consensus404 98.45
KOG4424|consensus 623 98.3
PF02318118 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 97.9
KOG1811|consensus 1141 97.57
KOG0230|consensus 1598 97.32
KOG0230|consensus 1598 96.84
KOG0993|consensus542 95.53
KOG1841|consensus 1287 94.42
KOG1729|consensus 288 93.04
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 91.88
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 91.59
KOG4275|consensus 350 90.6
KOG3799|consensus169 88.89
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 88.37
PF1463444 zf-RING_5: zinc-RING finger domain 87.56
PRK00464154 nrdR transcriptional regulator NrdR; Validated 87.4
PF1371736 zinc_ribbon_4: zinc-ribbon domain 86.6
smart0015439 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C 86.27
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 85.77
PF1371937 zinc_ribbon_5: zinc-ribbon domain 85.73
KOG2164|consensus 513 84.48
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 83.46
KOG0320|consensus187 82.72
KOG3576|consensus267 82.44
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 80.72
PF1277350 DZR: Double zinc ribbon 80.25
>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information 
Probab=99.85  E-value=2.1e-22  Score=130.89  Aligned_cols=64  Identities=50%  Similarity=1.155  Sum_probs=47.8

Q ss_pred             CccccCcCCccccccccccccccccccccccCceEeCCCCCCeeeCC----CCCCCcccCcccHHHhh
Q psy1895          69 AQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALP----SAAKPVRVCDECNVKLV  132 (140)
Q Consensus        69 ~~W~~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp----~~~~~~RVC~~C~~~l~  132 (140)
                      |.|+||.++..|+.|+++|++++||||||.||.+||+.|+.+.+++|    ....++|||+.||..|+
T Consensus         1 ~~W~~d~~~~~C~~C~~~F~~~~rrhhCr~CG~~vC~~Cs~~~~~~~~~~~~~~~~~RvC~~C~~~~~   68 (69)
T PF01363_consen    1 PHWVPDSEASNCMICGKKFSLFRRRHHCRNCGRVVCSSCSSQRIPLPTPSSGSGEPVRVCDSCYSKLQ   68 (69)
T ss_dssp             --SSSGGG-SB-TTT--B-BSSS-EEE-TTT--EEECCCS-EEEEET--GGTESEEEEE-HHHHHHHH
T ss_pred             CCcCCCCCCCcCcCcCCcCCCceeeEccCCCCCEECCchhCCEEcccccccCCCCcCEECHHHHHHhc
Confidence            68999999999999999999999999999999999999999999888    23899999999999875

Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
>KOG1729|consensus Back     alignment and domain information
>KOG1818|consensus Back     alignment and domain information
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; Back     alignment and domain information
>PTZ00303 phosphatidylinositol kinase; Provisional Back     alignment and domain information
>KOG1819|consensus Back     alignment and domain information
>KOG1842|consensus Back     alignment and domain information
>KOG1841|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>PF02318 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A Back     alignment and domain information
>KOG1811|consensus Back     alignment and domain information
>KOG0230|consensus Back     alignment and domain information
>KOG0230|consensus Back     alignment and domain information
>KOG0993|consensus Back     alignment and domain information
>KOG1841|consensus Back     alignment and domain information
>KOG1729|consensus Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>KOG3799|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>smart00154 ZnF_AN1 AN1-like Zinc finger Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
2yqm_A89 Solution Structure Of The Fyve Domain In Zinc Finge 2e-22
2yw8_A82 Crystal Structure Of Human Run And Fyve Domain-Cont 4e-22
1joc_A125 Eea1 Homodimer Of C-Terminal Fyve Domain Bound To I 1e-16
1hyi_A65 Solution Structure Of The Eea1 Fyve Domain Complexe 1e-14
1z2q_A84 High-Resolution Solution Structure Of The Lm5-1 Fyv 2e-12
1dvp_A220 Crystal Structure Of The Vhs And Fyve Tandem Domain 8e-12
3t7l_A90 Crystal Structure Of The Fyve Domain Of Endofin (Zf 1e-10
1vfy_A73 Phosphatidylinositol-3-Phosphate Binding Fyve Domai 1e-09
3zyq_A226 Crystal Structure Of The Tandem Vhs And Fyve Domain 2e-08
3mpx_A434 Crystal Structure Of The Dh And Ph-1 Domains Of Hum 1e-06
1wfk_A88 Fyve Domain Of Fyve Domain Containing 19 Protein Fr 3e-04
>pdb|2YQM|A Chain A, Solution Structure Of The Fyve Domain In Zinc Finger Fyve Domain-Containing Protein 12 Length = 89 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (250), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 41/70 (58%), Positives = 53/70 (75%)
Query: 71  WAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVK 130
           W KD EA  CR C+KEF+++RR+HHCRNCG IFCN CS N++ALPS  KPVRVCD C+  
Sbjct: 20  WLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTL 79
Query: 131 LVEKLTVVNS 140
           L+++ +   S
Sbjct: 80  LLQRCSSTAS 89
>pdb|2YW8|A Chain A, Crystal Structure Of Human Run And Fyve Domain-Containing Protein Length = 82 Back     alignment and structure
>pdb|1JOC|A Chain A, Eea1 Homodimer Of C-Terminal Fyve Domain Bound To Inositol 1,3-Diphosphate Length = 125 Back     alignment and structure
>pdb|1HYI|A Chain A, Solution Structure Of The Eea1 Fyve Domain Complexed With Inositol 1,3-Bisphosphate Length = 65 Back     alignment and structure
>pdb|1Z2Q|A Chain A, High-Resolution Solution Structure Of The Lm5-1 Fyve Domain From Leishmania Major Length = 84 Back     alignment and structure
>pdb|1DVP|A Chain A, Crystal Structure Of The Vhs And Fyve Tandem Domains Of Hrs, A Protein Involved In Membrane Trafficking And Signal Transduction Length = 220 Back     alignment and structure
>pdb|3T7L|A Chain A, Crystal Structure Of The Fyve Domain Of Endofin (Zfyve16) At 1.1a Resolution Length = 90 Back     alignment and structure
>pdb|1VFY|A Chain A, Phosphatidylinositol-3-Phosphate Binding Fyve Domain Of Vps27p Protein From Saccharomyces Cerevisiae Length = 73 Back     alignment and structure
>pdb|3ZYQ|A Chain A, Crystal Structure Of The Tandem Vhs And Fyve Domains Of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) At 1.48 A Resolution Length = 226 Back     alignment and structure
>pdb|3MPX|A Chain A, Crystal Structure Of The Dh And Ph-1 Domains Of Human Fgd5 Length = 434 Back     alignment and structure
>pdb|1WFK|A Chain A, Fyve Domain Of Fyve Domain Containing 19 Protein From Mus Musculus Length = 88 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 2e-30
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 7e-29
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 1e-28
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 3e-28
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 1e-25
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 1e-24
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 3e-24
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 7e-23
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 2e-22
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 6e-18
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 2e-14
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 4e-09
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 3e-07
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Length = 82 Back     alignment and structure
 Score =  104 bits (260), Expect = 2e-30
 Identities = 41/75 (54%), Positives = 53/75 (70%)

Query: 66  ATEAQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCD 125
                W KD EA  CR C+KEF+++RR+HHCRNCG IFCN CS N++ALPS  KPVRVCD
Sbjct: 8   LKGHAWLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCD 67

Query: 126 ECNVKLVEKLTVVNS 140
            C+  L+++ +   S
Sbjct: 68  SCHTLLLQRCSSTAS 82
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Length = 84 Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Length = 125 Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Length = 90 Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Length = 73 Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Length = 88 Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Length = 220 Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Length = 226 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Length = 120 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 99.92
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 99.92
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 99.9
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 99.89
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 99.88
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 99.85
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 99.82
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 99.79
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 99.79
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 99.75
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 99.73
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 97.97
1zbd_B134 Rabphilin-3A; G protein, effector, RABCDR, synapti 97.57
2zet_C153 Melanophilin; complex, GTP-binding protein, GTPase 97.46
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 95.77
2csz_A76 Synaptotagmin-like protein 4; exophilin 2, granuph 95.27
1wff_A85 Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc 94.35
1wfh_A64 Zinc finger (AN1-like) family protein; ZF-AN1 doma 94.14
2ecm_A55 Ring finger and CHY zinc finger domain- containing 93.24
1wg2_A64 Zinc finger (AN1-like) family protein; riken struc 93.08
1wfl_A74 Zinc finger protein 216; ZF-AN1 domain, zinc bindi 92.74
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 92.38
2a20_A62 Regulating synaptic membrane exocytosis protein 2; 92.37
1wfp_A74 Zinc finger (AN1-like) family protein; ZF-AN1 doma 91.91
1z60_A59 TFIIH basal transcription factor complex P44 subun 91.54
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 90.81
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 90.48
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 90.34
2ect_A78 Ring finger protein 126; metal binding protein, st 90.32
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 90.04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 89.3
2e72_A49 POGO transposable element with ZNF domain; zinc fi 89.0
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 88.83
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 88.72
2ysl_A73 Tripartite motif-containing protein 31; ring-type 88.0
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 87.8
1x4w_A67 Hypothetical protein FLJ13222; ZF-AN1 domain, zinc 87.03
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 85.18
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 84.7
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 84.45
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 83.56
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 83.5
2ysj_A63 Tripartite motif-containing protein 31; ring-type 81.76
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 81.18
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 80.83
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 80.29
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure
Probab=99.92  E-value=1.5e-26  Score=154.94  Aligned_cols=73  Identities=56%  Similarity=1.185  Sum_probs=60.2

Q ss_pred             CCccccCcCCccccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHHhhccccCCCC
Q psy1895          68 EAQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVEKLTVVNS  140 (140)
Q Consensus        68 ~~~W~~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~~~~~~~~s  140 (140)
                      .+.|+||+++..|+.|+++|++++||||||+||+|||+.|+.++++||...+|+|||+.||..|.++++++++
T Consensus        10 ~~~W~~d~~~~~C~~C~~~Fs~~~RrHHCR~CG~v~C~~Cs~~~~~l~~~~~~~RVC~~C~~~l~~~~~~~~~   82 (82)
T 2yw8_A           10 GHAWLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS   82 (82)
T ss_dssp             -----CCCCCCBCTTTCCBCBTTBCCEECTTTCCEECSGGGCEEECCTTCSSCEEECHHHHHHTTC-------
T ss_pred             CCccccCccCCcccCcCCcccCccccccCCCCCCEEChHHhCCeeecCCCCCcCEECHHHHHHHHHhccccCC
Confidence            3899999999999999999999999999999999999999999999999999999999999999998887764
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1 Back     alignment and structure
>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2csz_A Synaptotagmin-like protein 4; exophilin 2, granuphilin, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2a20_A Regulating synaptic membrane exocytosis protein 2; zinc-finger domain, metal binding protein; NMR {Rattus norvegicus} PDB: 2cjs_C Back     alignment and structure
>1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4w_A Hypothetical protein FLJ13222; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 140
d1joca164 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) 5e-19
d1wfka_88 g.50.1.1 (A:) Zinc finger FYVE domain containing p 2e-17
d1dvpa272 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila me 4e-16
d1vfya_67 g.50.1.1 (A:) vps27p protein {Baker's yeast (Sacch 1e-14
d1y02a251 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger pro 2e-13
d1zbdb_124 g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat 3e-10
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: FYVE, a phosphatidylinositol-3-phosphate binding domain
domain: Eea1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 73.2 bits (179), Expect = 5e-19
 Identities = 35/61 (57%), Positives = 38/61 (62%)

Query: 71  WAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVK 130
           WA+D E   C AC K F+VT RRHHCR CG IFC  CS      PS+ KPVRVCD C   
Sbjct: 2   WAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFND 61

Query: 131 L 131
           L
Sbjct: 62  L 62
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 72 Back     information, alignment and structure
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 99.84
d1vfya_67 vps27p protein {Baker's yeast (Saccharomyces cerev 99.81
d1wfka_88 Zinc finger FYVE domain containing protein 19 {Mou 99.79
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 99.6
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 99.28
d1wfha_64 Zinc finger A20 and AN1 domains containing protein 94.34
d1wfla_74 Zinc finger A20 domain containing protein 2 {Mouse 94.33
d1wffa_85 ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus 93.67
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 92.27
d1wfpa_74 Zinc finger A20 and AN1 domains containing protein 91.31
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 90.69
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 87.67
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 85.15
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 81.87
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 80.1
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 80.03
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: FYVE, a phosphatidylinositol-3-phosphate binding domain
domain: Eea1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.90  E-value=2.8e-25  Score=141.03  Aligned_cols=64  Identities=55%  Similarity=1.105  Sum_probs=61.5

Q ss_pred             ccccCcCCccccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHHhhc
Q psy1895          70 QWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVE  133 (140)
Q Consensus        70 ~W~~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~~  133 (140)
                      .|+||+++..|+.|+++|+++.||||||+||.|||+.|+++++++|....|+|||+.||..|.+
T Consensus         1 rW~~d~~~~~C~~C~~~F~~~~rrHHCR~CG~v~C~~Cs~~~~~~~~~~~~~RVC~~C~~~l~G   64 (64)
T d1joca1           1 KWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG   64 (64)
T ss_dssp             CCCCGGGCCBCTTTCCBCCSSSCCEECTTTCCEECGGGSCEEECCTTCSSCEEECHHHHHHTTC
T ss_pred             CCCCcccCCcCcCcCCcccCCccccchhhhCCeecccccCCceecCCCCCccEehHHHHHHhcC
Confidence            5999999999999999999999999999999999999999999999999999999999999864
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure