Psyllid ID: psy1940


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------
MLYLQCSQDLSSTELSSSSSPVTINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVELRRGSDPATLYW
cEEEEcccccEEEEcccccccEEEccccccEEEEEEcccccEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEc
cEEEEEcccccccccccccccEEEEccccHHEEEEEcccccEEEEEccccEEEEEEEcccccEEEEEEccccccEEEc
mlylqcsqdlsstelssssspvtiNAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVElrrgsdpatlyw
MLYLQCSqdlsstelssssspVTINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLkkvqlvelrrgsdpatlyw
MLYLQCsqdlsstelsssssPVTINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVELRRGSDPATLYW
****************************SELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVELR**********
*LYLQCSQDLSSTELSSSSSPVTINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVELRRGSDPATLYW
***********************INAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVELRRGSDPATLYW
MLYLQCSQDLSSTELSSSSSPVTINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVELRRGSDPATLYW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLYLQCSQDLSSTELSSSSSPVTINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVELRRGSDPATLYW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query78 2.2.26 [Sep-21-2011]
Q7ZUX3 358 WD repeat domain phosphoi yes N/A 0.884 0.192 0.681 5e-22
Q6DCV0 355 WD repeat domain phosphoi N/A N/A 0.884 0.194 0.681 2e-21
Q9Y484 360 WD repeat domain phosphoi yes N/A 0.884 0.191 0.666 3e-21
Q91VM3 360 WD repeat domain phosphoi yes N/A 0.884 0.191 0.666 3e-21
Q5R7W0 344 WD repeat domain phosphoi no N/A 0.833 0.188 0.550 2e-12
Q9CR39 344 WD repeat domain phosphoi no N/A 0.833 0.188 0.550 2e-12
Q5MNZ6 344 WD repeat domain phosphoi no N/A 0.833 0.188 0.550 2e-12
Q640T2 344 WD repeat domain phosphoi no N/A 0.833 0.188 0.550 2e-12
Q68F45 344 WD repeat domain phosphoi N/A N/A 0.833 0.188 0.550 2e-12
Q5ZL16 344 WD repeat domain phosphoi yes N/A 0.833 0.188 0.536 6e-12
>sp|Q7ZUX3|WIPI4_DANRE WD repeat domain phosphoinositide-interacting protein 4 OS=Danio rerio GN=wdr45 PE=2 SV=1 Back     alignment and function desciption
 Score =  102 bits (255), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 47/69 (68%), Positives = 61/69 (88%)

Query: 9   DLSSTELSSSSSPVTINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVELR 68
           DLS+T+  +SS+P TINAHQSE+ACLALNQ G+++A+AS KGTLIR++DT  + +LVELR
Sbjct: 171 DLSNTKPGTSSAPFTINAHQSEIACLALNQPGSVVASASRKGTLIRLFDTTTRDKLVELR 230

Query: 69  RGSDPATLY 77
           RG+DPATLY
Sbjct: 231 RGTDPATLY 239





Danio rerio (taxid: 7955)
>sp|Q6DCV0|WIPI4_XENLA WD repeat domain phosphoinositide-interacting protein 4 OS=Xenopus laevis GN=wdr45 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y484|WIPI4_HUMAN WD repeat domain phosphoinositide-interacting protein 4 OS=Homo sapiens GN=WDR45 PE=2 SV=1 Back     alignment and function description
>sp|Q91VM3|WIPI4_MOUSE WD repeat domain phosphoinositide-interacting protein 4 OS=Mus musculus GN=Wdr45 PE=2 SV=1 Back     alignment and function description
>sp|Q5R7W0|WIPI3_PONAB WD repeat domain phosphoinositide-interacting protein 3 OS=Pongo abelii GN=WDR45B PE=2 SV=1 Back     alignment and function description
>sp|Q9CR39|WIPI3_MOUSE WD repeat domain phosphoinositide-interacting protein 3 OS=Mus musculus GN=Wdr45b PE=2 SV=2 Back     alignment and function description
>sp|Q5MNZ6|WIPI3_HUMAN WD repeat domain phosphoinositide-interacting protein 3 OS=Homo sapiens GN=WDR45B PE=2 SV=2 Back     alignment and function description
>sp|Q640T2|WIPI3_XENTR WD repeat domain phosphoinositide-interacting protein 3 OS=Xenopus tropicalis GN=wdr45b PE=2 SV=1 Back     alignment and function description
>sp|Q68F45|WIPI3_XENLA WD repeat domain phosphoinositide-interacting protein 3 OS=Xenopus laevis GN=wdr45b PE=2 SV=1 Back     alignment and function description
>sp|Q5ZL16|WIPI3_CHICK WD repeat domain phosphoinositide-interacting protein 3 OS=Gallus gallus GN=WDR45B PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query78
242006835 379 WD repeat domain phosphoinositide-intera 0.884 0.182 0.797 8e-25
442762509 337 Hypothetical protein, partial [Ixodes ri 0.884 0.204 0.797 9e-23
321478800 348 hypothetical protein DAPPUDRAFT_190531 [ 0.884 0.198 0.753 1e-21
196476718 228 WD repeat domain 45-like protein [Amblyo 0.897 0.307 0.728 3e-21
346470733 346 hypothetical protein [Amblyomma maculatu 0.884 0.199 0.753 6e-21
327282229 358 PREDICTED: WD repeat domain phosphoinosi 0.884 0.192 0.695 8e-21
427778677 385 Hypothetical protein [Rhipicephalus pulc 0.948 0.192 0.689 1e-20
307170168 345 WD repeat domain phosphoinositide-intera 0.884 0.2 0.681 2e-20
345324568 222 PREDICTED: WD repeat domain phosphoinosi 0.884 0.310 0.681 2e-20
146332319 189 WD repeat domain phosphoinositide intera 0.884 0.365 0.681 2e-20
>gi|242006835|ref|XP_002424250.1| WD repeat domain phosphoinositide-interacting protein, putative [Pediculus humanus corporis] gi|212507619|gb|EEB11512.1| WD repeat domain phosphoinositide-interacting protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 55/69 (79%), Positives = 63/69 (91%)

Query: 9   DLSSTELSSSSSPVTINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVELR 68
           DL STE+ +SS+PVTINAHQ ELACLA++Q GTM+ATAS+KGTLIRVWDT+KK  LVELR
Sbjct: 168 DLGSTEIGTSSAPVTINAHQGELACLAVSQQGTMVATASTKGTLIRVWDTVKKALLVELR 227

Query: 69  RGSDPATLY 77
           RGSDPATLY
Sbjct: 228 RGSDPATLY 236




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|442762509|gb|JAA73413.1| Hypothetical protein, partial [Ixodes ricinus] Back     alignment and taxonomy information
>gi|321478800|gb|EFX89757.1| hypothetical protein DAPPUDRAFT_190531 [Daphnia pulex] Back     alignment and taxonomy information
>gi|196476718|gb|ACG76224.1| WD repeat domain 45-like protein [Amblyomma americanum] Back     alignment and taxonomy information
>gi|346470733|gb|AEO35211.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|327282229|ref|XP_003225846.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 4-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|427778677|gb|JAA54790.1| Hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|307170168|gb|EFN62575.1| WD repeat domain phosphoinositide-interacting protein 4 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345324568|ref|XP_003430832.1| PREDICTED: WD repeat domain phosphoinositide-interacting protein 4-like [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|146332319|gb|ABQ22665.1| WD repeat domain phosphoinositide interacting protein 4-like protein [Callithrix jacchus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query78
UNIPROTKB|Q5M8E0 329 wdr45 "WD repeat domain 45" [X 0.730 0.173 0.736 5.8e-18
UNIPROTKB|C9JYH8 325 WDR45 "WD repeat domain 45, is 0.730 0.175 0.701 1.6e-17
ZFIN|ZDB-GENE-040426-990 358 wdr45 "WD repeat domain 45" [D 0.730 0.159 0.719 3.1e-17
UNIPROTKB|Q9Y484 360 WDR45 "WD repeat domain phosph 0.730 0.158 0.701 3.2e-17
UNIPROTKB|Q0IIH0 360 WDR45 "WD repeat domain 45" [B 0.730 0.158 0.701 4.2e-17
MGI|MGI:1859606 360 Wdr45 "WD repeat domain 45" [M 0.730 0.158 0.701 4.2e-17
UNIPROTKB|Q5MNZ6 344 WDR45B "WD repeat domain phosp 0.730 0.165 0.578 5.2e-11
MGI|MGI:1914090 344 Wdr45b "WD repeat domain 45B" 0.730 0.165 0.578 5.2e-11
RGD|1305141 344 Wdr45b "WD repeat domain 45B" 0.730 0.165 0.578 5.2e-11
UNIPROTKB|Q5ZL16 344 WDR45B "WD repeat domain phosp 0.730 0.165 0.578 6.7e-11
UNIPROTKB|Q5M8E0 wdr45 "WD repeat domain 45" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
 Score = 218 (81.8 bits), Expect = 5.8e-18, P = 5.8e-18
 Identities = 42/57 (73%), Positives = 50/57 (87%)

Query:    21 PVTINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVELRRGSDPATLY 77
             P TINAHQSEL CLA+NQ GT++A+AS KGTLIR++DT  + QLVELRRG+DPATLY
Sbjct:   154 PFTINAHQSELGCLAVNQQGTLVASASRKGTLIRLFDTQTREQLVELRRGTDPATLY 210




GO:0000045 "autophagic vacuole assembly" evidence=IBA
GO:0005737 "cytoplasm" evidence=IBA
GO:0032266 "phosphatidylinositol-3-phosphate binding" evidence=IBA
GO:0080025 "phosphatidylinositol-3,5-bisphosphate binding" evidence=IBA
UNIPROTKB|C9JYH8 WDR45 "WD repeat domain 45, isoform CRA_e" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-990 wdr45 "WD repeat domain 45" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y484 WDR45 "WD repeat domain phosphoinositide-interacting protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IIH0 WDR45 "WD repeat domain 45" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1859606 Wdr45 "WD repeat domain 45" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5MNZ6 WDR45B "WD repeat domain phosphoinositide-interacting protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914090 Wdr45b "WD repeat domain 45B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305141 Wdr45b "WD repeat domain 45B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZL16 WDR45B "WD repeat domain phosphoinositide-interacting protein 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q91VM3WIPI4_MOUSENo assigned EC number0.66660.88460.1916yesN/A
Q7ZUX3WIPI4_DANRENo assigned EC number0.68110.88460.1927yesN/A
Q9Y484WIPI4_HUMANNo assigned EC number0.66660.88460.1916yesN/A
Q9HDZ7ATG18_SCHPONo assigned EC number0.51850.69230.1447yesN/A
Q6C044ATG18_YARLINo assigned EC number0.51850.69230.135yesN/A
A2RAG5ATG18_ASPNCNo assigned EC number0.53700.69230.1301yesN/A
Q5BH53ATG18_EMENINo assigned EC number0.51850.69230.1258yesN/A
Q6BUX9HSV2_DEBHANo assigned EC number0.50940.67940.1226yesN/A
Q5ZL16WIPI3_CHICKNo assigned EC number0.53620.83330.1889yesN/A
Q2U6D5ATG18_ASPORNo assigned EC number0.53700.69230.1307yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query78
smart0032040 smart00320, WD40, WD40 repeats 2e-04
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 2e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-04
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 0.002
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 0.002
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
 Score = 35.0 bits (81), Expect = 2e-04
 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 23 TINAHQSELACLALNQTGTMIATASSKGTLIRVWD 57
          T+  H   +  +A +  G  +A+ S  GT I++WD
Sbjct: 7  TLKGHTGPVTSVAFSPDGKYLASGSDDGT-IKLWD 40


Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain. Length = 40

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 78
KOG0271|consensus 480 99.58
KOG0272|consensus459 99.56
KOG0263|consensus707 99.55
KOG2110|consensus 391 99.49
KOG0266|consensus 456 99.48
KOG0273|consensus524 99.47
KOG0269|consensus 839 99.38
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.38
KOG0295|consensus406 99.36
KOG2111|consensus 346 99.33
PTZ00421 493 coronin; Provisional 99.33
KOG0272|consensus 459 99.31
KOG0315|consensus 311 99.31
KOG0271|consensus480 99.31
KOG0286|consensus343 99.29
KOG0264|consensus422 99.29
KOG0286|consensus 343 99.28
KOG0291|consensus 893 99.23
KOG0279|consensus315 99.22
KOG0266|consensus 456 99.21
KOG0282|consensus 503 99.19
PTZ00421 493 coronin; Provisional 99.17
KOG0319|consensus 775 99.16
KOG0284|consensus 464 99.14
KOG0289|consensus506 99.13
KOG1407|consensus313 99.12
PTZ00420 568 coronin; Provisional 99.12
PLN00181 793 protein SPA1-RELATED; Provisional 99.11
KOG1273|consensus 405 99.11
KOG0316|consensus 307 99.1
KOG0318|consensus 603 99.1
KOG0302|consensus440 99.09
KOG0645|consensus 312 99.08
KOG0285|consensus 460 99.08
KOG0315|consensus311 99.08
KOG0263|consensus 707 99.07
KOG0308|consensus 735 99.06
KOG0265|consensus 338 99.06
KOG0647|consensus 347 99.05
KOG1539|consensus 910 99.04
KOG0285|consensus 460 99.04
KOG0296|consensus 399 99.03
PTZ00420 568 coronin; Provisional 99.02
KOG0649|consensus 325 99.01
KOG0639|consensus 705 99.0
KOG0278|consensus334 98.97
KOG0319|consensus 775 98.97
KOG0281|consensus 499 98.96
KOG0316|consensus 307 98.96
KOG0279|consensus 315 98.96
KOG0267|consensus 825 98.94
KOG0274|consensus 537 98.94
KOG1445|consensus 1012 98.93
KOG0277|consensus311 98.92
KOG0265|consensus338 98.92
KOG0303|consensus 472 98.92
KOG0274|consensus 537 98.92
KOG0643|consensus 327 98.91
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 98.9
KOG0293|consensus 519 98.9
KOG4283|consensus 397 98.89
KOG0306|consensus 888 98.89
KOG0275|consensus 508 98.88
KOG0291|consensus 893 98.88
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 98.88
KOG0273|consensus 524 98.87
KOG0276|consensus 794 98.87
KOG0650|consensus 733 98.87
KOG0284|consensus 464 98.86
KOG1446|consensus 311 98.84
KOG0292|consensus 1202 98.83
KOG0264|consensus422 98.83
KOG1407|consensus313 98.81
KOG0277|consensus 311 98.8
KOG0275|consensus 508 98.79
KOG0281|consensus499 98.78
KOG0302|consensus440 98.78
KOG0276|consensus 794 98.77
KOG2394|consensus 636 98.77
KOG0310|consensus 487 98.76
KOG0283|consensus 712 98.76
KOG0645|consensus 312 98.76
KOG0307|consensus 1049 98.72
KOG0294|consensus 362 98.72
KOG0288|consensus459 98.71
KOG0310|consensus 487 98.71
KOG2096|consensus 420 98.7
KOG0772|consensus 641 98.69
KOG0295|consensus 406 98.69
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.68
KOG0296|consensus 399 98.67
KOG0305|consensus484 98.66
PLN00181793 protein SPA1-RELATED; Provisional 98.65
KOG0305|consensus 484 98.65
KOG0283|consensus 712 98.64
KOG1332|consensus 299 98.62
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.62
KOG1034|consensus 385 98.62
KOG0293|consensus 519 98.61
KOG0639|consensus 705 98.61
KOG0647|consensus 347 98.6
KOG0313|consensus423 98.6
KOG0278|consensus 334 98.58
KOG0282|consensus 503 98.58
KOG0268|consensus 433 98.57
KOG0646|consensus 476 98.57
KOG0308|consensus 735 98.57
KOG0640|consensus 430 98.55
KOG0270|consensus 463 98.55
KOG0318|consensus 603 98.55
KOG0973|consensus 942 98.53
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.53
KOG1034|consensus 385 98.5
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.5
KOG1274|consensus 933 98.48
KOG0300|consensus481 98.47
KOG0299|consensus 479 98.47
KOG0267|consensus 825 98.46
KOG0641|consensus350 98.45
KOG1272|consensus 545 98.45
KOG0289|consensus 506 98.44
KOG0294|consensus 362 98.44
KOG0290|consensus364 98.42
KOG0642|consensus 577 98.42
KOG1007|consensus 370 98.41
KOG0268|consensus 433 98.4
KOG1538|consensus 1081 98.4
KOG0643|consensus327 98.39
KOG1445|consensus 1012 98.38
KOG0313|consensus423 98.37
KOG1009|consensus 434 98.37
KOG1446|consensus 311 98.36
KOG0646|consensus 476 98.36
KOG0771|consensus 398 98.35
KOG0299|consensus 479 98.34
KOG0640|consensus430 98.34
KOG0269|consensus 839 98.33
KOG0292|consensus 1202 98.32
KOG0290|consensus 364 98.31
KOG2096|consensus420 98.3
KOG2139|consensus 445 98.29
KOG0641|consensus350 98.29
KOG0306|consensus 888 98.28
KOG0300|consensus 481 98.27
KOG1310|consensus 758 98.27
KOG2048|consensus 691 98.23
COG2319 466 FOG: WD40 repeat [General function prediction only 98.2
KOG0973|consensus 942 98.19
KOG1188|consensus 376 98.18
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.18
KOG0288|consensus 459 98.18
KOG4328|consensus498 98.16
KOG0322|consensus323 98.14
KOG1009|consensus 434 98.13
KOG1273|consensus 405 98.11
COG2319 466 FOG: WD40 repeat [General function prediction only 98.1
KOG1063|consensus 764 98.1
KOG2445|consensus 361 98.1
KOG0303|consensus 472 98.07
KOG0270|consensus 463 98.05
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.03
KOG1332|consensus 299 98.02
KOG1408|consensus 1080 98.02
KOG0974|consensus 967 98.01
KOG2111|consensus346 98.0
KOG1036|consensus323 97.96
KOG4378|consensus 673 97.96
KOG0301|consensus 745 97.95
KOG1007|consensus370 97.95
KOG1524|consensus 737 97.94
KOG0772|consensus 641 97.93
KOG1188|consensus 376 97.93
KOG2394|consensus 636 97.91
KOG1036|consensus 323 97.87
KOG4547|consensus 541 97.85
KOG0301|consensus 745 97.84
KOG1274|consensus 933 97.83
KOG1524|consensus 737 97.83
KOG4328|consensus 498 97.82
KOG1408|consensus 1080 97.81
KOG4283|consensus 397 97.73
KOG4714|consensus319 97.71
KOG2919|consensus406 97.67
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.67
KOG0644|consensus 1113 97.66
KOG0644|consensus 1113 97.66
KOG0322|consensus323 97.65
KOG1063|consensus 764 97.64
KOG4640|consensus 665 97.63
KOG2919|consensus 406 97.63
KOG0321|consensus 720 97.62
KOG3881|consensus412 97.58
KOG4497|consensus 447 97.57
KOG1539|consensus 910 97.56
PRK01742 429 tolB translocation protein TolB; Provisional 97.52
KOG1587|consensus 555 97.5
KOG2106|consensus 626 97.5
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.48
KOG3881|consensus 412 97.46
KOG0307|consensus 1049 97.45
KOG2695|consensus425 97.44
KOG1912|consensus 1062 97.4
KOG1538|consensus 1081 97.32
KOG0280|consensus339 97.31
KOG2139|consensus 445 97.31
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.29
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 97.28
KOG3914|consensus 390 97.25
KOG0321|consensus 720 97.23
KOG4378|consensus 673 97.23
KOG2445|consensus361 97.2
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.19
PRK05137 435 tolB translocation protein TolB; Provisional 97.19
KOG2079|consensus 1206 97.17
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 97.15
PF15492 282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.14
KOG2321|consensus 703 97.11
KOG0649|consensus 325 97.09
KOG1645|consensus 463 97.07
KOG2695|consensus425 97.05
KOG1963|consensus 792 97.0
KOG4227|consensus 609 96.98
KOG1409|consensus 404 96.97
PRK01742 429 tolB translocation protein TolB; Provisional 96.95
PRK04922 433 tolB translocation protein TolB; Provisional 96.95
KOG2048|consensus 691 96.86
PRK02889 427 tolB translocation protein TolB; Provisional 96.85
KOG1334|consensus 559 96.85
KOG0771|consensus398 96.84
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 96.84
KOG2110|consensus 391 96.8
KOG0642|consensus577 96.79
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.69
KOG2055|consensus 514 96.66
TIGR02800 417 propeller_TolB tol-pal system beta propeller repea 96.64
KOG1240|consensus 1431 96.63
KOG0280|consensus 339 96.62
KOG1645|consensus 463 96.61
KOG1523|consensus 361 96.58
PRK03629 429 tolB translocation protein TolB; Provisional 96.56
KOG1064|consensus2439 96.49
KOG1310|consensus 758 96.47
KOG1523|consensus 361 96.46
PRK03629 429 tolB translocation protein TolB; Provisional 96.46
PRK05137 435 tolB translocation protein TolB; Provisional 96.38
PRK11028330 6-phosphogluconolactonase; Provisional 96.37
KOG2106|consensus 626 96.33
KOG1587|consensus 555 96.32
KOG3914|consensus 390 96.31
PF07433 305 DUF1513: Protein of unknown function (DUF1513); In 96.3
PRK04922 433 tolB translocation protein TolB; Provisional 96.23
KOG1963|consensus 792 96.16
PRK00178 430 tolB translocation protein TolB; Provisional 96.16
KOG0974|consensus 967 96.12
KOG2315|consensus 566 96.11
PRK02889 427 tolB translocation protein TolB; Provisional 96.03
KOG1832|consensus 1516 96.01
KOG4532|consensus344 96.01
PRK01029428 tolB translocation protein TolB; Provisional 96.0
PRK11028 330 6-phosphogluconolactonase; Provisional 95.92
PRK00178 430 tolB translocation protein TolB; Provisional 95.87
KOG4547|consensus 541 95.79
KOG0650|consensus733 95.73
KOG4190|consensus 1034 95.73
KOG1517|consensus1387 95.6
KOG2055|consensus 514 95.6
KOG2315|consensus 566 95.57
TIGR02800 417 propeller_TolB tol-pal system beta propeller repea 95.55
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 95.55
KOG4190|consensus 1034 95.53
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 95.49
KOG2321|consensus 703 95.33
PRK04792 448 tolB translocation protein TolB; Provisional 95.07
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 95.02
KOG4227|consensus 609 95.01
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.01
PRK01029428 tolB translocation protein TolB; Provisional 94.9
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 94.85
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 94.74
KOG1517|consensus 1387 94.63
PRK04792 448 tolB translocation protein TolB; Provisional 94.6
COG4946 668 Uncharacterized protein related to the periplasmic 94.54
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 94.52
KOG0882|consensus 558 94.26
KOG2314|consensus 698 93.97
KOG0309|consensus 1081 93.9
KOG0309|consensus 1081 93.75
KOG4497|consensus447 93.71
KOG1409|consensus404 93.7
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 93.58
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 93.56
KOG1240|consensus 1431 93.31
KOG1354|consensus 433 92.89
KOG3621|consensus 726 92.86
KOG1916|consensus 1283 92.77
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 92.74
PF06977 248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 92.69
KOG1334|consensus 559 92.68
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 92.64
PRK02888 635 nitrous-oxide reductase; Validated 92.53
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 92.51
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 92.47
KOG1354|consensus 433 92.42
KOG3617|consensus 1416 92.37
KOG1275|consensus 1118 92.29
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 92.28
KOG2314|consensus 698 92.23
PRK04043 419 tolB translocation protein TolB; Provisional 92.08
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 91.91
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 91.72
KOG2066|consensus 846 91.6
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 91.32
KOG4532|consensus344 91.2
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.72
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 90.65
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 90.54
KOG1064|consensus2439 90.5
KOG2041|consensus 1189 89.68
COG3204 316 Uncharacterized protein conserved in bacteria [Fun 89.6
KOG2066|consensus 846 89.59
COG4946 668 Uncharacterized protein related to the periplasmic 89.32
KOG4499|consensus310 89.05
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 88.72
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 88.15
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 87.95
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 86.92
KOG1272|consensus 545 86.76
KOG1912|consensus 1062 86.41
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 86.25
KOG2377|consensus 657 86.06
COG3386307 Gluconolactonase [Carbohydrate transport and metab 85.83
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 85.74
PF13360 238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 85.69
KOG0882|consensus 558 85.59
PF14269 299 Arylsulfotran_2: Arylsulfotransferase (ASST) 85.58
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 84.88
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 83.33
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 83.33
COG3490 366 Uncharacterized protein conserved in bacteria [Fun 83.19
KOG2109|consensus 788 82.27
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 81.61
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 80.99
KOG2114|consensus 933 80.83
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 80.67
KOG1275|consensus 1118 80.09
>KOG0271|consensus Back     alignment and domain information
Probab=99.58  E-value=4.9e-15  Score=95.89  Aligned_cols=69  Identities=30%  Similarity=0.489  Sum_probs=62.7

Q ss_pred             eeeeEEEcccCCcCCCCCcEEecCCccCEEEEEECCCCCEEEEEcCCCCEEEEeeCCCCcEE-EEeeCCCCCeE-EeC
Q psy1940           3 YLQCSQDLSSTELSSSSSPVTINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQL-VELRRGSDPAT-LYW   78 (78)
Q Consensus         3 ~~~~i~d~~~~~~~~~~~~~~~~~h~~~i~~v~fs~dg~~l~s~~~d~~~i~i~d~~~~~~~-~~~~~~~~~~~-~~w   78 (78)
                      .+. +||+....     +.++..+|.+.|.||+|+|||+.||+|+.||+ |++||..+|+++ ..+++|.+.++ |+|
T Consensus       138 TvR-~WD~~TeT-----p~~t~KgH~~WVlcvawsPDgk~iASG~~dg~-I~lwdpktg~~~g~~l~gH~K~It~Law  208 (480)
T KOG0271|consen  138 TVR-LWDLDTET-----PLFTCKGHKNWVLCVAWSPDGKKIASGSKDGS-IRLWDPKTGQQIGRALRGHKKWITALAW  208 (480)
T ss_pred             eEE-eeccCCCC-----cceeecCCccEEEEEEECCCcchhhccccCCe-EEEecCCCCCcccccccCcccceeEEee
Confidence            356 89998877     89999999999999999999999999999999 999999998766 88899999887 777



>KOG0272|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2109|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query78
4av8_A 339 Kluyveromyces Lactis Hsv2 Complete Loop 6cd Length 5e-06
3vu4_A 355 Crystal Structure Of Kluyvelomyces Marxianus Hsv2 L 2e-05
>pdb|4AV8|A Chain A, Kluyveromyces Lactis Hsv2 Complete Loop 6cd Length = 339 Back     alignment and structure

Iteration: 1

Score = 46.2 bits (108), Expect = 5e-06, Method: Composition-based stats. Identities = 23/55 (41%), Positives = 33/55 (60%) Query: 22 VTINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVELRRGSDPATL 76 V + AH + + + LN+ G M+AT S GTLIRV+ T V + E RRG D ++ Sbjct: 173 VLVKAHANPVKMVRLNRKGDMVATCSQDGTLIRVFQTDNGVLVREFRRGLDRTSI 227
>pdb|3VU4|A Chain A, Crystal Structure Of Kluyvelomyces Marxianus Hsv2 Length = 355 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query78
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 3e-20
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 9e-04
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 2e-04
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 4e-04
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 6e-04
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 8e-04
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 8e-04
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
 Score = 80.8 bits (199), Expect = 3e-20
 Identities = 25/71 (35%), Positives = 37/71 (52%)

Query: 7   SQDLSSTELSSSSSPVTINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVE 66
           +QD    + +     V I AH + +  + LN+   M+AT S  GT+IRV+ T   V + E
Sbjct: 174 TQDQGVQQKAILGKGVLIKAHTNPIKMVRLNRKSDMVATCSQDGTIIRVFKTEDGVLVRE 233

Query: 67  LRRGSDPATLY 77
            RRG D A + 
Sbjct: 234 FRRGLDRADVV 244


>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query78
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 99.53
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.51
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.49
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.47
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.47
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.46
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.45
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 99.44
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.43
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.43
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.43
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.43
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.42
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 99.42
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.42
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 99.42
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 99.41
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.4
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 99.4
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.39
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.39
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.39
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 99.39
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.38
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.38
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.37
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.37
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.36
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.36
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 99.35
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.35
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.34
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 99.34
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.34
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.33
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.32
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.32
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.31
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 99.31
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.31
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.31
2pm7_B 297 Protein transport protein SEC13, protein transport 99.3
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.3
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.3
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.3
3iz6_a 380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.29
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.29
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.28
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.28
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.28
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.28
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 99.27
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.27
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.27
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.26
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.26
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.26
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.26
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 99.26
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.25
2pm7_B 297 Protein transport protein SEC13, protein transport 99.25
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.25
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.23
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.23
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.23
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.23
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.22
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.22
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.21
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.2
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.2
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.19
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.18
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.18
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.17
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 99.17
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.17
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.17
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.17
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.15
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.14
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 99.14
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 99.14
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.14
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.13
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 99.13
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 99.13
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.11
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.11
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.1
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.1
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.08
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.08
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.08
2w18_A 356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.07
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.07
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.07
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.07
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.06
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.06
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.06
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.06
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.06
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.05
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.04
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.02
3jro_A 753 Fusion protein of protein transport protein SEC13 99.01
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 99.01
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.01
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.01
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.0
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 98.99
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 98.98
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 98.97
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 98.96
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.96
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 98.96
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 98.94
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 98.92
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.9
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.9
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 98.89
3jro_A 753 Fusion protein of protein transport protein SEC13 98.87
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.8
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.8
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 98.8
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.75
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 98.75
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.71
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.56
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.49
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 98.46
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 98.45
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.41
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.39
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.3
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.24
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.23
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.2
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.2
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.14
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 98.13
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 98.11
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.09
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.08
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.08
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.07
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 98.02
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.95
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.9
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 97.89
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.89
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.88
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.86
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 97.85
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.8
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 97.79
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.74
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.73
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 97.71
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.68
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.68
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.67
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.62
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.61
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.61
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.51
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 97.41
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 97.39
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 97.38
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 97.37
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.35
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 97.34
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.32
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 97.27
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.25
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.24
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.21
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 97.15
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 97.13
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.12
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 97.12
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 97.11
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.08
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 97.08
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.06
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 97.05
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.91
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.89
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.86
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.84
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.81
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 96.75
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 96.68
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.63
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.62
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 96.6
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 96.6
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.48
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.42
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.36
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 96.14
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.9
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 95.79
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.73
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.51
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.4
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.38
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.16
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 95.13
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 95.01
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 94.9
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 94.69
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 94.05
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 93.92
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 93.88
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 93.68
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 93.44
2qe8_A 343 Uncharacterized protein; structural genomics, join 93.4
3qqz_A 255 Putative uncharacterized protein YJIK; MCSG, PSI-2 93.22
2qe8_A 343 Uncharacterized protein; structural genomics, join 92.72
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 92.63
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 92.55
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 92.32
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 91.94
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 91.87
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 91.41
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 91.33
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 91.31
3nok_A 268 Glutaminyl cyclase; beta-propeller, cyclotransfera 91.26
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 91.16
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 91.14
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 90.92
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 90.04
2ece_A 462 462AA long hypothetical selenium-binding protein; 89.53
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 89.23
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 89.19
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 88.68
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 88.41
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 88.24
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 88.17
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 87.94
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 86.92
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 86.41
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 86.03
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 85.8
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 83.39
2p4o_A 306 Hypothetical protein; putative lactonase, structur 83.35
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 81.75
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 80.68
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
Probab=99.53  E-value=1.3e-13  Score=86.94  Aligned_cols=65  Identities=22%  Similarity=0.343  Sum_probs=57.0

Q ss_pred             eeeEEEcccCCcCCCCCcE----EecCCccCEEEEEECCCCCEEEEEcCCCCEEEEeeCCCCcEEEEeeCCCCCeE
Q psy1940           4 LQCSQDLSSTELSSSSSPV----TINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVELRRGSDPAT   75 (78)
Q Consensus         4 ~~~i~d~~~~~~~~~~~~~----~~~~h~~~i~~v~fs~dg~~l~s~~~d~~~i~i~d~~~~~~~~~~~~~~~~~~   75 (78)
                      ++ +||+.+..     ...    .+.+|.+.|++++|+|+|++|++++.|++ |++||+++++++..+.+|...+.
T Consensus       105 v~-lWd~~~~~-----~~~~~~~~~~~H~~~V~~v~~spdg~~l~sgs~d~~-i~iwd~~~~~~~~~~~~h~~~V~  173 (344)
T 4gqb_B          105 VE-LWELDENE-----TLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDIC-IKVWDLAQQVVLSSYRAHAAQVT  173 (344)
T ss_dssp             EE-EEEECTTS-----SCEEEEEEEECCSSCEEEEEECTTSSEEEEEETTSC-EEEEETTTTEEEEEECCCSSCEE
T ss_pred             EE-EEeccCCC-----ceeEeeccccCCCCCEEEEEECCCCCEEEEEeCCCe-EEEEECCCCcEEEEEcCcCCceE
Confidence            56 89998765     333    34489999999999999999999999999 99999999999999999988775



>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 78
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 6e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-04
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 7e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 8e-05
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 9e-04
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.004
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.003
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.004
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 38.2 bits (87), Expect = 3e-05
 Identities = 11/56 (19%), Positives = 24/56 (42%), Gaps = 1/56 (1%)

Query: 23 TINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVELRRGSDPATLYW 78
           ++ H+S +  +  +   +++ +AS   T I+VWD         L+  +D      
Sbjct: 12 ALSGHRSPVTRVIFHPVFSVMVSASEDAT-IKVWDYETGDFERTLKGHTDSVQDIS 66


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query78
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.55
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 99.54
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 99.53
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.47
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.45
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.44
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.38
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.31
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.28
d1sq9a_ 393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.27
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.26
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.26
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.25
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.21
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.2
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.2
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.19
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.17
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.16
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.14
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.12
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.12
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.1
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.08
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.08
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.04
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.04
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 98.98
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 98.97
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.96
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 98.95
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.95
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.93
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.91
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.86
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.85
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.8
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 98.8
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.73
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.7
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.67
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.65
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.53
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.51
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 98.33
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.31
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.02
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.86
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.82
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.51
d2hqsa1 269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.22
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.05
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 95.61
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 95.26
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 94.59
d2nt0a1143 Glucosylceramidase {Human (Homo sapiens) [TaxId: 9 94.12
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 93.83
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 93.6
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 93.4
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 92.27
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 92.27
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 92.07
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 91.19
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 89.81
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 89.7
d1q7fa_ 279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 89.21
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 87.2
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 85.58
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 84.77
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 83.78
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 82.35
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 80.78
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 80.35
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 80.24
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Antiviral protein Ski8 (Ski8p)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.55  E-value=1.2e-14  Score=90.47  Aligned_cols=70  Identities=24%  Similarity=0.343  Sum_probs=54.2

Q ss_pred             eeeEEEcccCCc--------CCCCCcEEecCCccCEEEEEECCCCCEEEEEcCCCCEEEEeeCCCCcEEEEeeCCCCCeE
Q psy1940           4 LQCSQDLSSTEL--------SSSSSPVTINAHQSELACLALNQTGTMIATASSKGTLIRVWDTLKKVQLVELRRGSDPAT   75 (78)
Q Consensus         4 ~~~i~d~~~~~~--------~~~~~~~~~~~h~~~i~~v~fs~dg~~l~s~~~d~~~i~i~d~~~~~~~~~~~~~~~~~~   75 (78)
                      +. +||+.....        ........+.+|.+.|++++|+|||++|+|++.|++ |++||+++|+++.++++|.++++
T Consensus       258 i~-lwd~~~g~~~~~l~~~~~~~~~~~~~~gH~~~V~~l~fspd~~~l~S~s~D~~-v~vWd~~~g~~~~~l~gH~~~v~  335 (393)
T d1sq9a_         258 IT-LYETEFGERIGSLSVPTHSSQASLGEFAHSSWVMSLSFNDSGETLCSAGWDGK-LRFWDVKTKERITTLNMHCDDIE  335 (393)
T ss_dssp             EE-EEETTTCCEEEEECBC--------CCBSBSSCEEEEEECSSSSEEEEEETTSE-EEEEETTTTEEEEEEECCGGGCS
T ss_pred             ee-ecccccceeeeeeccccccccceeeeecccCceeeeccCCCCCeeEEECCCCE-EEEEECCCCCEEEEECCcCCccc
Confidence            45 788876540        011122233589999999999999999999999999 99999999999999999877653



>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2nt0a1 b.71.1.2 (A:1-77,A:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure