Psyllid ID: psy1955

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510--
MDQPPKIKKLDETVVNRIAAGEVIQRPANALKELLENSLDAKSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRWCTYLADLMALALMEMSQYLQRDKEQIGDKEEKQWYRTVEHTLVPLMKSQYQPSEKIVERACLLEIASLNNLELLSVEGTDDAFQLKVTGWITNVNFSTKKMTFLLFINNPIKRMIEQVYSIYLPKGSFPFVYLSLCMDPKNVDVNVHPTKHEVHFLHEDTIIERVQSMLEKTLLGSNTSRVFYTQSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRASYIDSKLKDPIKPCAGNQGTQIIAEDLFYNIPTRRKALKQPSEEYNKIADVVSRYAVHNPHVGFTLKKQNENLADIRTNVNSSHSEVIGNIYGNNISRRVRRFSSASQSALARKA
cccccccccccHHHHHHHHccccEEccHHHHHHHHHHcccccccEEEEEEccccEEEEEEEEccccccHHcHHHHHHHcccccccccccccccccccccHHHHHHHHHHHcEEEEEcccccccEEcEEEEEEcccccccHHHHHcccccHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHcccccEEEEEEccccccEEEEEEEEcccccccccEEEEEEEcHHHHHHHHHHHcccccccccEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccEEEEEEccccEEEEEEEEcccccccccHHHHHcccccccccccccccccccccccHHHHHHHHHcEEEEEEEcccccccEEEEEEEcccccccccccccccccEEEEcccccccHHHHHcccccHHHHHHHHHHHHHHHHccccEEEEEEEccEEEEEEEccccccHHHHHHHHccHHHHccccEEEEcccccccccc
cccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEEEHHHccEEEEEEccccccHHHHHHHHccccccccccHHHHHccccccccccHHHHHHHccEEEEEEEcccHHHHccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHcHHHHHHHHcccccccHHHHHHHHHccccHHHEEEEEEccccccEEEEEEEccccccccccEEEEEcHHHHHHHHHHHHHHccccccccEEEEEEccHHHEEccccccccccEEHHHcHHHHHHHHHHHHHHHcccccHHccccccEEEEEEEHHHccEEEEEEccccccHHHHHHHHccccccccccHHHHHccccccccccHHHHHHHccEEEEEEEccccccEEEEEEEccccEEEEEEEccccEEEEEEEccccccHHHHcccccHHHHHHHHHHHHHHHHHHcccEEEEEEEcccEEEEEcccccHHHHHHHHHHHcHHHHHHHcccccccccccEEcc
mdqppkikkldeTVVNRIAAGEVIQRPANALKELLENSLDAKSTSIQVTVKQGglkllqiqdngtgirkedmdIVCErfttskltqfedlnsistfgfRGEALASISHVAHLTIItktktspcayrWCTYLADLMALALMEMSQYLQRDkeqigdkeekqWYRTVEHTLVPlmksqyqpseKIVERACLLEIASlnnlellsvegtddafqLKVTGWITNVNFSTKKMTFLLFINNPIKRMIEQVYSiylpkgsfpfvylslcmdpknvdvnvhptkhevhflHEDTIIERVQSMLEKTllgsntsrvfYTQSTSIQVTVKQGGLKllqiqdngtgirkedmdIVCErfttskltqfedlnsistfgfRGEALASISHVAHLTIItktktspcayrasyidsklkdpikpcagnqgtqiIAEDlfyniptrrkalkqpseeynKIADVVSRyavhnphvgfTLKKQNENLADIRTNVNSSHSEVIGNIYGNNISRRVRRFSSASQSALARKA
mdqppkikkldetvvnriaageviqrpANALKELLENSLDAKSTSIqvtvkqgglkllqiqdngtgirkedMDIVCERFttskltqfedlNSISTFGFRGEALASISHVAHLTIItktktspcayRWCTYLADLMALALMEMSQYLQRDKEQIGDKEEKQWYRTVEHTLVPLMKSQYQPSEKIVERACLLEIASLNNLELLSVEGTDDAFQLKVTGWITNVNFSTKKMTFLLFINNPIKRMIEQVYSIYLPKGSFPFVYLSLCMDPKNVDVNVHPTKHEVHFLHEDTIIERVQSMLEKTLLGSNTSRVFYTQSTSIqvtvkqgglkllqiqdngtgirkedMDIVCERFttskltqfedlNSISTFGFRGEALASISHVAHLtiitktktspcaYRASYIDSKLKDPIKPCAGNQGTQIIAEDLFYNIPTRRkalkqpseeyNKIADVVSRYAVHNPHVGFTLKKQNENLADIRTnvnsshsevigniygnnisrrvrrfssasqsalarka
MDQPPKIKKLDETVVNRIAAGEVIQRPANALKELLENSLDAKSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRWCTYladlmalalmemSQYLQRDKEQIGDKEEKQWYRTVEHTLVPLMKSQYQPSEKIVERACLLEIASLNNLELLSVEGTDDAFQLKVTGWITNVNFSTKKMTFLLFINNPIKRMIEQVYSIYLPKGSFPFVYLSLCMDPKNVDVNVHPTKHEVHFLHEDTIIERVQSMLEKTLLGSNTSRVFYTQSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRASYIDSKLKDPIKPCAGNQGTQIIAEDLFYNIPTRRKALKQPSEEYNKIADVVSRYAVHNPHVGFTLKKQNENLADIRTNVNSSHSEVIGNIYGNNISRRVRRFSSASQSALARKA
*************VVNRIAAGEVIQRPANALKELL********TSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRWCTYLADLMALALMEMSQYLQR*********EKQWYRTVEHTLVPLMKSQYQPSEKIVERACLLEIASLNNLELLSVEGTDDAFQLKVTGWITNVNFSTKKMTFLLFINNPIKRMIEQVYSIYLPKGSFPFVYLSLCMDPKNVDVNVHPTKHEVHFLHEDTIIERVQSMLEKTLLGSNTSRVFYTQSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRASYIDSKLKDPIKPCAGNQGTQIIAEDLFYNIPTRRKAL*****EYNKIADVVSRYAVHNPHVGFTLKKQNENLADIRTNVN**HSEVIGNIYGNNI*******************
***PPKI*KLDETVVNRIAAGEVIQRPANALKELLENSLDAKSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRWCTYLADLMALALMEMSQYLQRDKEQIGDKEEKQWYRTVEHTLVPLMKSQYQPSEKIVERACLLEIASLNNLELLSVEGTDDAFQLKVTGWITNVNFSTKKMTFLLFINNPIKRMIEQVYSIYLPKGSFPFVYLSLCMDPKNVDVNVHPTKHEVHFLHEDTIIERVQSMLEKTLLG*******************QGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRASYIDSK*KDP**PCAGNQGTQIIAEDLFYNIPTRRKALKQPSEEYNKIADVVSRYAVHNPHVGFTLKKQNENLADIRTNVNSSHSEVIGNIYGNNISRRVRRFSSASQ***A***
MDQPPKIKKLDETVVNRIAAGEVIQRPANALKELLENSLDAKSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRWCTYLADLMALALMEMSQYLQRDKEQIGDKEEKQWYRTVEHTLVPLMKSQYQPSEKIVERACLLEIASLNNLELLSVEGTDDAFQLKVTGWITNVNFSTKKMTFLLFINNPIKRMIEQVYSIYLPKGSFPFVYLSLCMDPKNVDVNVHPTKHEVHFLHEDTIIERVQSMLEKTLLGSNTSRVFYTQSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRASYIDSKLKDPIKPCAGNQGTQIIAEDLFYNIPTRRKALKQPSEEYNKIADVVSRYAVHNPHVGFTLKKQNENLADIRTNVNSSHSEVIGNIYGNNISRRVRR*************
*****KIKKLDETVVNRIAAGEVIQRPANALKELLENSLDAKSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRWCTYLADLMALALMEMSQYLQRDKEQIGDKEEKQWYRTVEHTLVPLMKSQYQPSEKIVERACLLEIASLNNLELLSVEGTDDAFQLKVTGWITNVNFSTKKMTFLLFINNPIKRMIEQVYSIYLPKGSFPFVYLSLCMDPKNVDVNVHPTKHEVHFLHEDTIIERVQSMLEKTLLGSNTSRVFYTQSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRASYIDSKLKDPIKPCAGNQGTQIIAEDLFYNIPTRRKALKQPSEEYNKIADVVSRYAVHNPHVGFTLKKQNENLADIRTNVNSSHSEVIGNIYGNNISRRVRRFSSASQS******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQPPKIKKLDETVVNRIAAGEVIQRPANALKELLENSLDAKSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRWCTYLADLMALALMEMSQYLQRDKEQIGDKEEKQWYRTVEHTLVPLMKSQYQPSEKIVERACLLEIASLNNLELLSVEGTDDAFQLKVTGWITNVNFSTKKMTFLLFINNPIKRMIEQVYSIYLPKGSFPFVYLSLCMDPKNVDVNVHPTKHEVHFLHEDTIIERVQSMLEKTLLGSNTSRVFYTQSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRASYIDSKLKDPIKPCAGNQGTQIIAEDLFYNIPTRRKALKQPSEEYNKIADVVSRYAVHNPHVGFTLKKQNENLADIRTNVNSSHSEVIGNIYGNNISRRVRRFSSASQSALARKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query512 2.2.26 [Sep-21-2011]
P40692 756 DNA mismatch repair prote yes N/A 0.595 0.403 0.514 2e-88
Q9JK91 760 DNA mismatch repair prote yes N/A 0.595 0.401 0.508 6e-88
P97679 757 DNA mismatch repair prote yes N/A 0.595 0.402 0.505 2e-86
Q54KD8 884 DNA mismatch repair prote yes N/A 0.431 0.25 0.479 8e-59
P38920 769 DNA mismatch repair prote yes N/A 0.285 0.189 0.581 2e-49
Q9P7W6 684 Putative MutL protein hom yes N/A 0.406 0.304 0.454 1e-41
B8CX97 644 DNA mismatch repair prote yes N/A 0.558 0.444 0.331 2e-40
P44494629 DNA mismatch repair prote yes N/A 0.542 0.441 0.343 6e-40
Q4QPH7629 DNA mismatch repair prote yes N/A 0.542 0.441 0.340 2e-39
A5UFN4629 DNA mismatch repair prote yes N/A 0.542 0.441 0.337 2e-39
>sp|P40692|MLH1_HUMAN DNA mismatch repair protein Mlh1 OS=Homo sapiens GN=MLH1 PE=1 SV=1 Back     alignment and function desciption
 Score =  326 bits (836), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 225/342 (65%), Gaps = 37/342 (10%)

Query: 7   IKKLDETVVNRIAAGEVIQRPANALKELLENSLDAKSTSIQVTVKQGGLKLLQIQDNGTG 66
           I++LDETVVNRIAAGEVIQRPANA+KE++EN LDAKSTSIQV VK+GGLKL+QIQDNGTG
Sbjct: 8   IRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTG 67

Query: 67  IRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYR 126
           IRKED+DIVCERFTTSKL  FEDL SIST+GFRGEALASISHVAH+TI TKT    CAYR
Sbjct: 68  IRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYR 127

Query: 127 WCTYLADLMA-------------------LALMEMSQYLQRDKEQIGDKEEKQWYRTVEH 167
                  L A                     +    + L+   E+ G   E     +V +
Sbjct: 128 ASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHN 187

Query: 168 TLVPLMKSQYQPSEKIVERACLLEIASLNNL----------ELLSVEGTDDAFQLKVTGW 217
             +    S  +  E + +   L   ++++N+          EL+ +   D     K+ G+
Sbjct: 188 AGISF--SVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGY 245

Query: 218 ITNVNFSTKKMTFLLFINN------PIKRMIEQVYSIYLPKGSFPFVYLSLCMDPKNVDV 271
           I+N N+S KK  FLLFIN+       +++ IE VY+ YLPK + PF+YLSL + P+NVDV
Sbjct: 246 ISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDV 305

Query: 272 NVHPTKHEVHFLHEDTIIERVQSMLEKTLLGSNTSRVFYTQS 313
           NVHPTKHEVHFLHE++I+ERVQ  +E  LLGSN+SR+++TQ+
Sbjct: 306 NVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQT 347
Heterodimerizes with PMS2 to form MutL alpha, a component of the post-replicative DNA mismatch repair system (MMR). DNA repair is initiated by MutS alpha (MSH2-MSH6) or MutS beta (MSH2-MSH6) binding to a dsDNA mismatch, then MutL alpha is recruited to the heteroduplex. Assembly of the MutL-MutS-heteroduplex ternary complex in presence of RFC and PCNA is sufficient to activate endonuclease activity of PMS2. It introduces single-strand breaks near the mismatch and thus generates new entry points for the exonuclease EXO1 to degrade the strand containing the mismatch. DNA methylation would prevent cleavage and therefore assure that only the newly mutated DNA strand is going to be corrected. MutL alpha (MLH1-PMS2) interacts physically with the clamp loader subunits of DNA polymerase III, suggesting that it may play a role to recruit the DNA polymerase III to the site of the MMR. Also implicated in DNA damage signaling, a process which induces cell cycle arrest and can lead to apoptosis in case of major DNA damages. Heterodimerizes with MLH3 to form MutL gamma which plays a role in meiosis.
Homo sapiens (taxid: 9606)
>sp|Q9JK91|MLH1_MOUSE DNA mismatch repair protein Mlh1 OS=Mus musculus GN=Mlh1 PE=2 SV=2 Back     alignment and function description
>sp|P97679|MLH1_RAT DNA mismatch repair protein Mlh1 OS=Rattus norvegicus GN=Mlh1 PE=2 SV=1 Back     alignment and function description
>sp|Q54KD8|MLH1_DICDI DNA mismatch repair protein Mlh1 OS=Dictyostelium discoideum GN=mlh1 PE=3 SV=1 Back     alignment and function description
>sp|P38920|MLH1_YEAST DNA mismatch repair protein MLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLH1 PE=1 SV=2 Back     alignment and function description
>sp|Q9P7W6|MLH1_SCHPO Putative MutL protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mlh1 PE=2 SV=1 Back     alignment and function description
>sp|B8CX97|MUTL_HALOH DNA mismatch repair protein MutL OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=mutL PE=3 SV=1 Back     alignment and function description
>sp|P44494|MUTL_HAEIN DNA mismatch repair protein MutL OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mutL PE=3 SV=1 Back     alignment and function description
>sp|Q4QPH7|MUTL_HAEI8 DNA mismatch repair protein MutL OS=Haemophilus influenzae (strain 86-028NP) GN=mutL PE=3 SV=1 Back     alignment and function description
>sp|A5UFN4|MUTL_HAEIG DNA mismatch repair protein MutL OS=Haemophilus influenzae (strain PittGG) GN=mutL PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query512
242008773 657 DNA mismatch repair protein MlH1, putati 0.603 0.470 0.542 3e-90
444526303 705 DNA mismatch repair protein Mlh1 [Tupaia 0.544 0.395 0.555 3e-88
302148833348 Chain A, Mutl Protein Homolog 1 Isoform 0.595 0.876 0.514 6e-88
355702650 757 mutL-like protein 1, colon cancer, nonpo 0.773 0.523 0.444 2e-87
73989704 757 PREDICTED: DNA mismatch repair protein M 0.591 0.400 0.520 2e-87
410971723 689 PREDICTED: DNA mismatch repair protein M 0.595 0.442 0.514 3e-87
148229904 750 mutL homolog 1, colon cancer, nonpolypos 0.599 0.409 0.523 4e-87
301757691 757 PREDICTED: DNA mismatch repair protein M 0.773 0.523 0.441 5e-87
410971717 758 PREDICTED: DNA mismatch repair protein M 0.595 0.402 0.514 6e-87
109042257583 PREDICTED: DNA mismatch repair protein M 0.595 0.523 0.508 6e-87
>gi|242008773|ref|XP_002425174.1| DNA mismatch repair protein MlH1, putative [Pediculus humanus corporis] gi|212508876|gb|EEB12436.1| DNA mismatch repair protein MlH1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  338 bits (868), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 190/350 (54%), Positives = 233/350 (66%), Gaps = 41/350 (11%)

Query: 1   MDQPPKIKKLDETVVNRIAAGEVIQRPANALKELLENSLDAKSTSIQVTVKQGGLKLLQI 60
           M   P IKKLDE V+NRIAAGEVIQRP NALKEL+ENS+DAKS+ IQ+TVK GGLKLLQI
Sbjct: 1   MSVAPSIKKLDEAVINRIAAGEVIQRPYNALKELIENSIDAKSSKIQITVKDGGLKLLQI 60

Query: 61  QDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIIT---- 116
            DNGTGIRKED+DIVCERFTTSKL++FEDL  IST+GFRGEALASISHVAHLTI+T    
Sbjct: 61  SDNGTGIRKEDLDIVCERFTTSKLSKFEDLTKISTYGFRGEALASISHVAHLTIVTKTAD 120

Query: 117 --------------KTKTSPCAYRWCTYL------------ADLMALALMEMSQYLQR-D 149
                         K    PCA    T +             + +     E S+ L    
Sbjct: 121 NQCGYKASYVDSKLKNPPKPCAVEKGTQIIVEELFYNVPTRKNALKSPAEEYSKVLDVVR 180

Query: 150 KEQIGDKEEKQWYRTVEHTLVPLMKSQYQPSEKIVERACLLEIASLNNLELLSVEGTDDA 209
           K  I + +     +  + TL  +   Q   S   V+   L+  AS+   ELL V+ +DD 
Sbjct: 181 KYAIHNSKIAFSLKKHKETLSDVNTPQNSTS---VDNIRLIYGASIAK-ELLEVKDSDDT 236

Query: 210 FQLKVTGWITNVNFSTKKMTFLLFINN------PIKRMIEQVYSIYLPKGSFPFVYLSLC 263
            + +V G ITNVN+S KK TFLLFIN+       +K +IEQVYSIYLPK ++PFVYLSL 
Sbjct: 237 LKFQVQGQITNVNYSNKKFTFLLFINDRLVNSSSLKSIIEQVYSIYLPKNNYPFVYLSLT 296

Query: 264 MDPKNVDVNVHPTKHEVHFLHEDTIIERVQSMLEKTLLGSNTSRVFYTQS 313
           + P+N+DVNVHPTKHEVHFLHE+ I+ +++++ EKTLLGSNTSR+FYTQS
Sbjct: 297 ICPENIDVNVHPTKHEVHFLHEENIVNKIKAIFEKTLLGSNTSRIFYTQS 346

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|444526303|gb|ELV14290.1| DNA mismatch repair protein Mlh1 [Tupaia chinensis] Back     alignment and taxonomy information
>gi|302148833|pdb|3NA3|A Chain A, Mutl Protein Homolog 1 Isoform 1 From Homo Sapiens Back     alignment and taxonomy information
>gi|355702650|gb|AES02002.1| mutL-like protein 1, colon cancer, nonpolyposis type 2 [Mustela putorius furo] Back     alignment and taxonomy information
>gi|73989704|ref|XP_534219.2| PREDICTED: DNA mismatch repair protein Mlh1 isoform 1 [Canis lupus familiaris] Back     alignment and taxonomy information
>gi|410971723|ref|XP_003992314.1| PREDICTED: DNA mismatch repair protein Mlh1 isoform 4 [Felis catus] Back     alignment and taxonomy information
>gi|148229904|ref|NP_001090545.1| mutL homolog 1, colon cancer, nonpolyposis type 2 [Xenopus laevis] gi|117167959|gb|AAI24967.1| LOC100036779 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|301757691|ref|XP_002914683.1| PREDICTED: DNA mismatch repair protein Mlh1-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|410971717|ref|XP_003992311.1| PREDICTED: DNA mismatch repair protein Mlh1 isoform 1 [Felis catus] Back     alignment and taxonomy information
>gi|109042257|ref|XP_001087274.1| PREDICTED: DNA mismatch repair protein Mlh1-like [Macaca mulatta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query512
UNIPROTKB|E2RBM6 757 MLH1 "Uncharacterized protein" 0.363 0.245 0.704 6.5e-67
UNIPROTKB|P40692 756 MLH1 "DNA mismatch repair prot 0.363 0.246 0.720 1.9e-67
ZFIN|ZDB-GENE-040426-1600 725 mlh1 "mutL homolog 1, colon ca 0.363 0.256 0.666 1.6e-63
UNIPROTKB|H0Y818 679 MLH1 "DNA mismatch repair prot 0.363 0.273 0.720 1.9e-67
UNIPROTKB|F1MPG0 758 MLH1 "Uncharacterized protein" 0.363 0.245 0.709 1.1e-66
MGI|MGI:101938 760 Mlh1 "mutL homolog 1 (E. coli) 0.363 0.244 0.688 5.2e-65
UNIPROTKB|E1BQE0 757 MLH1 "Uncharacterized protein" 0.363 0.245 0.672 5.2e-65
RGD|620937 757 Mlh1 "mutL homolog 1, colon ca 0.416 0.281 0.589 2.3e-64
UNIPROTKB|P97679 757 Mlh1 "DNA mismatch repair prot 0.416 0.281 0.589 2.3e-64
FB|FBgn0011659 664 Mlh1 "Mlh1" [Drosophila melano 0.408 0.314 0.621 6.9e-63
UNIPROTKB|E2RBM6 MLH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 680 (244.4 bits), Expect = 6.5e-67, P = 6.5e-67
 Identities = 131/186 (70%), Positives = 154/186 (82%)

Query:   312 QSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGE 371
             +STSIQV VK+GGLKL+QIQDNGTGIRKED+DIVCERFTTSKL  FEDL SIST+GFRGE
Sbjct:    43 KSTSIQVVVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGE 102

Query:   372 ALASISHVAHLTIITKTKTSPCAYRASYIDSKLKDPIKPCAGNQGTQIIAEDLFYNIPTR 431
             ALASISHVAH+TI TKT  + CAYRA+Y D KLK P KPCAGNQGTQI  EDLFYNI TR
Sbjct:   103 ALASISHVAHVTITTKTAEAKCAYRATYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTR 162

Query:   432 RKALKQPSEEYNKIADVVSRYAVHNPHVGFTLKKQNENLADIRTNVNSSHSEVIGNIYGN 491
             RKALK PSEEY KI +VV RY++HN  + F++KKQ E +AD+RT  N++  + I +I+GN
Sbjct:   163 RKALKNPSEEYGKILEVVGRYSIHNSGISFSVKKQGETVADVRTLPNATTVDNIRSIFGN 222

Query:   492 NISRRV 497
              +SR +
Sbjct:   223 AVSREL 228
GO:0051257 "spindle midzone assembly involved in meiosis" evidence=IEA
GO:0048477 "oogenesis" evidence=IEA
GO:0045950 "negative regulation of mitotic recombination" evidence=IEA
GO:0045190 "isotype switching" evidence=IEA
GO:0043060 "meiotic metaphase I plate congression" evidence=IEA
GO:0032407 "MutSalpha complex binding" evidence=IEA
GO:0032389 "MutLalpha complex" evidence=IEA
GO:0032137 "guanine/thymine mispair binding" evidence=IEA
GO:0016446 "somatic hypermutation of immunoglobulin genes" evidence=IEA
GO:0008630 "intrinsic apoptotic signaling pathway in response to DNA damage" evidence=IEA
GO:0007283 "spermatogenesis" evidence=IEA
GO:0007060 "male meiosis chromosome segregation" evidence=IEA
GO:0006303 "double-strand break repair via nonhomologous end joining" evidence=IEA
GO:0006298 "mismatch repair" evidence=IEA
GO:0005712 "chiasma" evidence=IEA
GO:0003697 "single-stranded DNA binding" evidence=IEA
GO:0001673 "male germ cell nucleus" evidence=IEA
GO:0000795 "synaptonemal complex" evidence=IEA
GO:0000712 "resolution of meiotic recombination intermediates" evidence=IEA
GO:0000289 "nuclear-transcribed mRNA poly(A) tail shortening" evidence=IEA
GO:0000239 "pachytene" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|P40692 MLH1 "DNA mismatch repair protein Mlh1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1600 mlh1 "mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y818 MLH1 "DNA mismatch repair protein Mlh1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPG0 MLH1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:101938 Mlh1 "mutL homolog 1 (E. coli)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQE0 MLH1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|620937 Mlh1 "mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P97679 Mlh1 "DNA mismatch repair protein Mlh1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0011659 Mlh1 "Mlh1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P40692MLH1_HUMANNo assigned EC number0.51460.59570.4034yesN/A
P97679MLH1_RATNo assigned EC number0.50580.59570.4029yesN/A
Q9JK91MLH1_MOUSENo assigned EC number0.50870.59570.4013yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
PRK00095617 PRK00095, mutL, DNA mismatch repair protein; Revie 1e-72
TIGR00585312 TIGR00585, mutl, DNA mismatch repair protein MutL 1e-66
COG0323 638 COG0323, MutL, DNA mismatch repair enzyme (predict 3e-62
PRK00095 617 PRK00095, mutL, DNA mismatch repair protein; Revie 5e-57
TIGR00585312 TIGR00585, mutl, DNA mismatch repair protein MutL 5e-57
COG0323 638 COG0323, MutL, DNA mismatch repair enzyme (predict 8e-57
cd03483127 cd03483, MutL_Trans_MLH1, MutL_Trans_MLH1: transdu 3e-46
pfam01119119 pfam01119, DNA_mis_repair, DNA mismatch repair pro 5e-32
cd00782122 cd00782, MutL_Trans, MutL_Trans: transducer domain 1e-29
COG0323638 COG0323, MutL, DNA mismatch repair enzyme (predict 5e-19
TIGR00585312 TIGR00585, mutl, DNA mismatch repair protein MutL 6e-16
cd00329107 cd00329, TopoII_MutL_Trans, MutL_Trans: transducer 2e-13
cd03482123 cd03482, MutL_Trans_MutL, MutL_Trans_MutL: transdu 4e-12
pfam13589134 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyr 5e-12
cd03485132 cd03485, MutL_Trans_hPMS_1_like, MutL_Trans_hPMS1_ 8e-11
cd03484142 cd03484, MutL_Trans_hPMS_2_like, MutL_Trans_hPMS2_ 4e-10
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; 1e-07
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyras 1e-06
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPas 3e-05
pfam13589134 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyr 2e-04
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; 9e-04
COG0642336 COG0642, BaeS, Signal transduction histidine kinas 0.001
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyras 0.004
>gnl|CDD|234630 PRK00095, mutL, DNA mismatch repair protein; Reviewed Back     alignment and domain information 
 Score =  241 bits (618), Expect = 1e-72
 Identities = 99/344 (28%), Positives = 165/344 (47%), Gaps = 67/344 (19%)

Query: 5   PKIKKLDETVVNRIAAGEVIQRPANALKELLENSLDAKSTSIQVTVKQGGLKLLQIQDNG 64
             I+ L   + N+IAAGEV++RPA+ +KEL+EN+LDA +T I + +++GGLKL++++DNG
Sbjct: 1   MPIQLLPPQLANQIAAGEVVERPASVVKELVENALDAGATRIDIEIEEGGLKLIRVRDNG 60

Query: 65  TGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCA 124
            GI KED+ +   R  TSK+   +DL +I T GFRGEAL SI+ V+ LT+ ++T  +   
Sbjct: 61  CGISKEDLALALARHATSKIASLDDLEAIRTLGFRGEALPSIASVSRLTLTSRTADAAEG 120

Query: 125 YRWCTYLADLMALALMEMS--------------------QYLQRDKEQ---IGD------ 155
             W         + +   +                    ++L+ +K +   I D      
Sbjct: 121 --WQIVYEGGEIVEVKPAAHPVGTTIEVRDLFFNTPARRKFLKSEKTELGHIDDVVNRLA 178

Query: 156 -----------KEEKQWYRTVEHTLVPLMKSQYQPSEKIVER-ACLLEIASLNNLELLSV 203
                         K                Q + + ++++R A +L      N   L +
Sbjct: 179 LAHPDVAFTLTHNGKLVL-------------QTRGAGQLLQRLAAILGREFAEN--ALPI 223

Query: 204 EGTDDAFQLKVTGWITNVNFSTKKMTFL-LFINN-PIK-RM----IEQVYSIYLPKGSFP 256
           +       L+++G++     S     +  LF+N   ++ ++    I Q Y   LP+G +P
Sbjct: 224 DAEHG--DLRLSGYVGLPTLSRANRDYQYLFVNGRYVRDKLLNHAIRQAYHDLLPRGRYP 281

Query: 257 FVYLSLCMDPKNVDVNVHPTKHEVHFLHEDTIIERVQSMLEKTL 300
              L L +DP  VDVNVHP KHEV F  E  + + +   +++ L
Sbjct: 282 AFVLFLELDPHQVDVNVHPAKHEVRFRDERLVHDLIVQAIQEAL 325

Length = 617
>gnl|CDD|233035 TIGR00585, mutl, DNA mismatch repair protein MutL Back     alignment and domain information
>gnl|CDD|223400 COG0323, MutL, DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234630 PRK00095, mutL, DNA mismatch repair protein; Reviewed Back     alignment and domain information
>gnl|CDD|233035 TIGR00585, mutl, DNA mismatch repair protein MutL Back     alignment and domain information
>gnl|CDD|223400 COG0323, MutL, DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|239565 cd03483, MutL_Trans_MLH1, MutL_Trans_MLH1: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to yeast and human MLH1 (MutL homologue 1) Back     alignment and domain information
>gnl|CDD|201604 pfam01119, DNA_mis_repair, DNA mismatch repair protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|238405 cd00782, MutL_Trans, MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of DNA mismatch repair (MutL/MLH1/PMS2) family Back     alignment and domain information
>gnl|CDD|223400 COG0323, MutL, DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233035 TIGR00585, mutl, DNA mismatch repair protein MutL Back     alignment and domain information
>gnl|CDD|238202 cd00329, TopoII_MutL_Trans, MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of type II DNA topoisomerases (Topo II) and DNA mismatch repair (MutL/MLH1/PMS2) proteins Back     alignment and domain information
>gnl|CDD|239564 cd03482, MutL_Trans_MutL, MutL_Trans_MutL: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to Escherichia coli MutL Back     alignment and domain information
>gnl|CDD|222246 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|239567 cd03485, MutL_Trans_hPMS_1_like, MutL_Trans_hPMS1_like: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to human PSM1 (hPSM1) and yeast MLH2 Back     alignment and domain information
>gnl|CDD|239566 cd03484, MutL_Trans_hPMS_2_like, MutL_Trans_hPMS2_like: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to human PSM2 (hPSM2) Back     alignment and domain information
>gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|214643 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|222246 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|223715 COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 512
KOG1979|consensus 694 100.0
COG0323638 MutL DNA mismatch repair enzyme (predicted ATPase) 100.0
PRK00095617 mutL DNA mismatch repair protein; Reviewed 100.0
TIGR00585312 mutl DNA mismatch repair protein MutL. All protein 100.0
KOG1978|consensus 672 100.0
KOG1979|consensus 694 100.0
COG0323 638 MutL DNA mismatch repair enzyme (predicted ATPase) 100.0
KOG1978|consensus 672 100.0
KOG1977|consensus 1142 100.0
PRK00095 617 mutL DNA mismatch repair protein; Reviewed 100.0
TIGR00585312 mutl DNA mismatch repair protein MutL. All protein 100.0
KOG1977|consensus 1142 99.95
cd03483127 MutL_Trans_MLH1 MutL_Trans_MLH1: transducer domain 99.94
PF01119119 DNA_mis_repair: DNA mismatch repair protein, C-ter 99.93
cd03482123 MutL_Trans_MutL MutL_Trans_MutL: transducer domain 99.92
cd03485132 MutL_Trans_hPMS_1_like MutL_Trans_hPMS1_like: tran 99.91
cd03486141 MutL_Trans_MLH3 MutL_Trans_MLH3: transducer domain 99.9
cd00782122 MutL_Trans MutL_Trans: transducer domain, having a 99.9
cd03484142 MutL_Trans_hPMS_2_like MutL_Trans_hPMS2_like: tran 99.89
PRK14867 659 DNA topoisomerase VI subunit B; Provisional 99.85
PRK14868 795 DNA topoisomerase VI subunit B; Provisional 99.8
PRK14867 659 DNA topoisomerase VI subunit B; Provisional 99.75
smart00433594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomeras 99.7
TIGR01055625 parE_Gneg DNA topoisomerase IV, B subunit, proteob 99.7
TIGR01052 488 top6b DNA topoisomerase VI, B subunit. This model 99.69
PRK14868 795 DNA topoisomerase VI subunit B; Provisional 99.66
TIGR01055 625 parE_Gneg DNA topoisomerase IV, B subunit, proteob 99.64
PRK05644 638 gyrB DNA gyrase subunit B; Validated 99.64
TIGR01059 654 gyrB DNA gyrase, B subunit. This model describes t 99.63
TIGR01059 654 gyrB DNA gyrase, B subunit. This model describes t 99.62
PRK05644638 gyrB DNA gyrase subunit B; Validated 99.62
smart00433 594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomeras 99.58
cd00329107 TopoII_MutL_Trans MutL_Trans: transducer domain, h 99.58
PRK05559631 DNA topoisomerase IV subunit B; Reviewed 99.55
PRK14939 756 gyrB DNA gyrase subunit B; Provisional 99.55
PRK05218613 heat shock protein 90; Provisional 99.55
PRK05559 631 DNA topoisomerase IV subunit B; Reviewed 99.55
PRK14939 756 gyrB DNA gyrase subunit B; Provisional 99.52
PF13589137 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and 99.48
TIGR01052488 top6b DNA topoisomerase VI, B subunit. This model 99.47
PRK04184 535 DNA topoisomerase VI subunit B; Validated 99.47
PRK04184535 DNA topoisomerase VI subunit B; Validated 99.3
PRK05218 613 heat shock protein 90; Provisional 99.29
COG1389538 DNA topoisomerase VI, subunit B [DNA replication, 99.21
COG1389 538 DNA topoisomerase VI, subunit B [DNA replication, 98.88
PRK14083601 HSP90 family protein; Provisional 98.82
COG3290537 CitA Signal transduction histidine kinase regulati 98.78
COG4191603 Signal transduction histidine kinase regulating C4 98.62
PF02518111 HATPase_c: Histidine kinase-, DNA gyrase B-, and H 98.62
PTZ00130 814 heat shock protein 90; Provisional 98.38
PTZ00272 701 heat shock protein 83 kDa (Hsp83); Provisional 98.34
TIGR01058 637 parE_Gpos DNA topoisomerase IV, B subunit, Gram-po 98.26
TIGR02938494 nifL_nitrog nitrogen fixation negative regulator N 98.25
COG0326623 HtpG Molecular chaperone, HSP90 family [Posttransl 98.25
PRK15053545 dpiB sensor histidine kinase DpiB; Provisional 98.23
PRK10364457 sensor protein ZraS; Provisional 98.19
PF13589137 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and 98.18
PRK09303380 adaptive-response sensory kinase; Validated 98.11
PRK10604433 sensor protein RstB; Provisional 98.1
PRK11006430 phoR phosphate regulon sensor protein; Provisional 98.07
TIGR01386457 cztS_silS_copS heavy metal sensor kinase. Members 98.06
PRK11086542 sensory histidine kinase DcuS; Provisional 98.03
PRK10755356 sensor protein BasS/PmrB; Provisional 97.98
PRK09470461 cpxA two-component sensor protein; Provisional 97.94
PRK10549466 signal transduction histidine-protein kinase BaeS; 97.93
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Si 97.91
COG0642336 BaeS Signal transduction histidine kinase [Signal 97.9
PRK10815485 sensor protein PhoQ; Provisional 97.9
cd00075103 HATPase_c Histidine kinase-like ATPases; This fami 97.89
PRK09467435 envZ osmolarity sensor protein; Provisional 97.87
PRK11100475 sensory histidine kinase CreC; Provisional 97.85
TIGR02916679 PEP_his_kin putative PEP-CTERM system histidine ki 97.84
PRK11091779 aerobic respiration control sensor protein ArcB; P 97.81
PRK15347921 two component system sensor kinase SsrA; Provision 97.79
PRK13837828 two-component VirA-like sensor kinase; Provisional 97.72
PRK10618894 phosphotransfer intermediate protein in two-compon 97.72
TIGR03785703 marine_sort_HK proteobacterial dedicated sortase s 97.69
TIGR01058 637 parE_Gpos DNA topoisomerase IV, B subunit, Gram-po 97.69
PRK11073348 glnL nitrogen regulation protein NR(II); Provision 97.68
TIGR01925137 spIIAB anti-sigma F factor. This model describes t 97.67
COG0187 635 GyrB Type IIA topoisomerase (DNA gyrase/topo II, t 97.65
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine 97.61
PRK10337449 sensor protein QseC; Provisional 97.6
PRK10490895 sensor protein KdpD; Provisional 97.58
TIGR02966333 phoR_proteo phosphate regulon sensor kinase PhoR. 97.57
PRK11360607 sensory histidine kinase AtoS; Provisional 97.55
COG3852363 NtrB Signal transduction histidine kinase, nitroge 97.52
TIGR02956968 TMAO_torS TMAO reductase sytem sensor TorS. This p 97.51
PRK11466914 hybrid sensory histidine kinase TorS; Provisional 97.48
PRK14083 601 HSP90 family protein; Provisional 97.47
PRK09835482 sensor kinase CusS; Provisional 97.47
PRK13557540 histidine kinase; Provisional 97.46
COG5000712 NtrY Signal transduction histidine kinase involved 97.43
PRK10841924 hybrid sensory kinase in two-component regulatory 97.4
COG5002459 VicK Signal transduction histidine kinase [Signal 97.3
PRK11107919 hybrid sensory histidine kinase BarA; Provisional 97.3
PRK04069161 serine-protein kinase RsbW; Provisional 97.28
PRK10547670 chemotaxis protein CheA; Provisional 97.23
PRK03660146 anti-sigma F factor; Provisional 97.19
PRK099591197 hybrid sensory histidine kinase in two-component r 97.13
TIGR01924159 rsbW_low_gc serine-protein kinase RsbW. This model 97.06
COG4192673 Signal transduction histidine kinase regulating ph 96.89
PTZ00272 701 heat shock protein 83 kDa (Hsp83); Provisional 96.87
PTZ00130 814 heat shock protein 90; Provisional 96.79
COG0643716 CheA Chemotaxis protein histidine kinase and relat 96.76
COG0326 623 HtpG Molecular chaperone, HSP90 family [Posttransl 96.52
KOG0019|consensus656 96.5
PRK11644495 sensory histidine kinase UhpB; Provisional 96.47
PHA02569602 39 DNA topoisomerase II large subunit; Provisional 96.44
PF13581125 HATPase_c_2: Histidine kinase-like ATPase domain 96.25
COG0187 635 GyrB Type IIA topoisomerase (DNA gyrase/topo II, t 96.25
PTZ00108 1388 DNA topoisomerase 2-like protein; Provisional 96.21
PTZ00109 903 DNA gyrase subunit b; Provisional 96.17
PF02518111 HATPase_c: Histidine kinase-, DNA gyrase B-, and H 96.16
COG3850574 NarQ Signal transduction histidine kinase, nitrate 96.15
PTZ00109 903 DNA gyrase subunit b; Provisional 96.12
PHA02569 602 39 DNA topoisomerase II large subunit; Provisional 96.07
KOG0020|consensus 785 96.03
PLN03128 1135 DNA topoisomerase 2; Provisional 96.0
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 95.84
PLN03237 1465 DNA topoisomerase 2; Provisional 95.7
KOG0787|consensus414 95.45
COG4251750 Bacteriophytochrome (light-regulated signal transd 95.41
COG4585365 Signal transduction histidine kinase [Signal trans 95.35
PRK13560807 hypothetical protein; Provisional 95.09
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein 95.08
PTZ00108 1388 DNA topoisomerase 2-like protein; Provisional 94.99
COG2972456 Predicted signal transduction protein with a C-ter 94.83
PLN03237 1465 DNA topoisomerase 2; Provisional 94.21
COG3920221 Signal transduction histidine kinase [Signal trans 93.65
PLN03128 1135 DNA topoisomerase 2; Provisional 93.58
PRK10935565 nitrate/nitrite sensor protein NarQ; Provisional 93.01
COG3851497 UhpB Signal transduction histidine kinase, glucose 92.51
COG4191603 Signal transduction histidine kinase regulating C4 92.47
PRK13559361 hypothetical protein; Provisional 92.26
PRK10364457 sensor protein ZraS; Provisional 92.1
COG3290537 CitA Signal transduction histidine kinase regulati 91.57
TIGR02938494 nifL_nitrog nitrogen fixation negative regulator N 91.33
PRK11006430 phoR phosphate regulon sensor protein; Provisional 91.22
PRK10549466 signal transduction histidine-protein kinase BaeS; 90.7
PRK09303380 adaptive-response sensory kinase; Validated 90.41
PRK15347 921 two component system sensor kinase SsrA; Provision 90.28
PRK11100475 sensory histidine kinase CreC; Provisional 90.05
PRK10755356 sensor protein BasS/PmrB; Provisional 89.12
PRK10604433 sensor protein RstB; Provisional 89.07
TIGR01386457 cztS_silS_copS heavy metal sensor kinase. Members 88.95
PRK11360607 sensory histidine kinase AtoS; Provisional 88.82
COG3275557 LytS Putative regulator of cell autolysis [Signal 88.81
TIGR02916679 PEP_his_kin putative PEP-CTERM system histidine ki 88.66
PRK10815485 sensor protein PhoQ; Provisional 87.9
TIGR02956 968 TMAO_torS TMAO reductase sytem sensor TorS. This p 87.8
PRK09470461 cpxA two-component sensor protein; Provisional 87.37
PRK11091 779 aerobic respiration control sensor protein ArcB; P 87.14
PRK10618 894 phosphotransfer intermediate protein in two-compon 86.92
KOG0019|consensus 656 86.84
PRK10337449 sensor protein QseC; Provisional 86.76
COG0642336 BaeS Signal transduction histidine kinase [Signal 86.66
PRK10490895 sensor protein KdpD; Provisional 86.47
COG4564459 Signal transduction histidine kinase [Signal trans 86.41
TIGR03785703 marine_sort_HK proteobacterial dedicated sortase s 86.33
PRK15053545 dpiB sensor histidine kinase DpiB; Provisional 86.27
COG3852363 NtrB Signal transduction histidine kinase, nitroge 85.85
PRK11073348 glnL nitrogen regulation protein NR(II); Provision 85.21
PRK13837828 two-component VirA-like sensor kinase; Provisional 84.93
TIGR02966333 phoR_proteo phosphate regulon sensor kinase PhoR. 84.68
PF14501100 HATPase_c_5: GHKL domain 83.37
PRK10841 924 hybrid sensory kinase in two-component regulatory 82.79
COG3850574 NarQ Signal transduction histidine kinase, nitrate 82.77
PRK11466 914 hybrid sensory histidine kinase TorS; Provisional 82.71
PRK09835482 sensor kinase CusS; Provisional 82.39
PRK09467435 envZ osmolarity sensor protein; Provisional 82.24
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 81.55
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Si 81.11
PRK11086542 sensory histidine kinase DcuS; Provisional 81.05
>KOG1979|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.1e-72  Score=580.84  Aligned_cols=341  Identities=49%  Similarity=0.712  Sum_probs=313.0

Q ss_pred             CccccccChHHHHHHhcCCcccCHHHHHHHHHHccccCCCCeEEEEEEeCCeeeEEEEeCCCCCCHHhHHHHHhhcccCC
Q psy1955           4 PPKIKKLDETVVNRIAAGEVIQRPANALKELLENSLDAKSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSK   83 (512)
Q Consensus         4 ~~~i~~l~~~~~~~i~s~~~i~~~~~~v~eLv~Ns~dA~a~~i~i~~~~~~~~~i~v~DnG~Gi~~~~~~~~~~~~~tsK   83 (512)
                      ++.|++||++++++|+|||+|++|..|+|||||||+||++|.|.|.+..||...++|.|||.||.++||+.+|+||.|||
T Consensus         5 ~~~IrrLde~VVNRIAAGEVI~RP~NAlKEliENSLDA~ST~I~V~vk~GGLKLlQisDnG~GI~reDl~ilCeRftTSK   84 (694)
T KOG1979|consen    5 PRKIRRLDEDVVNRIAAGEVIQRPVNALKELIENSLDANSTSIDVLVKDGGLKLLQISDNGSGIRREDLPILCERFTTSK   84 (694)
T ss_pred             chhhhcCcHHHHhHhhccchhhchHHHHHHHHhccccCCCceEEEEEecCCeEEEEEecCCCccchhhhHHHHHHhhhhh
Confidence            34599999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCccccccccccCCcchhhhhhhccceEEEEEecCCCCceEEEEeee---------------------hhhhhhhhccc
Q psy1955          84 LTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRWCTYL---------------------ADLMALALMEM  142 (512)
Q Consensus        84 ~~~~~d~~~~~~~G~rGeaL~si~~~s~l~i~S~~~~~~~~~~~~~~~---------------------~dl~~~~F~n~  142 (512)
                      +..|+||.++.||||||||||||++|++|+|+||++++.+||++ .|.                     +||    |||+
T Consensus        85 L~kFEDL~~lsTyGFRGEALASiShVA~VtV~TK~~~~~cayra-sY~DGkm~~~pKpcAgk~GT~I~vedL----FYN~  159 (694)
T KOG1979|consen   85 LTKFEDLFSLSTYGFRGEALASISHVAHVTVTTKTAEGKCAYRA-SYRDGKMIATPKPCAGKQGTIITVEDL----FYNM  159 (694)
T ss_pred             cchhHHHHhhhhcCccHHHHhhhhheeEEEEEEeecCceeeeEE-EeeccccccCCCCccCCCceEEEehHh----hccC
Confidence            99999999999999999999999999999999999999999999 777                     889    9999


Q ss_pred             chhhhHhhhcCCcHHHHHhhhhhc------ccCeE--EEecCCc-ceeecC-ccChHHHHH----HHHhhcce-Eee-ec
Q psy1955         143 SQYLQRDKEQIGDKEEKQWYRTVE------HTLVP--LMKSQYQ-PSEKIV-ERACLLEIA----SLNNLELL-SVE-GT  206 (512)
Q Consensus       143 Pv~~~Rrk~lks~~~E~~ki~~lv------~p~Vs--~~~~~~~-~~~~t~-~~s~~~~i~----~~~~~~l~-~i~-~~  206 (512)
                      |+   ||+.|+++.+|+++|.++|      +|+|+  +++.|++ ..+++. ..+..|+|+    ..++.+|+ ++. .+
T Consensus       160 ~~---Rrkal~~~~EE~~ki~dlv~ryAIHn~~VsFs~rk~Gd~~~dl~t~~~~s~~D~ir~i~g~~Va~~ll~els~~~  236 (694)
T KOG1979|consen  160 PT---RRKALRNHAEEYRKIMDLVGRYAIHNPRVSFSLRKQGDTVADLRTSVSCSREDNIRNIYGVSVAKNLLNELSKCD  236 (694)
T ss_pred             HH---HHHHhcCcHHHHHHHHHHHHHHheeCCCcceEEeeccccccccccCCccccccchhhhhhhHHHHHHHHHhhhcc
Confidence            99   9999999999999999999      89995  5566665 677887 788888888    67788888 776 56


Q ss_pred             CCcccEEEEEEEecCcccCCCceEEEEEeCc------hHHHHHHHHhhcCCCCCCeEEEEEeeCCCceEEEeecCCCcce
Q psy1955         207 DDAFQLKVTGWITNVNFSTKKMTFLLFINNP------IKRMIEQVYSIYLPKGSFPFVYLSLCMDPKNVDVNVHPTKHEV  280 (512)
Q Consensus       207 ~~~~~~~v~G~is~p~~~~~r~~q~lfVNgR------i~k~I~~~Y~~~l~~~~~P~~~L~i~ipp~~iDVNvhP~K~eV  280 (512)
                      +..+.|+++||||++++..++....+|||||      |+++|..+|..+||++..||+||+|++||+.+||||||+|+||
T Consensus       237 ~~~l~f~~~g~Isn~n~~akk~i~vlFIN~RLVes~~Lr~ale~VYa~yLpk~~~pFvYLsL~i~p~~vDVNVHPTK~eV  316 (694)
T KOG1979|consen  237 SKLLKFSAEGYISNANYSAKKSILVLFINGRLVESDELRHALEEVYAAYLPKGHHPFVYLSLNIDPENVDVNVHPTKREV  316 (694)
T ss_pred             CceeEEeccceEechhhhhhhheEEEEEcCcEeehHHHHHHHHHHHHHhcCCCCCceEEEEEecCHHHcccccCCCccee
Confidence            6667889999999999999999999999999      9999999999999999999999999999999999999999999


Q ss_pred             eecchhhHHHHHHHHHHHHhcCCCCcceeecceeeEEEEEccCce---------eeEeecCCCCCCCcchhhhhhhcccc
Q psy1955         281 HFLHEDTIIERVQSMLEKTLLGSNTSRVFYTQSTSIQVTVKQGGL---------KLLQIQDNGTGIRKEDMDIVCERFTT  351 (512)
Q Consensus       281 ~f~~~~~I~~~I~~~l~~~l~~~~~~r~~~~q~~~i~i~~~~~~~---------~~i~v~Dng~gi~~~~l~~~~~~~~T  351 (512)
                      +|+++++|++.|++.++..|.+.+++|.|+.|..+    |...++         ..-+..++...++++.|+|++.+  .
T Consensus       317 ~FL~qEeIie~I~~~ie~~L~~~d~er~~~~q~~i----P~~~~~~~er~~~~~~~~~s~~ks~k~~~~~mVRtDss--e  390 (694)
T KOG1979|consen  317 HFLNQEEIIERICQQIEERLSALDTERTFLKQVMI----PGPSTLKSERNKPSLKQSPSAQKSDKRYENKMVRTDSS--E  390 (694)
T ss_pred             EeecHHHHHHHHHHHHHHHHhccCcccchhhhhcc----cCCccccccccCccccccccccccchhcccceeecccc--c
Confidence            99999999999999999999999999999988766    443322         12334456678999999999999  7


Q ss_pred             CCccccc
Q psy1955         352 SKLTQFE  358 (512)
Q Consensus       352 SKi~~~~  358 (512)
                      .||++|.
T Consensus       391 ~ki~~fl  397 (694)
T KOG1979|consen  391 RKIDSFL  397 (694)
T ss_pred             cchhhhh
Confidence            8999997

>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL Back     alignment and domain information
>KOG1978|consensus Back     alignment and domain information
>KOG1979|consensus Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1978|consensus Back     alignment and domain information
>KOG1977|consensus Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL Back     alignment and domain information
>KOG1977|consensus Back     alignment and domain information
>cd03483 MutL_Trans_MLH1 MutL_Trans_MLH1: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to yeast and human MLH1 (MutL homologue 1) Back     alignment and domain information
>PF01119 DNA_mis_repair: DNA mismatch repair protein, C-terminal domain; InterPro: IPR013507 This entry represents the C-terminal domain of DNA mismatch repair proteins, such as MutL Back     alignment and domain information
>cd03482 MutL_Trans_MutL MutL_Trans_MutL: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to Escherichia coli MutL Back     alignment and domain information
>cd03485 MutL_Trans_hPMS_1_like MutL_Trans_hPMS1_like: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to human PSM1 (hPSM1) and yeast MLH2 Back     alignment and domain information
>cd03486 MutL_Trans_MLH3 MutL_Trans_MLH3: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to yeast and human MLH3 (MutL homologue 3) Back     alignment and domain information
>cd00782 MutL_Trans MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of DNA mismatch repair (MutL/MLH1/PMS2) family Back     alignment and domain information
>cd03484 MutL_Trans_hPMS_2_like MutL_Trans_hPMS2_like: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to human PSM2 (hPSM2) Back     alignment and domain information
>PRK14867 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>PRK14868 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>PRK14867 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit, proteobacterial Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit Back     alignment and domain information
>PRK14868 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit, proteobacterial Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>TIGR01059 gyrB DNA gyrase, B subunit Back     alignment and domain information
>TIGR01059 gyrB DNA gyrase, B subunit Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>cd00329 TopoII_MutL_Trans MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of type II DNA topoisomerases (Topo II) and DNA mismatch repair (MutL/MLH1/PMS2) proteins Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>PRK14939 gyrB DNA gyrase subunit B; Provisional Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>PRK14939 gyrB DNA gyrase subunit B; Provisional Back     alignment and domain information
>PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14083 HSP90 family protein; Provisional Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>TIGR01058 parE_Gpos DNA topoisomerase IV, B subunit, Gram-positive Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15053 dpiB sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>TIGR03785 marine_sort_HK proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>TIGR01058 parE_Gpos DNA topoisomerase IV, B subunit, Gram-positive Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>TIGR01925 spIIAB anti-sigma F factor Back     alignment and domain information
>COG0187 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK14083 HSP90 family protein; Provisional Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR01924 rsbW_low_gc serine-protein kinase RsbW Back     alignment and domain information
>COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0019|consensus Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>PHA02569 39 DNA topoisomerase II large subunit; Provisional Back     alignment and domain information
>PF13581 HATPase_c_2: Histidine kinase-like ATPase domain Back     alignment and domain information
>COG0187 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00108 DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>PTZ00109 DNA gyrase subunit b; Provisional Back     alignment and domain information
>PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00109 DNA gyrase subunit b; Provisional Back     alignment and domain information
>PHA02569 39 DNA topoisomerase II large subunit; Provisional Back     alignment and domain information
>KOG0020|consensus Back     alignment and domain information
>PLN03128 DNA topoisomerase 2; Provisional Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>PLN03237 DNA topoisomerase 2; Provisional Back     alignment and domain information
>KOG0787|consensus Back     alignment and domain information
>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00108 DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03237 DNA topoisomerase 2; Provisional Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03128 DNA topoisomerase 2; Provisional Back     alignment and domain information
>PRK10935 nitrate/nitrite sensor protein NarQ; Provisional Back     alignment and domain information
>COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>KOG0019|consensus Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03785 marine_sort_HK proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>PRK15053 dpiB sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PF14501 HATPase_c_5: GHKL domain Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
3na3_A348 Mutl Protein Homolog 1 Isoform 1 From Homo Sapiens 8e-90
3na3_A 348 Mutl Protein Homolog 1 Isoform 1 From Homo Sapiens 3e-75
1bkn_A352 Crystal Structure Of An N-Terminal 40kd Fragment Of 2e-34
1bkn_A 352 Crystal Structure Of An N-Terminal 40kd Fragment Of 2e-26
1b62_A355 Mutl Complexed With Adp Length = 355 2e-34
1b62_A 355 Mutl Complexed With Adp Length = 355 2e-26
1b63_A333 Mutl Complexed With Adpnp Length = 333 6e-34
1b63_A333 Mutl Complexed With Adpnp Length = 333 1e-26
1nhj_A333 Crystal Structure Of N-Terminal 40kd MutlA100P MUTA 3e-33
1nhj_A333 Crystal Structure Of N-Terminal 40kd MutlA100P MUTA 6e-26
1h7s_A365 N-Terminal 40kda Fragment Of Human Pms2 Length = 36 1e-20
1h7s_A 365 N-Terminal 40kda Fragment Of Human Pms2 Length = 36 4e-15
1h7u_A365 Hpms2-atpgs Length = 365 1e-20
1h7u_A 365 Hpms2-atpgs Length = 365 3e-15
1ea6_A364 N-Terminal 40kda Fragment Of Nhpms2 Complexed With 1e-20
1ea6_A 364 N-Terminal 40kda Fragment Of Nhpms2 Complexed With 3e-15
3h4l_A367 Crystal Structure Of N Terminal Domain Of A Dna Rep 8e-19
3h4l_A 367 Crystal Structure Of N Terminal Domain Of A Dna Rep 1e-17
>pdb|3NA3|A Chain A, Mutl Protein Homolog 1 Isoform 1 From Homo Sapiens Length = 348 Back     alignment and structure 
Iteration: 1

 Score =  327 bits (839), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 175/342 (51%), Positives = 223/342 (65%), Gaps = 37/342 (10%)
Query: 7   IKKLDETVVNRIAAGEVIQRPANALKELLENSLDAKSTSIQVTVKQGGLKLLQIQDNGTG 66
           I++LDETVVNRIAAGEVIQRPANA+KE++EN LDAKSTSIQV VK+GGLKL+QIQDNGTG
Sbjct: 9   IRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTG 68
Query: 67  IRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYR 126
           IRKED+DIVCERFTTSKL  FEDL SIST+GFRGEALASISHVAH+TI TKT    CAYR
Sbjct: 69  IRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYR 128
Query: 127 W-------------CTYXXXXXXXXX------XXXSQYLQRDKEQIGDKEEKQWYRTVEH 167
                         C                     + L+   E+ G   E     +V +
Sbjct: 129 ASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHN 188
Query: 168 TLVPLMKSQYQPSEKIVERACLLEIASLNNL----------ELLSVEGTDDAFQLKVTGW 217
             +    S  +  E + +   L   ++++N+          EL+ +   D     K+ G+
Sbjct: 189 AGISF--SVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGY 246
Query: 218 ITNVNFSTKKMTFLLFINN------PIKRMIEQVYSIYLPKGSFPFVYLSLCMDPKNVDV 271
           I+N N+S KK  FLLFIN+       +++ IE VY+ YLPK + PF+YLSL + P+NVDV
Sbjct: 247 ISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDV 306
Query: 272 NVHPTKHEVHFLHEDTIIERVQSMLEKTLLGSNTSRVFYTQS 313
           NVHPTKHEVHFLHE++I+ERVQ  +E  LLGSN+SR+++TQ+
Sbjct: 307 NVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQT 348
>pdb|3NA3|A Chain A, Mutl Protein Homolog 1 Isoform 1 From Homo Sapiens Length = 348 Back     alignment and structure
>pdb|1BKN|A Chain A, Crystal Structure Of An N-Terminal 40kd Fragment Of E. Coli Dna Mismatch Repair Protein Mutl Length = 352 Back     alignment and structure
>pdb|1BKN|A Chain A, Crystal Structure Of An N-Terminal 40kd Fragment Of E. Coli Dna Mismatch Repair Protein Mutl Length = 352 Back     alignment and structure
>pdb|1B62|A Chain A, Mutl Complexed With Adp Length = 355 Back     alignment and structure
>pdb|1B62|A Chain A, Mutl Complexed With Adp Length = 355 Back     alignment and structure
>pdb|1B63|A Chain A, Mutl Complexed With Adpnp Length = 333 Back     alignment and structure
>pdb|1B63|A Chain A, Mutl Complexed With Adpnp Length = 333 Back     alignment and structure
>pdb|1NHJ|A Chain A, Crystal Structure Of N-Terminal 40kd MutlA100P MUTANT PROTEIN COMPLEX With Adpnp And One Sodium Length = 333 Back     alignment and structure
>pdb|1NHJ|A Chain A, Crystal Structure Of N-Terminal 40kd MutlA100P MUTANT PROTEIN COMPLEX With Adpnp And One Sodium Length = 333 Back     alignment and structure
>pdb|1H7S|A Chain A, N-Terminal 40kda Fragment Of Human Pms2 Length = 365 Back     alignment and structure
>pdb|1H7S|A Chain A, N-Terminal 40kda Fragment Of Human Pms2 Length = 365 Back     alignment and structure
>pdb|1H7U|A Chain A, Hpms2-atpgs Length = 365 Back     alignment and structure
>pdb|1H7U|A Chain A, Hpms2-atpgs Length = 365 Back     alignment and structure
>pdb|1EA6|A Chain A, N-Terminal 40kda Fragment Of Nhpms2 Complexed With Adp Length = 364 Back     alignment and structure
>pdb|1EA6|A Chain A, N-Terminal 40kda Fragment Of Nhpms2 Complexed With Adp Length = 364 Back     alignment and structure
>pdb|3H4L|A Chain A, Crystal Structure Of N Terminal Domain Of A Dna Repair Prote Length = 367 Back     alignment and structure
>pdb|3H4L|A Chain A, Crystal Structure Of N Terminal Domain Of A Dna Repair Prote Length = 367 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
3na3_A 348 DNA mismatch repair protein MLH1; MUTL protein hom 5e-97
3na3_A348 DNA mismatch repair protein MLH1; MUTL protein hom 2e-75
3na3_A348 DNA mismatch repair protein MLH1; MUTL protein hom 9e-44
1h7s_A 365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 3e-86
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 2e-74
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 4e-27
3h4l_A 367 DNA mismatch repair protein PMS1; ATP binding, DNA 4e-84
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA 8e-72
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA 2e-27
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 8e-63
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 1e-58
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 1e-17
2zbk_B530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 2e-05
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 2e-05
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 1e-04
3rbn_A284 DNA mismatch repair protein MLH1; structural genom 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 5e-04
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Length = 348 Back     alignment and structure
 Score =  296 bits (760), Expect = 5e-97
 Identities = 134/198 (67%), Positives = 155/198 (78%)

Query: 313 STSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEA 372
           STSIQV VK+GGLKL+QIQDNGTGIRKED+DIVCERFTTSKL  FEDL SIST+GFRGEA
Sbjct: 45  STSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEA 104

Query: 373 LASISHVAHLTIITKTKTSPCAYRASYIDSKLKDPIKPCAGNQGTQIIAEDLFYNIPTRR 432
           LASISHVAH+TI TKT    CAYRASY D KLK P KPCAGNQGTQI  EDLFYNI TRR
Sbjct: 105 LASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRR 164

Query: 433 KALKQPSEEYNKIADVVSRYAVHNPHVGFTLKKQNENLADIRTNVNSSHSEVIGNIYGNN 492
           KALK PSEEY KI +VV RY+VHN  + F++KKQ E +AD+RT  N+S  + I +I+GN 
Sbjct: 165 KALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNA 224

Query: 493 ISRRVRRFSSASQSALAR 510
           +SR +       ++   +
Sbjct: 225 VSRELIEIGCEDKTLAFK 242
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Length = 348 Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Length = 348 Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Length = 365 Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Length = 365 Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Length = 365 Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Length = 367 Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Length = 367 Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Length = 367 Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Length = 333 Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Length = 333 Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Length = 333 Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Length = 530 Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Length = 621 Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Length = 621 Back     alignment and structure
>3rbn_A DNA mismatch repair protein MLH1; structural genomics, structural genomics consortium, SGC, DN mismatch repair, endonucleases, protein binding; HET: DNA; 2.16A {Homo sapiens} Length = 284 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Length = 471 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query512
3na3_A348 DNA mismatch repair protein MLH1; MUTL protein hom 100.0
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA 100.0
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 100.0
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 100.0
3na3_A 348 DNA mismatch repair protein MLH1; MUTL protein hom 100.0
3h4l_A 367 DNA mismatch repair protein PMS1; ATP binding, DNA 100.0
1h7s_A 365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 99.98
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 99.97
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B 99.89
1s16_A390 Topoisomerase IV subunit B; two-domain protein com 99.87
1ei1_A391 DNA gyrase B, GYRB; ATPase domain, dimer, isomeras 99.86
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B 99.83
3cwv_A369 DNA gyrase, B subunit, truncated; structural genom 99.82
1y4s_A559 Chaperone protein HTPG; HSP90, molecular chaperone 99.78
1s16_A 390 Topoisomerase IV subunit B; two-domain protein com 99.78
2ioq_A624 Chaperone protein HTPG; heat shock protein, HSP90; 99.77
1ei1_A 391 DNA gyrase B, GYRB; ATPase domain, dimer, isomeras 99.77
3cwv_A 369 DNA gyrase, B subunit, truncated; structural genom 99.74
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 99.69
1kij_A390 DNA gyrase subunit B; topoisomerase, gyrase B-coum 99.68
2o1u_A666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 99.67
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 99.67
4duh_A220 DNA gyrase subunit B; structure-based drug design, 99.66
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 99.65
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 99.64
1zxm_A400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozy 99.63
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; 99.61
1zxm_A 400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozy 99.59
1kij_A 390 DNA gyrase subunit B; topoisomerase, gyrase B-coum 99.58
4duh_A220 DNA gyrase subunit B; structure-based drug design, 99.58
4emv_A226 DNA topoisomerase IV, B subunit; protein-inhibitor 99.57
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 99.55
1y4s_A 559 Chaperone protein HTPG; HSP90, molecular chaperone 99.55
2ioq_A 624 Chaperone protein HTPG; heat shock protein, HSP90; 99.54
3ttz_A198 DNA gyrase subunit B; protein-inhibitor complex, A 99.47
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 99.46
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; 99.45
3lnu_A408 Topoisomerase IV subunit B; PARE, ATP-binding, nuc 99.43
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, A 99.41
2o1u_A 666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 99.38
4emv_A226 DNA topoisomerase IV, B subunit; protein-inhibitor 99.37
3ttz_A198 DNA gyrase subunit B; protein-inhibitor complex, A 99.31
3lnu_A 408 Topoisomerase IV subunit B; PARE, ATP-binding, nuc 99.29
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 99.25
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 99.24
2zbk_B 530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 99.24
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 99.22
1mu5_A 471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 99.18
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, A 99.14
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 99.12
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 99.12
3peh_A281 Endoplasmin homolog; structural genomics, structur 99.1
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone 99.1
2zbk_B530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 99.08
3nmq_A239 Heat shock protein HSP 90-beta; ATPase, chaperone- 99.06
2q2e_B621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 99.04
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 98.92
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone 98.8
3ied_A272 Heat shock protein; HSP90, chaperone, structural g 98.57
3peh_A281 Endoplasmin homolog; structural genomics, structur 98.56
1pvg_A418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA 98.52
3nmq_A239 Heat shock protein HSP 90-beta; ATPase, chaperone- 98.43
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 98.42
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s 98.36
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein 98.35
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 98.32
1pvg_A 418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA 98.3
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding dom 98.28
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine 98.25
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, sign 98.25
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 98.23
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 98.22
4ew8_A268 Sensor protein DIVL; signal transduction, two-comp 98.19
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 98.19
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 98.15
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase doma 98.15
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 98.15
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 98.14
1b3q_A379 Protein (chemotaxis protein CHEA); histine kinase, 98.13
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 98.13
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 98.06
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, t 97.99
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 97.98
3zxo_A129 Redox sensor histidine kinase response regulator; 97.9
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, G 97.78
3ied_A272 Heat shock protein; HSP90, chaperone, structural g 97.71
3zxq_A124 Hypoxia sensor histidine kinase response regulato; 97.69
4fpp_A247 Phosphotransferase; four helix bundle, bergerat fo 97.61
4gfh_A 1177 DNA topoisomerase 2; topoisomerase, protein-DNA co 96.59
1ixm_A192 SPO0B, protein (sporulation response regulatory pr 95.6
3ke6_A399 Protein RV1364C/MT1410; anti-sigma factor, anti-si 95.46
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 94.56
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding dom 94.52
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 94.47
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase doma 94.44
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 94.4
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein 93.96
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine 93.64
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 93.42
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 93.19
4ew8_A268 Sensor protein DIVL; signal transduction, two-comp 93.11
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 92.67
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 92.41
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, sign 92.4
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 92.18
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, t 91.53
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 91.4
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 90.99
3zxq_A124 Hypoxia sensor histidine kinase response regulato; 90.91
4gfh_A 1177 DNA topoisomerase 2; topoisomerase, protein-DNA co 90.42
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 89.58
1b3q_A379 Protein (chemotaxis protein CHEA); histine kinase, 88.56
3zxo_A129 Redox sensor histidine kinase response regulator; 87.8
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, G 86.83
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s 83.76
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=7.5e-69  Score=548.42  Aligned_cols=305  Identities=57%  Similarity=0.868  Sum_probs=240.6

Q ss_pred             CC-CCccccccChHHHHHHhcCCcccCHHHHHHHHHHccccCCCCeEEEEEEeCCeeeEEEEeCCCCCCHHhHHHHHhhc
Q psy1955           1 MD-QPPKIKKLDETVVNRIAAGEVIQRPANALKELLENSLDAKSTSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERF   79 (512)
Q Consensus         1 ~~-~~~~i~~l~~~~~~~i~s~~~i~~~~~~v~eLv~Ns~dA~a~~i~i~~~~~~~~~i~v~DnG~Gi~~~~~~~~~~~~   79 (512)
                      |+ |+++|++||++++++|+||++|++|.++|+|||+||+||+|+.|.|.++.++...|+|.|||+||++++++.+|++|
T Consensus         2 ~~~m~~~I~~L~~~~~~~Iaagevi~~~~~vv~eLv~NAidA~a~~I~I~i~~~~~~~I~V~DnG~GI~~~~l~~~~~~~   81 (348)
T 3na3_A            2 MSFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERF   81 (348)
T ss_dssp             --CCCCCCCCCCHHHHHHHHHHHHCCSHHHHHHHHHHHHHHTTCSEEEEEEEGGGTSEEEEEECSCCCCGGGGGTTTSTT
T ss_pred             CCccccccccCCHHHHHhhcccCcccCHHHHHHHHHHHHHHcCCCEEEEEEEeCCEEEEEEEECCcCcChHHhhhhhccc
Confidence            66 88889999999999999999999999999999999999999999999987777779999999999999999999999


Q ss_pred             ccCCCCCccccccccccCCcchhhhhhhccceEEEEEecCCCCceEEEEeee---------------------hhhhhhh
Q psy1955          80 TTSKLTQFEDLNSISTFGFRGEALASISHVAHLTIITKTKTSPCAYRWCTYL---------------------ADLMALA  138 (512)
Q Consensus        80 ~tsK~~~~~d~~~~~~~G~rGeaL~si~~~s~l~i~S~~~~~~~~~~~~~~~---------------------~dl~~~~  138 (512)
                      +|||+.+++|+..+.++|||||||+||+++|+|+|+||++++..+|++ .|.                     +||    
T Consensus        82 ~tsK~~~~~dl~~i~s~GfrGeaL~Si~avs~l~v~sr~~~~~~~~~~-~~~~G~~~~~~~~~~~~~GTtV~v~~L----  156 (348)
T 3na3_A           82 TTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRA-SYSDGKLKAPPKPCAGNQGTQITVEDL----  156 (348)
T ss_dssp             CCSSCCCC---------CCTTCHHHHHHHSSEEEEEEECTTCSSEEEE-EEETTEESSCCEEECCCSEEEEEEEST----
T ss_pred             cccccCcchhhhccccCCcCChHHHHhhcccEEEEEEEECCCCceEEE-EEeCCEEeeeeeEecCCCCcEEEECcc----
Confidence            999999999999999999999999999999999999999998889988 554                     778    


Q ss_pred             hcccchhhhHhhhcCCcHHHHHhhhhhc------ccCeEEEe--cCCc-ceeecC-ccChHHHHH----HHHhhcceEee
Q psy1955         139 LMEMSQYLQRDKEQIGDKEEKQWYRTVE------HTLVPLMK--SQYQ-PSEKIV-ERACLLEIA----SLNNLELLSVE  204 (512)
Q Consensus       139 F~n~Pv~~~Rrk~lks~~~E~~ki~~lv------~p~Vs~~~--~~~~-~~~~t~-~~s~~~~i~----~~~~~~l~~i~  204 (512)
                      |+|+|+   |||+|++.+.|+.+|.+++      +|+|+|..  +++. ..++++ .+++.++|.    ..++++|++++
T Consensus       157 F~n~P~---R~k~lk~~~~e~~~i~~~l~~~Al~~p~v~f~l~~~g~~~~~~~~~~~~~~~~~i~~i~G~~~~~~l~~v~  233 (348)
T 3na3_A          157 FYNIAT---RRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIG  233 (348)
T ss_dssp             TTTCHH---HHHTSCCHHHHHHHHHHHHHHHHHHCTTCEEEEEETTCSSCSEECCTTCCHHHHHHHHHCHHHHTTEEEEE
T ss_pred             cccCch---hhhhccccHHHHHHHHHHHHHHHhhCCCeEEEEEECCEEEEEeecCCCCCHHHHHHHHhChHhHhhcEEEE
Confidence            999999   9999999999999999998      99996654  4443 457777 778999888    77889999999


Q ss_pred             ecCCcccEEEEEEEecCcccCCCceEEEEEeCc------hHHHHHHHHhhcCCCCCCeEEEEEeeCCCceEEEeecCCCc
Q psy1955         205 GTDDAFQLKVTGWITNVNFSTKKMTFLLFINNP------IKRMIEQVYSIYLPKGSFPFVYLSLCMDPKNVDVNVHPTKH  278 (512)
Q Consensus       205 ~~~~~~~~~v~G~is~p~~~~~r~~q~lfVNgR------i~k~I~~~Y~~~l~~~~~P~~~L~i~ipp~~iDVNvhP~K~  278 (512)
                      .+.+...++++||+|.|.++.++..||+|||||      |.++|+++|+.++|+++||+++|+|+|||+.|||||||+|+
T Consensus       234 ~~~~~~~~~i~G~is~p~~~~~~~~q~~fVNgR~v~~~~l~~ai~~~y~~~l~~~~~P~~~L~l~~~p~~vDVNvhP~K~  313 (348)
T 3na3_A          234 CEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKH  313 (348)
T ss_dssp             EEEGGGTEEEEEEEECSSCCBSSCEEEEEETTEECCCTTHHHHHHHHHHTTSCTTCBCEEEEEEECC-------------
T ss_pred             eecCCccEEEEEEEeCCccCCCcccEEEEECCeEecCHHHHHHHHHHHHHhCcCCCceEEEEEEEeChhheeeeeCCCcC
Confidence            876644699999999999887788999999999      99999999999999999999999999999999999999999


Q ss_pred             ceeecchhhHHHHHHHHHHHHhcCCCCcceeecce
Q psy1955         279 EVHFLHEDTIIERVQSMLEKTLLGSNTSRVFYTQS  313 (512)
Q Consensus       279 eV~f~~~~~I~~~I~~~l~~~l~~~~~~r~~~~q~  313 (512)
                      ||+|.+|++|++.|+++|+++|...+++|+|+.|+
T Consensus       314 eV~f~~e~~i~~~i~~~v~~~l~~~~~sr~f~~~~  348 (348)
T 3na3_A          314 EVHFLHEESILERVQQHIESKLLGSNSSRMYFTQT  348 (348)
T ss_dssp             ---------CTHHHHHHHHHHHC------------
T ss_pred             EEEEcCHHHHHHHHHHHHHHHHhcCCCcceeeccC
Confidence            99999999999999999999999999999998774
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, B-subunit binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus} Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Back     alignment and structure
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, B-subunit binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus} Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Back     alignment and structure
>4duh_A DNA gyrase subunit B; structure-based drug design, antibacterial, DNA gyrase B, GY isomerase-isomerase inhibitor complex; HET: DNA RLI; 1.50A {Escherichia coli} PDB: 1aj6_A* 1kzn_A* 3g7e_A* Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>4duh_A DNA gyrase subunit B; structure-based drug design, antibacterial, DNA gyrase B, GY isomerase-isomerase inhibitor complex; HET: DNA RLI; 1.50A {Escherichia coli} PDB: 1aj6_A* 1kzn_A* 3g7e_A* Back     alignment and structure
>4emv_A DNA topoisomerase IV, B subunit; protein-inhibitor complex, ATP binding, structure-based drug antimicrobial, virtual screen; HET: DNA 0R9; 1.70A {Streptococcus pneumoniae GA47373} PDB: 4em7_A* Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Back     alignment and structure
>3ttz_A DNA gyrase subunit B; protein-inhibitor complex, ATP-binding, structure-based drug antimicrobial, isomerase-isomerase inhibitor complex; HET: DNA 07N; 1.63A {Staphylococcus aureus} PDB: 3u2d_A* 3u2k_A* 3g75_A* 3g7b_A* Back     alignment and structure
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Back     alignment and structure
>3lnu_A Topoisomerase IV subunit B; PARE, ATP-binding, nucleotide-BI topoisomerase; 2.20A {Xanthomonas oryzae PV} PDB: 3lps_A* Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>4emv_A DNA topoisomerase IV, B subunit; protein-inhibitor complex, ATP binding, structure-based drug antimicrobial, virtual screen; HET: DNA 0R9; 1.70A {Streptococcus pneumoniae GA47373} PDB: 4em7_A* Back     alignment and structure
>3ttz_A DNA gyrase subunit B; protein-inhibitor complex, ATP-binding, structure-based drug antimicrobial, isomerase-isomerase inhibitor complex; HET: DNA 07N; 1.63A {Staphylococcus aureus} PDB: 3u2d_A* 3u2k_A* 3g75_A* 3g7b_A* Back     alignment and structure
>3lnu_A Topoisomerase IV subunit B; PARE, ATP-binding, nucleotide-BI topoisomerase; 2.20A {Xanthomonas oryzae PV} PDB: 3lps_A* Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Back     alignment and structure
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Back     alignment and structure
>1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} SCOP: d.14.1.3 d.122.1.2 PDB: 1qzr_A* Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Back     alignment and structure
>1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Back     alignment and structure
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Back     alignment and structure
>1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} SCOP: d.14.1.3 d.122.1.2 PDB: 1qzr_A* Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Back     alignment and structure
>1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Back     alignment and structure
>1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi-domai protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* 3ur1_A Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Back     alignment and structure
>3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>3zxo_A Redox sensor histidine kinase response regulator; transferase; HET: MSE; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3zxq_A Hypoxia sensor histidine kinase response regulato; transferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>4fpp_A Phosphotransferase; four helix bundle, bergerat fold, CCKA, CTRA, CPDR, bacterial cytoplasme; 2.20A {Caulobacter crescentus} PDB: 4fmt_A Back     alignment and structure
>4gfh_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, DNA supercoiling, DNA replication; HET: DNA PTR TSP ANP; 4.41A {Saccharomyces cerevisiae} Back     alignment and structure
>1ixm_A SPO0B, protein (sporulation response regulatory protein); phosphotransferase, two component system; 2.60A {Bacillus subtilis} SCOP: d.123.1.1 PDB: 2ftk_A* 1f51_A Back     alignment and structure
>3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Back     alignment and structure
>4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure
>1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>3zxq_A Hypoxia sensor histidine kinase response regulato; transferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>4gfh_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, DNA supercoiling, DNA replication; HET: DNA PTR TSP ANP; 4.41A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Back     alignment and structure
>1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi-domai protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* 3ur1_A Back     alignment and structure
>3zxo_A Redox sensor histidine kinase response regulator; transferase; HET: MSE; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Back     alignment and structure
>1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 512
d1b63a2218 d.122.1.2 (A:-2-216) DNA mismatch repair protein M 6e-40
d1b63a2218 d.122.1.2 (A:-2-216) DNA mismatch repair protein M 2e-38
d1h7sa2203 d.122.1.2 (A:29-231) DNA mismatch repair protein P 2e-37
d1h7sa2203 d.122.1.2 (A:29-231) DNA mismatch repair protein P 8e-29
d1b63a1115 d.14.1.3 (A:217-331) DNA mismatch repair protein M 4e-20
d1h7sa1134 d.14.1.3 (A:232-365) DNA mismatch repair protein P 4e-18
d2hkja3219 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {A 5e-18
d2hkja3219 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {A 2e-07
d1bxda_161 d.122.1.3 (A:) Histidine kinase domain of the osmo 6e-04
d1jm6a2190 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kin 0.004
>d1b63a2 d.122.1.2 (A:-2-216) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]} Length = 218 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: DNA gyrase/MutL, N-terminal domain
domain: DNA mismatch repair protein MutL
species: Escherichia coli [TaxId: 562]

 Score =  142 bits (358), Expect = 6e-40
 Identities = 60/168 (35%), Positives = 94/168 (55%)

Query: 313 STSIQVTVKQGGLKLLQIQDNGTGIRKEDMDIVCERFTTSKLTQFEDLNSISTFGFRGEA 372
           +T I + +++GG KL++I+DNG GI+K+++ +   R  TSK+   +DL +I + GFRGEA
Sbjct: 41  ATRIDIDIERGGAKLIRIRDNGCGIKKDELALALARHATSKIASLDDLEAIISLGFRGEA 100

Query: 373 LASISHVAHLTIITKTKTSPCAYRASYIDSKLKDPIKPCAGNQGTQIIAEDLFYNIPTRR 432
           LASIS V+ LT+ ++T     A++A      +   +KP A   GT +   DLFYN P RR
Sbjct: 101 LASISSVSRLTLTSRTAEQQEAWQAYAEGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARR 160

Query: 433 KALKQPSEEYNKIADVVSRYAVHNPHVGFTLKKQNENLADIRTNVNSS 480
           K L+    E+N I +++ R A+    V   L    + +   R      
Sbjct: 161 KFLRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGG 208
>d1b63a2 d.122.1.2 (A:-2-216) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]} Length = 218 Back     information, alignment and structure
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 203 Back     information, alignment and structure
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 203 Back     information, alignment and structure
>d1b63a1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d1h7sa1 d.14.1.3 (A:232-365) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 134 Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 219 Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 219 Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Length = 190 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query512
d1b63a2218 DNA mismatch repair protein MutL {Escherichia coli 100.0
d1b63a2218 DNA mismatch repair protein MutL {Escherichia coli 100.0
d1h7sa2203 DNA mismatch repair protein PMS2 {Human (Homo sapi 100.0
d1h7sa2203 DNA mismatch repair protein PMS2 {Human (Homo sapi 100.0
d1b63a1115 DNA mismatch repair protein MutL {Escherichia coli 99.94
d1h7sa1134 DNA mismatch repair protein PMS2 {Human (Homo sapi 99.88
d2hkja3219 Topoisomerase VI-B subunit {Archaeon Sulfolobus sh 99.75
d2hkja3219 Topoisomerase VI-B subunit {Archaeon Sulfolobus sh 99.74
d2iwxa1213 HSP90 {Baker's yeast (Saccharomyces cerevisiae) [T 98.85
d1ysra1148 Sensor-type histidine kinase PrrB {Mycobacterium t 98.72
d1bxda_161 Histidine kinase domain of the osmosensor EnvZ {Es 98.72
d1id0a_146 Histidine kinase PhoQ domain {Escherichia coli [Ta 98.71
d1gkza2193 Branched-chain alpha-ketoacid dehydrogenase kinase 98.68
d1jm6a2190 Pyruvate dehydrogenase kinase {Rat (Rattus norvegi 98.66
d1uyla_208 HSP90 {Human (Homo sapiens) [TaxId: 9606]} 98.61
d2c2aa2161 Sensor histidine kinase TM0853 {Thermotoga maritim 98.58
d2gqpa1227 HSP90 {Dog (Canis familiaris) [TaxId: 9615]} 98.54
d1r62a_156 Nitrogen regulation protein NtrB, C-terminal domai 98.36
d1th8a_139 Anti-sigma factor spoIIab {Bacillus stearothermoph 98.3
d1y8oa2125 Pyruvate dehydrogenase kinase {Human (Homo sapiens 98.19
d1ixma_179 Sporulation response regulatory protein Spo0B {Bac 98.1
d2iwxa1213 HSP90 {Baker's yeast (Saccharomyces cerevisiae) [T 97.91
d1s14a_168 Topoisomerase IV subunit B {Escherichia coli [TaxI 97.82
d1ei1a2219 DNA gyrase B {Escherichia coli [TaxId: 562]} 97.65
d1ei1a2219 DNA gyrase B {Escherichia coli [TaxId: 562]} 97.64
d1s14a_168 Topoisomerase IV subunit B {Escherichia coli [TaxI 97.61
d1pvga2239 DNA topoisomerase II {Baker's yeast (Saccharomyces 97.54
d1kija2212 DNA gyrase B {Thermus thermophilus [TaxId: 274]} 97.49
d1uyla_208 HSP90 {Human (Homo sapiens) [TaxId: 9606]} 97.26
d1kija2212 DNA gyrase B {Thermus thermophilus [TaxId: 274]} 97.24
d2gqpa1227 HSP90 {Dog (Canis familiaris) [TaxId: 9615]} 97.0
d1ysra1148 Sensor-type histidine kinase PrrB {Mycobacterium t 96.59
d1bxda_161 Histidine kinase domain of the osmosensor EnvZ {Es 96.57
d1id0a_146 Histidine kinase PhoQ domain {Escherichia coli [Ta 96.29
d2c2aa2161 Sensor histidine kinase TM0853 {Thermotoga maritim 95.74
d1gkza2193 Branched-chain alpha-ketoacid dehydrogenase kinase 95.71
d1pvga2239 DNA topoisomerase II {Baker's yeast (Saccharomyces 95.57
d1jm6a2190 Pyruvate dehydrogenase kinase {Rat (Rattus norvegi 94.61
d1r62a_156 Nitrogen regulation protein NtrB, C-terminal domai 94.48
d1ixma_179 Sporulation response regulatory protein Spo0B {Bac 93.54
d1y8oa2125 Pyruvate dehydrogenase kinase {Human (Homo sapiens 93.41
d1th8a_139 Anti-sigma factor spoIIab {Bacillus stearothermoph 84.87
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b63a1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h7sa1 d.14.1.3 (A:232-365) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Back     information, alignment and structure
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Back     information, alignment and structure
>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s14a_ d.122.1.2 (A:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s14a_ d.122.1.2 (A:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Back     information, alignment and structure
>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure