Psyllid ID: psy1960


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MEYLKHNRPEYMRCQIEYLHFSLLILDRYNVQETPEWTYLPGSKEREAITAALKRVGSTVEEVPIVIGSKEYKTEHVQYQPMVSLHVQYQPMPHNHKKKIAKFYYATPVLKSALDIVSSLCPYEKNSVGLLINTEVLHDDLYFRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGGRMSALTFYLEVLASNLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLIGECGGKNFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPESLFCFCSCFLLLFLFSASVPVFCFCSCFLLLFLFSTSVPVFCFCSCFLLLFLFSASVPVFCFCGNSAWYGLIT
cccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEccEEEEEcccEEccccccccccccccccccEEEEEEEccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHcccccccEEEEccccccHHHHHHccccccEEEEEccHHHHHHHHHHHHHccccccccccEEEEcccccEEEEcccccHHHHHHHHHHHHHccccccccccEEEEEccccHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccccc
ccHHccccHHHHHHHHHHHHHEHHcccccccccccccccccccccccHHHHHHccccccccEEEEEEccEEEEcccccEccccccccEEEEEccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcHccccccccccccccEEEEEccEEEEEEEccccHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHccccccEEEcccccccHHHHHHccccccEEEEEccHHHHHHHHHHHHHcccccccccEEEEEcccccccEEEccccHHHHHHHHHHHHHHHcccEEEcccEEEEEHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHccEEEEEEcccccccccc
meylkhnrpeymrCQIEYLHFSLLILDrynvqetpewtylpgskEREAITAALKRVGstveevpivigskeyktehvqyqpmvslhvqyqpmphnhkkKIAKFYYATPVLKSALDIVSSLcpyeknsvgllintevlhddlyFRCLDDLKYAAgnyyindkstgsvvgqqpfgggrmSALTFYLEVLASnlgrgegldgfvaavspfnftaiggnlaytpalmgssvlwkpsdtallsNYTIYKIMIeagvppgvvnfvpadgpvfgdtitaspylaginftgsvptfNRLWLQVgkninvyknfprligecggknfhFIHASANVESVVNGTIRSAFEYCgqkcsacsrmyvpeslfCFCSCFLLLFLFSASVPVFCFCSCFLLLFLFSTSVPVFCFCSCFLLLFLFsasvpvfcfcgnsawyglit
meylkhnrpeyMRCQIEYLHFSLLILDRYNVQETPewtylpgskerEAITAALkrvgstveevPIVIGSKEYKTEHVQYQPMVSLHVQYQPMPHNHKKKIAKFYYATPVLKSALDIVSSLCPYEKNSVGLLINTEVLHDDLYFRCLDDLKYAAGNYyindkstgsVVGQQPFGGGRMSALTFYLEVLASNLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLIGECGGKNFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPESLFCFCSCFLLLFLFSASVPVFCFCSCFLLLFLFSTSVPVFCFCSCFLLLFLFSASVPVFCFCGNSAWYGLIT
MEYLKHNRPEYMRCQIEYLHFSLLILDRYNVQETPEWTYLPGSKEREAITAALKRVGSTVEEVPIVIGSKEYKTEHVQYQPMVSLHVQYQPMPHNHKKKIAKFYYATPVLKSALDIVSSLCPYEKNSVGLLINTEVLHDDLYFRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGGRMSALTFYLEVLASNLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLIGECGGKNFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPEslfcfcscflllflfsAsvpvfcfcscflllflfstsvpvfcfcscflllflfsasvpvfCFCGNSAWYGLIT
*********EYMRCQIEYLHFSLLILDRYNVQETPEWTYLPGSKEREAITAALKRVGSTVEEVPIVIGSKEYKTEHVQYQPMVSLHVQYQPMPHNHKKKIAKFYYATPVLKSALDIVSSLCPYEKNSVGLLINTEVLHDDLYFRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGGRMSALTFYLEVLASNLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLIGECGGKNFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPESLFCFCSCFLLLFLFSASVPVFCFCSCFLLLFLFSTSVPVFCFCSCFLLLFLFSASVPVFCFCGNSAWYGLI*
**************************DRYNVQETPEWTYLPGSKEREAITAALKRVGSTVEEVPIVIGSKEYKTEHVQYQPMVSLHVQYQPMPHNHKKKIAKFYYATPVLKSALDIVSSLCPYEKNSVGLLINTEVLHDDLYFRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGGRMSALTFYLEVLASNLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLIGECGGKNFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPESLFCFCSCFLLLFLFSASVPVFCFCSCFLLLFLFSTSVPVFCFCSCFLLLFLFSASVPVFCFCGNSAWYGLIT
MEYLKHNRPEYMRCQIEYLHFSLLILDRYNVQETPEWTYLPGSKEREAITAALKRVGSTVEEVPIVIGSKEYKTEHVQYQPMVSLHVQYQPMPHNHKKKIAKFYYATPVLKSALDIVSSLCPYEKNSVGLLINTEVLHDDLYFRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGGRMSALTFYLEVLASNLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLIGECGGKNFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPESLFCFCSCFLLLFLFSASVPVFCFCSCFLLLFLFSTSVPVFCFCSCFLLLFLFSASVPVFCFCGNSAWYGLIT
*EYLKHNRPEYMRCQIEYLHFSLLILDRYNVQETPEWTYLPGSKEREAITAALKRVGSTVEEVPIVIGSKEYKTEHVQYQPMVSLHVQYQPMPHNHKKKIAKFYYATPVLKSALDIVSSLCPYEKNSVGLLINTEVLHDDLYFRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGGRMSALTFYLEVLASNLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLIGECGGKNFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPESLFCFCSCFLLLFLFSASVPVFCFCSCFLLLFLFSTSVPVFCFCSCFLLLFLFSASVPVFCFCGNSAW*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEYLKHNRPEYMRCQIEYLHFSLLILDRYNVQETPEWTYLPGSKEREAITAALKRVGSTVEEVPIVIGSKEYKTEHVQYQPMVSLHVQYQPMPHNHKKKIAKFYYATPVLKSALDIVSSLCPYEKNSVGLLINTEVLHDDLYFRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGGRMSALTFYLEVLASNLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLIGECGGKNFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPESLFCFCSCFLLLFLFSASVPVFCFCSCFLLLFLFSTSVPVFCFCSCFLLLFLFSASVPVFCFCGNSAWYGLIT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query428 2.2.26 [Sep-21-2011]
Q7SY23 556 Delta-1-pyrroline-5-carbo yes N/A 0.778 0.598 0.443 2e-80
Q8CHT0 562 Delta-1-pyrroline-5-carbo yes N/A 0.738 0.562 0.452 9e-79
P30038 563 Delta-1-pyrroline-5-carbo yes N/A 0.778 0.591 0.449 1e-78
A7YWE4 563 Delta-1-pyrroline-5-carbo yes N/A 0.719 0.547 0.451 6e-77
P0C2X9 563 Delta-1-pyrroline-5-carbo yes N/A 0.738 0.561 0.447 9e-77
Q54RA2 558 Delta-1-pyrroline-5-carbo yes N/A 0.703 0.539 0.377 7e-54
P78568 546 Delta-1-pyrroline-5-carbo N/A N/A 0.738 0.578 0.364 4e-52
O74766 548 Probable delta-1-pyrrolin yes N/A 0.726 0.567 0.348 4e-45
Q9P8I0 572 Delta-1-pyrroline-5-carbo yes N/A 0.703 0.526 0.343 1e-44
P07275 575 Delta-1-pyrroline-5-carbo yes N/A 0.675 0.502 0.347 2e-44
>sp|Q7SY23|AL4A1_DANRE Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Danio rerio GN=aldh4a1 PE=2 SV=1 Back     alignment and function desciption
 Score =  299 bits (766), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 168/379 (44%), Positives = 218/379 (57%), Gaps = 46/379 (12%)

Query: 30  NVQETPEWTYLPGSKEREAITAALKRVGSTVEEVPIVIGSKEYKTEHVQYQPMVSLHVQY 89
            V+  P   +  GSKER  +  AL+ +    EE+P VIG++E  T+ +++Q         
Sbjct: 24  EVKNEPVLEFKEGSKERAELEEALRNLKGKTEEIPCVIGNEEVWTKDIRFQLS------- 76

Query: 90  QPMPHNHKKKIAKFYYATP-VLKSALDIVSS------LCPYEKNSVGLLINTEVLHDDLY 142
              P NH  ++AKF YA   +L  A++   +      L P    +       +++     
Sbjct: 77  ---PFNHSHQVAKFCYADKDLLNKAIEASVAARREWDLKPVSDRAQIFFKAADIISGPKR 133

Query: 143 FRCLDDLKYAAGN----------------YYINDKSTGSVVGQQPFGGGRMSALTFYLEV 186
              L       G                 +  N K    +  QQP      +    Y   
Sbjct: 134 AEVLAKTMIGQGKTVVQAEIDAAPELIDFFRFNAKHAIELEDQQPLDSDGSTNTMLY--- 190

Query: 187 LASNLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIM 246
                    GL+GFVAAV+PFNFTAIGGNLA TPALMG+ VLWKPSDTA+ ++Y +YKI+
Sbjct: 191 --------RGLEGFVAAVAPFNFTAIGGNLAGTPALMGNVVLWKPSDTAMSASYAVYKIL 242

Query: 247 IEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFP 306
            E+G+PP ++ FVPADGPVFGDT+T+S +LAGINFTGSVPTF RLW QV +N+++YKNFP
Sbjct: 243 RESGLPPNIIQFVPADGPVFGDTVTSSEHLAGINFTGSVPTFKRLWKQVAQNLDIYKNFP 302

Query: 307 RLIGECGGKNFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPESLFCFCSCFLL 366
           R+ GECGGKNFHF+H SA+V SVV GTIRSAFEY GQKCSACSRMYVP+SL+      LL
Sbjct: 303 RVAGECGGKNFHFVHKSADVRSVVTGTIRSAFEYGGQKCSACSRMYVPDSLWPQIRQGLL 362

Query: 367 LFLFSASV--PVFCFCSCF 383
                  V  PV  F + F
Sbjct: 363 DVYKQIKVGDPVEDFSTFF 381




Irreversible conversion of delta-1-pyrroline-5-carboxylate (P5C), derived either from proline or ornithine, to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles.
Danio rerio (taxid: 7955)
EC: 1EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 2
>sp|Q8CHT0|AL4A1_MOUSE Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Mus musculus GN=Aldh4a1 PE=1 SV=3 Back     alignment and function description
>sp|P30038|AL4A1_HUMAN Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Homo sapiens GN=ALDH4A1 PE=1 SV=3 Back     alignment and function description
>sp|A7YWE4|AL4A1_BOVIN Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Bos taurus GN=ALDH4A1 PE=2 SV=1 Back     alignment and function description
>sp|P0C2X9|AL4A1_RAT Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Aldh4a1 PE=1 SV=1 Back     alignment and function description
>sp|Q54RA2|AL4A1_DICDI Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0283293 PE=3 SV=1 Back     alignment and function description
>sp|P78568|PUT2_AGABI Delta-1-pyrroline-5-carboxylate dehydrogenase OS=Agaricus bisporus GN=pruA PE=3 SV=1 Back     alignment and function description
>sp|O74766|PUT2_SCHPO Probable delta-1-pyrroline-5-carboxylate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC24C6.04 PE=1 SV=1 Back     alignment and function description
>sp|Q9P8I0|PUT2_EMENI Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prnC PE=3 SV=2 Back     alignment and function description
>sp|P07275|PUT2_YEAST Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query428
328698360 535 PREDICTED: delta-1-pyrroline-5-carboxyla 0.754 0.603 0.549 1e-99
347971770 573 AGAP004366-PA [Anopheles gambiae str. PE 0.768 0.574 0.551 2e-98
157109902 570 pyrroline-5-carboxylate dehydrogenase [A 0.754 0.566 0.550 2e-98
312375387 613 hypothetical protein AND_14227 [Anophele 0.764 0.533 0.543 3e-98
91084231 568 PREDICTED: similar to pyrroline-5-carbox 0.754 0.568 0.559 2e-97
170042990 570 pyrroline-5-carboxylate dehydrogenase [C 0.724 0.543 0.555 9e-97
357528293398 pyrroline-5-carboxylate dehydrogenase [L 0.721 0.776 0.520 1e-96
345483689 568 PREDICTED: delta-1-pyrroline-5-carboxyla 0.761 0.573 0.561 9e-96
194876019 574 GG13195 [Drosophila erecta] gi|190655482 0.733 0.547 0.538 1e-95
24668413 574 delta-1-Pyrroline-5-carboxylate dehydrog 0.733 0.547 0.544 2e-95
>gi|328698360|ref|XP_001952392.2| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  369 bits (947), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 196/357 (54%), Positives = 241/357 (67%), Gaps = 34/357 (9%)

Query: 21  FSLLILDRYNVQETPEWTYLPGSKEREAITAALKRVGSTVEEVPIVIGSKEYKTEHVQYQ 80
            SL  +  + V+  P   Y+PGSKER+ I A LKR+ + VE+VPI+IG++++KT+ V+YQ
Sbjct: 27  LSLPKIKDFTVENEPLLEYMPGSKERKEIEAELKRLSNNVEDVPIIIGNEKFKTKDVRYQ 86

Query: 81  PMVSLHVQYQPMPHNHKKKIAKFYYATPVLKSALDIVSSLCPYEKNSVGLLINTEVLHDD 140
            M          PHNH KKIAKFYYA+  L +    V++    + ++V L     +    
Sbjct: 87  VM----------PHNHSKKIAKFYYASSDLVAKAIKVATEAQTKWDTVPLEEKIRI---- 132

Query: 141 LYFRCLD------DLKYAAGNYYINDKS--------TGSVVGQQPFGGGRMSALTFYLEV 186
            + +  D       +K  A       K+        +  ++            LT Y  +
Sbjct: 133 -WLKAADLMATKYRMKLNAATMLGQSKTVIQAEIDASAELIDFIKLNAFFAKELTKYQPI 191

Query: 187 -----LASNLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYT 241
                +  N  R  GLDGFVAAVSPFNFTAIGGNLAYTPALMG SVLWKPSDTALLSN+ 
Sbjct: 192 SENKNVTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGCSVLWKPSDTALLSNWV 251

Query: 242 IYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINV 301
           IY+IM EAGVPPGVVNF+PADGPVFGDTITASP+L+GINFTGSVPTFNRLW QVGKNIN 
Sbjct: 252 IYEIMTEAGVPPGVVNFIPADGPVFGDTITASPHLSGINFTGSVPTFNRLWTQVGKNINS 311

Query: 302 YKNFPRLIGECGGKNFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPESLF 358
           Y NFPRLIGECGGKN+HF+H +A+V SVV GTIRS+FEYCGQKCSACSR+YVP+SL+
Sbjct: 312 YVNFPRLIGECGGKNYHFVHPTADVTSVVTGTIRSSFEYCGQKCSACSRLYVPQSLW 368




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|347971770|ref|XP_313649.4| AGAP004366-PA [Anopheles gambiae str. PEST] gi|333469021|gb|EAA09247.4| AGAP004366-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157109902|ref|XP_001650875.1| pyrroline-5-carboxylate dehydrogenase [Aedes aegypti] gi|108878912|gb|EAT43137.1| AAEL005422-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312375387|gb|EFR22772.1| hypothetical protein AND_14227 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|91084231|ref|XP_969408.1| PREDICTED: similar to pyrroline-5-carboxylate dehydrogenase [Tribolium castaneum] gi|270008791|gb|EFA05239.1| hypothetical protein TcasGA2_TC015385 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170042990|ref|XP_001849188.1| pyrroline-5-carboxylate dehydrogenase [Culex quinquefasciatus] gi|167866390|gb|EDS29773.1| pyrroline-5-carboxylate dehydrogenase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|357528293|gb|AET80385.1| pyrroline-5-carboxylate dehydrogenase [Leptinotarsa decemlineata] Back     alignment and taxonomy information
>gi|345483689|ref|XP_001601273.2| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|194876019|ref|XP_001973699.1| GG13195 [Drosophila erecta] gi|190655482|gb|EDV52725.1| GG13195 [Drosophila erecta] Back     alignment and taxonomy information
>gi|24668413|ref|NP_730695.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform A [Drosophila melanogaster] gi|24668417|ref|NP_649368.2| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform B [Drosophila melanogaster] gi|24668425|ref|NP_730698.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform D [Drosophila melanogaster] gi|320546182|ref|NP_001189159.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform E [Drosophila melanogaster] gi|442634086|ref|NP_001262196.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform F [Drosophila melanogaster] gi|7296504|gb|AAF51790.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform A [Drosophila melanogaster] gi|23094285|gb|AAN12191.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform B [Drosophila melanogaster] gi|23094287|gb|AAN12193.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform D [Drosophila melanogaster] gi|211938657|gb|ACJ13225.1| FI08816p [Drosophila melanogaster] gi|318069273|gb|ADV37595.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform E [Drosophila melanogaster] gi|440216173|gb|AGB94889.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform F [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query428
FB|FBgn0037138 574 P5CDh1 "delta-1-Pyrroline-5-ca 0.752 0.560 0.557 2.9e-87
ZFIN|ZDB-GENE-040426-1179 556 aldh4a1 "aldehyde dehydrogenas 0.735 0.566 0.474 3.2e-72
UNIPROTKB|E1C8Z8 551 ALDH4A1 "Uncharacterized prote 0.733 0.569 0.485 6.7e-72
UNIPROTKB|F1PT06 1459 TAS1R2 "Taste receptor type 1 0.373 0.109 0.706 1.4e-71
UNIPROTKB|D2D4A3512 ALDH4A1 "Mitochondrial aldehyd 0.733 0.613 0.470 9.9e-71
UNIPROTKB|P30038 563 ALDH4A1 "Delta-1-pyrroline-5-c 0.733 0.557 0.470 9.9e-71
MGI|MGI:2443883 562 Aldh4a1 "aldehyde dehydrogenas 0.735 0.560 0.462 1.6e-70
UNIPROTKB|J9P2L3 564 TAS1R2 "Taste receptor type 1 0.735 0.558 0.468 1.1e-69
WB|WBGene00000112 563 alh-6 [Caenorhabditis elegans 0.394 0.300 0.639 2e-69
RGD|1624206 563 Aldh4a1 "aldehyde dehydrogenas 0.735 0.559 0.459 3e-69
FB|FBgn0037138 P5CDh1 "delta-1-Pyrroline-5-carboxylate dehydrogenase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 872 (312.0 bits), Expect = 2.9e-87, P = 2.9e-87
 Identities = 193/346 (55%), Positives = 229/346 (66%)

Query:    24 LILDRYNVQETPEWTYLPGSKEREAITAALKRVGSTVEEVPIVIGSKEYKTEHVQYQPMV 83
             L L  + +   P   YL  SKER+A+  ALK   S+ E++PIVIG KEYKT      P  
Sbjct:    34 LKLKDFPIANEPILGYLKDSKERKALEQALKGTASSCEDIPIVIGGKEYKT------P-- 85

Query:    84 SLHVQYQPMPHNHKKKIAKFYYATPVL--KSALDIVSSLCPYEKNSVGLLINT-EVLHDD 140
                V+YQ MPH+H+ K+A FYYA   L  K+    V +   +++ S+   +   E   D 
Sbjct:    86 --EVRYQVMPHDHQHKLASFYYADKKLIEKAIKTAVETQPKWDRVSIADRLKIWEKAADL 143

Query:   141 LYFRCLDDLKYAA----GNYYINDK--STGSVVGQQPFGGGRMSALTFYLEV-----LAS 189
             +      DL  A         I  +  S   ++         +  +T Y  +     +  
Sbjct:   144 MATTYRQDLNAATMLGQSKTAIQAEIDSAAELIDFIRMNAYFLKEVTKYQPISENIKVTK 203

Query:   190 NLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEA 249
             N  R  G+DGF+AAVSPFNFTAIGGNL+YTPALMG+ VLWKPSDTA+LSN+ I+KIM EA
Sbjct:   204 NSLRYRGIDGFIAAVSPFNFTAIGGNLSYTPALMGNGVLWKPSDTAMLSNWIIFKIMREA 263

Query:   250 GVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLI 309
             GVP GVVNFVPADGPVFGDTITASP+LAGINFTGSVPTFNRLW QVG NI+ Y NFPRL 
Sbjct:   264 GVPDGVVNFVPADGPVFGDTITASPHLAGINFTGSVPTFNRLWKQVGNNIDNYVNFPRLT 323

Query:   310 GECGGKNFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPE 355
             GECGGKNFHFIHASA+VESVV  TIRSAFEYCGQKCSACSRMYVPE
Sbjct:   324 GECGGKNFHFIHASADVESVVTSTIRSAFEYCGQKCSACSRMYVPE 369


GO:0003842 "1-pyrroline-5-carboxylate dehydrogenase activity" evidence=ISS
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0006560 "proline metabolic process" evidence=ISS;IMP
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006561 "proline biosynthetic process" evidence=IEA
GO:0007005 "mitochondrion organization" evidence=IMP
GO:0005739 "mitochondrion" evidence=IDA
ZFIN|ZDB-GENE-040426-1179 aldh4a1 "aldehyde dehydrogenase 4 family, member A1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8Z8 ALDH4A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PT06 TAS1R2 "Taste receptor type 1 member 2" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D2D4A3 ALDH4A1 "Mitochondrial aldehyde dehydrogenase 4 family member A1 transcript variant ALDH4A1_v6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P30038 ALDH4A1 "Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2443883 Aldh4a1 "aldehyde dehydrogenase 4 family, member A1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J9P2L3 TAS1R2 "Taste receptor type 1 member 2" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00000112 alh-6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|1624206 Aldh4a1 "aldehyde dehydrogenase 4 family, member A1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query428
cd07123 522 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-ca 1e-115
TIGR01236 532 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carb 1e-109
cd07083 500 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent 6e-75
pfam00171 459 pfam00171, Aldedh, Aldehyde dehydrogenase family 8e-49
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 3e-45
cd07078 432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 7e-45
cd07124 512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 6e-42
COG1012 472 COG1012, PutA, NAD-dependent aldehyde dehydrogenas 5e-40
PRK03137 514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 8e-31
cd07097 473 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+ 2e-30
cd07125 518 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car 1e-29
TIGR01237 511 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carb 3e-28
cd07114 457 cd07114, ALDH_DhaS, Uncharacterized Candidatus pel 8e-27
cd07115 453 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 8e-27
cd07150 451 cd07150, ALDH_VaniDH_like, Pseudomonas putida vani 9e-27
cd07145 456 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcu 9e-27
COG4230 769 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate 1e-25
cd07086 478 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha 6e-25
cd07104 431 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P) 1e-24
cd07112 462 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+ 4e-24
cd07113 477 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dep 9e-24
cd07119 482 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-de 3e-23
PRK11904 1038 PRK11904, PRK11904, bifunctional proline dehydroge 4e-23
cd07149 453 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) wi 7e-23
cd07088 468 cd07088, ALDH_LactADH-AldA, Escherichia coli lacta 8e-23
cd07093 455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 9e-23
cd07138 466 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-ox 1e-22
cd07131 478 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candi 2e-22
TIGR01238 500 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carb 3e-22
cd07094 453 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NA 3e-22
cd07089 459 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6- 3e-22
cd07082 473 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-ph 5e-22
TIGR01804 467 TIGR01804, BADH, glycine betaine aldehyde dehydrog 1e-21
cd07091 476 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH 3e-21
cd07102 452 cd07102, ALDH_EDX86601, Uncharacterized aldehyde d 3e-21
PRK09407 524 PRK09407, gabD2, succinic semialdehyde dehydrogena 5e-21
cd07103 451 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina 7e-21
cd07095 431 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-sem 7e-21
cd07101 454 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul 8e-21
PRK11905 1208 PRK11905, PRK11905, bifunctional proline dehydroge 9e-21
cd07109 454 cd07109, ALDH_AAS00426, Uncharacterized Saccharopo 2e-20
cd07106 446 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofac 8e-20
PRK11809 1318 PRK11809, putA, trifunctional transcriptional regu 2e-19
cd07107 456 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxyben 5e-19
PRK09457 487 PRK09457, astD, succinylglutamic semialdehyde dehy 3e-18
PLN02278 498 PLN02278, PLN02278, succinic semialdehyde dehydrog 4e-18
cd07090 457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 5e-18
cd07152 443 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde 6e-18
cd07151 465 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxyb 8e-18
cd07105 432 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogena 1e-17
cd07130 474 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-amin 2e-17
TIGR03216 481 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semia 3e-17
cd07139 471 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculo 3e-17
TIGR01780 448 TIGR01780, SSADH, succinate-semialdehyde dehydroge 3e-17
cd07110 456 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehy 4e-17
TIGR02299 488 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate 6e-17
cd07092 450 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-d 8e-17
cd07108 457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 1e-16
cd07085 478 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyd 1e-16
cd07118 454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 2e-16
cd07144 484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 2e-16
cd07123 522 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-ca 3e-16
cd07111 480 cd07111, ALDH_F16, Aldehyde dehydrogenase family 1 3e-16
TIGR03240 484 TIGR03240, arg_catab_astD, succinylglutamic semial 6e-16
cd07141 481 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retin 1e-15
PRK13252 488 PRK13252, PRK13252, betaine aldehyde dehydrogenase 1e-15
PRK09847 494 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobuty 2e-15
cd07146 451 cd07146, ALDH_PhpJ, Streptomyces putative phosphon 2e-15
cd07123522 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-ca 4e-15
cd07143 481 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans al 1e-14
TIGR03250 472 TIGR03250, PhnAcAld_DH, putative phosphonoacetalde 3e-14
cd07120 455 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida al 3e-14
PRK11241 482 PRK11241, gabD, succinate-semialdehyde dehydrogena 9e-14
PLN02467 503 PLN02467, PLN02467, betaine aldehyde dehydrogenase 1e-13
cd07142 476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 1e-13
PRK13473 475 PRK13473, PRK13473, gamma-aminobutyraldehyde dehyd 2e-13
cd07099 453 cd07099, ALDH_DDALDH, Methylomonas sp 3e-13
TIGR03374 472 TIGR03374, ABALDH, 1-pyrroline dehydrogenase 4e-13
PRK10090 409 PRK10090, PRK10090, aldehyde dehydrogenase A; Prov 4e-13
TIGR01236532 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carb 5e-13
cd07147 452 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase f 5e-13
cd07140 486 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate 1e-12
cd07117 475 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylo 2e-12
PLN02766 501 PLN02766, PLN02766, coniferyl-aldehyde dehydrogena 7e-12
cd07084 442 cd07084, ALDH_KGSADH-like, ALDH subfamily: NAD(P)+ 3e-11
PLN02466 538 PLN02466, PLN02466, aldehyde dehydrogenase family 3e-11
PLN00412 496 PLN00412, PLN00412, NADP-dependent glyceraldehyde- 7e-11
cd07559 480 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophu 4e-10
TIGR01722 477 TIGR01722, MMSDH, methylmalonic acid semialdehyde 4e-10
cd07148 455 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL031 2e-09
cd07083500 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent 3e-08
TIGR04284 480 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, 4e-08
cd07116 479 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD 7e-08
PLN02419 604 PLN02419, PLN02419, methylmalonate-semialdehyde de 2e-07
cd07098 465 cd07098, ALDH_F15-22, Aldehyde dehydrogenase famil 2e-07
PRK13968 462 PRK13968, PRK13968, putative succinate semialdehyd 9e-07
cd07100 429 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tubercul 1e-06
PLN02315 508 PLN02315, PLN02315, aldehyde dehydrogenase family 3e-06
cd07124512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 8e-06
PRK03137514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 6e-05
cd07125518 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car 9e-05
cd07126 489 cd07126, ALDH_F12_P5CDH, Delta(1)-pyrroline-5-carb 1e-04
PTZ00381 493 PTZ00381, PTZ00381, aldehyde dehydrogenase family 3e-04
TIGR01237511 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carb 4e-04
PRK119041038 PRK11904, PRK11904, bifunctional proline dehydroge 7e-04
COG4230769 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate 0.001
PRK11903 521 PRK11903, PRK11903, aldehyde dehydrogenase; Provis 0.001
PRK119051208 PRK11905, PRK11905, bifunctional proline dehydroge 0.003
PRK118091318 PRK11809, putA, trifunctional transcriptional regu 0.003
cd07134 433 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehy 0.003
>gnl|CDD|143441 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
 Score =  346 bits (889), Expect = e-115
 Identities = 113/162 (69%), Positives = 137/162 (84%)

Query: 196 GLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGV 255
            L+GFV AVSPFNFTAIGGNLA  PALMG+ VLWKPSDTA+LSNY +YKI+ EAG+PPGV
Sbjct: 169 PLEGFVYAVSPFNFTAIGGNLAGAPALMGNVVLWKPSDTAVLSNYLVYKILEEAGLPPGV 228

Query: 256 VNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLIGECGGK 315
           +NFVP DGPV GDT+ ASP+LAG++FTGS PTF  LW Q+G+N++ Y+ +PR++GE GGK
Sbjct: 229 INFVPGDGPVVGDTVLASPHLAGLHFTGSTPTFKSLWKQIGENLDRYRTYPRIVGETGGK 288

Query: 316 NFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPESL 357
           NFH +H SA+V+S+V  T+R AFEY GQKCSA SR YVPESL
Sbjct: 289 NFHLVHPSADVDSLVTATVRGAFEYQGQKCSAASRAYVPESL 330


Delta(1)-pyrroline-5-carboxylate dehydrogenase (EC=1.5.1.12 ), families 4 and 17: a proline catabolic enzyme of the aldehyde dehydrogenase (ALDH) protein superfamily. Delta(1)-pyrroline-5-carboxylate dehydrogenase (P5CDH), also known as ALDH4A1 in humans, is a mitochondrial homodimer involved in proline degradation and catalyzes the NAD + -dependent conversion of P5C to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes. Also included in this CD is the Aldh17 Drosophila melanogaster (Q9VUC0) P5CDH and similar sequences. Length = 522

>gnl|CDD|233324 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>gnl|CDD|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143415 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>gnl|CDD|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>gnl|CDD|200087 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143463 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143430 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>gnl|CDD|143431 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>gnl|CDD|143437 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|237017 PRK11904, PRK11904, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143467 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143449 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>gnl|CDD|233325 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>gnl|CDD|143413 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>gnl|CDD|143401 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>gnl|CDD|200131 TIGR01804, BADH, glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>gnl|CDD|236501 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>gnl|CDD|143414 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>gnl|CDD|237018 PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143427 cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>gnl|CDD|143424 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>gnl|CDD|236989 PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143425 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>gnl|CDD|181873 PRK09457, astD, succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|215157 PLN02278, PLN02278, succinic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143423 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>gnl|CDD|143448 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>gnl|CDD|132260 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|188167 TIGR01780, SSADH, succinate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>gnl|CDD|131352 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143411 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|143441 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>gnl|CDD|143429 cd07111, ALDH_F16, Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>gnl|CDD|132284 TIGR03240, arg_catab_astD, succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143459 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>gnl|CDD|183918 PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182108 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143464 cd07146, ALDH_PhpJ, Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>gnl|CDD|143441 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>gnl|CDD|143461 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>gnl|CDD|132294 TIGR03250, PhnAcAld_DH, putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143438 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>gnl|CDD|183050 PRK11241, gabD, succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|215260 PLN02467, PLN02467, betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>gnl|CDD|237391 PRK13473, PRK13473, gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143417 cd07099, ALDH_DDALDH, Methylomonas sp Back     alignment and domain information
>gnl|CDD|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase Back     alignment and domain information
>gnl|CDD|182233 PRK10090, PRK10090, aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|233324 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>gnl|CDD|143465 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>gnl|CDD|143458 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>gnl|CDD|143435 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|215410 PLN02766, PLN02766, coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143403 cd07084, ALDH_KGSADH-like, ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>gnl|CDD|215259 PLN02466, PLN02466, aldehyde dehydrogenase family 2 member Back     alignment and domain information
>gnl|CDD|215110 PLN00412, PLN00412, NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143471 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>gnl|CDD|130783 TIGR01722, MMSDH, methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143466 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|212007 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, Rv0768 family Back     alignment and domain information
>gnl|CDD|143434 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|166060 PLN02419, PLN02419, methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>gnl|CDD|143416 cd07098, ALDH_F15-22, Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>gnl|CDD|184426 PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143418 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>gnl|CDD|177949 PLN02315, PLN02315, aldehyde dehydrogenase family 7 member Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>gnl|CDD|143444 cd07126, ALDH_F12_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>gnl|CDD|240392 PTZ00381, PTZ00381, aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>gnl|CDD|200087 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>gnl|CDD|237017 PRK11904, PRK11904, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237016 PRK11903, PRK11903, aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237018 PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|236989 PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 428
KOG2455|consensus 561 100.0
cd07123 522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 100.0
TIGR01236 533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 100.0
KOG2451|consensus 503 100.0
KOG2450|consensus 501 100.0
PRK03137 514 1-pyrroline-5-carboxylate dehydrogenase; Provision 100.0
cd07124 512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 100.0
COG1012 472 PutA NAD-dependent aldehyde dehydrogenases [Energy 100.0
TIGR01237 511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 100.0
TIGR01238 500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 100.0
PRK11241 482 gabD succinate-semialdehyde dehydrogenase I; Provi 100.0
PLN02419 604 methylmalonate-semialdehyde dehydrogenase [acylati 100.0
PLN02315 508 aldehyde dehydrogenase family 7 member 100.0
PLN02278 498 succinic semialdehyde dehydrogenase 100.0
cd07083 500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 100.0
PLN02766 501 coniferyl-aldehyde dehydrogenase 100.0
TIGR03374 472 ABALDH 1-pyrroline dehydrogenase. Members of this 100.0
cd07142 476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 100.0
cd07097 473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 100.0
cd07111 480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 100.0
PRK11904 1038 bifunctional proline dehydrogenase/pyrroline-5-car 100.0
PRK13252 488 betaine aldehyde dehydrogenase; Provisional 100.0
PLN02466 538 aldehyde dehydrogenase family 2 member 100.0
PLN02467 503 betaine aldehyde dehydrogenase 100.0
cd07140 486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 100.0
cd07113 477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 100.0
TIGR03216 481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 100.0
cd07117 475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 100.0
TIGR02299 488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 100.0
PRK11809 1318 putA trifunctional transcriptional regulator/proli 100.0
cd07085 478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 100.0
cd07559 480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 100.0
PRK11905 1208 bifunctional proline dehydrogenase/pyrroline-5-car 100.0
cd07138 466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 100.0
PRK09457 487 astD succinylglutamic semialdehyde dehydrogenase; 100.0
cd07143 481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 100.0
TIGR01804 467 BADH glycine betaine aldehyde dehydrogenase. Betai 100.0
cd07141 481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 100.0
cd07125 518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 100.0
cd07116 479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 100.0
cd07130 474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 100.0
PRK13473 475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 100.0
cd07119 482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 100.0
PRK09847 494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 100.0
cd07144 484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 100.0
cd07086 478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 100.0
cd07091 476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 100.0
PRK13968 462 putative succinate semialdehyde dehydrogenase; Pro 100.0
TIGR03240 484 arg_catab_astD succinylglutamic semialdehyde dehyd 100.0
cd07131 478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 100.0
cd07088 468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 100.0
TIGR01722 477 MMSDH methylmalonic acid semialdehyde dehydrogenas 100.0
cd07139 471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 100.0
cd07126 489 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de 100.0
cd07151 465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 100.0
PRK09406 457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 100.0
cd07128 513 ALDH_MaoC-N N-terminal domain of the monoamine oxi 100.0
PLN00412 496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 100.0
TIGR01780 448 SSADH succinate-semialdehyde dehydrogenase. SSADH 100.0
TIGR03250 472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 100.0
cd07110 456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 100.0
PRK11903 521 aldehyde dehydrogenase; Provisional 100.0
cd07109 454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 100.0
cd07118 454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 100.0
cd07145 456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 100.0
cd07120 455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 100.0
cd07150 451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 100.0
TIGR02278 663 PaaN-DH phenylacetic acid degradation protein paaN 100.0
cd07089 459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 100.0
cd07107 456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 100.0
cd07090 457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 100.0
cd07148 455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 100.0
cd07115 453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 100.0
PRK09407 524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 100.0
PRK11563 675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 100.0
PF00171 462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 100.0
cd07082 473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 100.0
cd07112 462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 100.0
cd07106 446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 100.0
cd07101 454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 100.0
cd07103 451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 100.0
cd07102 452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 100.0
cd07114 457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 100.0
cd07092 450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 100.0
COG4230 769 Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene 100.0
cd07152 443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 100.0
cd07108 457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 100.0
cd07093 455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 100.0
cd07094 453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 100.0
cd07099 453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 100.0
cd07127 549 ALDH_PAD-PaaZ Phenylacetic acid degradation protei 100.0
cd07098 465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 100.0
TIGR02288 551 PaaN_2 phenylacetic acid degradation protein paaN. 100.0
cd07147 452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 100.0
PLN02174 484 aldehyde dehydrogenase family 3 member H1 100.0
cd07146 451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 100.0
cd07149 453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 100.0
cd07100 429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 100.0
cd07095 431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 100.0
cd07081 439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 100.0
cd07105 432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 100.0
cd07121 429 ALDH_EutE Ethanolamine utilization protein EutE-li 100.0
cd07135 436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 100.0
PRK15398 465 aldehyde dehydrogenase EutE; Provisional 100.0
PLN02203 484 aldehyde dehydrogenase 100.0
cd07136 449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 100.0
cd07104 431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 100.0
PTZ00381 493 aldehyde dehydrogenase family protein; Provisional 100.0
cd07122 436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 100.0
cd07137 432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 100.0
cd07129 454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 100.0
cd07133 434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 100.0
cd07084 442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 100.0
cd07132 443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 100.0
cd07087 426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 100.0
cd07134 433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 100.0
PRK10090 409 aldehyde dehydrogenase A; Provisional 100.0
TIGR02518 488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 100.0
PRK00197417 proA gamma-glutamyl phosphate reductase; Provision 100.0
cd07079406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 100.0
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 100.0
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 100.0
cd07077397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 100.0
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 100.0
cd07078 432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 100.0
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 100.0
KOG2456|consensus 477 100.0
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 100.0
KOG2452|consensus 881 100.0
KOG2454|consensus 583 100.0
KOG2453|consensus 507 100.0
cd07080422 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC. Ac 99.97
COG0014417 ProA Gamma-glutamyl phosphate reductase [Amino aci 99.84
KOG4165|consensus433 99.72
PF05893399 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR0086 99.44
PRK119051208 bifunctional proline dehydrogenase/pyrroline-5-car 98.55
PRK118091318 putA trifunctional transcriptional regulator/proli 95.6
PF07368215 DUF1487: Protein of unknown function (DUF1487); In 95.31
KOG2455|consensus561 81.89
>KOG2455|consensus Back     alignment and domain information
Probab=100.00  E-value=9e-66  Score=507.01  Aligned_cols=334  Identities=49%  Similarity=0.756  Sum_probs=306.8

Q ss_pred             ccccCCCccCCCCCCCCCCCcHHHHHHHHHHHHhccCCcccCeEEcCEEeecCCeeeeccccccccccccCCCCCeeEEE
Q psy1960          23 LLILDRYNVQETPEWTYLPGSKEREAITAALKRVGSTVEEVPIVIGSKEYKTEHVQYQPMVSLHVQYQPMPHNHKKKIAK  102 (428)
Q Consensus        23 ~~~~~~~~~~n~p~~~~~~~s~~r~~~~~al~~~~~~~~~ip~~IgG~~v~s~~~~~~~~~~~~~~~~~~P~~~g~~ia~  102 (428)
                      +.+-....+.|||...|.++|++|..+++|++..+.++.++|++|||+++.+.+.++          +++|++|+.++++
T Consensus        20 ~~~~~~~~i~neP~~~~~~~s~er~~l~~A~~~~~~~~~evP~vIg~~~v~t~~~q~----------q~~P~~hq~~lA~   89 (561)
T KOG2455|consen   20 DEDKQPKKIANEPVLEYRKISKERVDLEKALKELQKRPLEVPLVIGDKEVYTNDEQY----------QVCPHNHQHVLAK   89 (561)
T ss_pred             ccccCCccccCCCccccCCCCHHHHHHHHHHHHHhcCceeccEEECCeeeecCCccc----------ccCCchhhhhhhh
Confidence            344556679999999999999999999999999998899999999999999988776          8999999999999


Q ss_pred             EeCCCHhH-HHHHHHHh-ccCccccCChhhhhhhhhhHHHHHHHHHHHHHHHhhccchhHHHHHHHhcCCCCCcccc---
Q psy1960         103 FYYATPVL-KSALDIVS-SLCPYEKNSVGLLINTEVLHDDLYFRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGGRM---  177 (428)
Q Consensus       103 v~~a~~~~-~~Av~aA~-A~~~W~~~~~~~R~~~~~~~~~iL~~~~a~l~~L~~~~~~~~~~~~~l~~gkp~~~~~~---  177 (428)
                      +.+|+.++ ++||++|. |++.|..+|..+|.       +|++|+ |++  ++..+++....+-.+.+||.+.++..   
T Consensus        90 ~~yA~~k~ie~AIkaAl~a~~~W~~~PiadR~-------aI~lkA-Adl--istkyr~~l~aatMlgqgKt~~qAeiDa~  159 (561)
T KOG2455|consen   90 VYYATKKQIEKAIKAALSAQKTWELVPIADRL-------AIFLKA-ADL--ISTKYRYDLLAATMLGQGKTAIQAEIDAA  159 (561)
T ss_pred             eeeccHHHHHHHHHHHHhhcCccccCcHHHHH-------HHHHHH-HHH--hcchHHHHHHHHHHhcCCcchHHHHHHHH
Confidence            99999999 99999999 99999999999999       999999 999  99777633333344567777765544   


Q ss_pred             ----hhhhhhhc--------------cccccceeeecccceEEEECCCchhhhhhHhhhhhhcCCCEEEEeCCccchHHH
Q psy1960         178 ----SALTFYLE--------------VLASNLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSN  239 (428)
Q Consensus       178 ----~~l~~~~~--------------~~~~~~~~~~~p~GVV~~I~P~NfP~~~~~~~iapALaGN~VVlKPs~~apl~a  239 (428)
                          +++|+.+.              .+..|++.||+..|+|++|+||||.++.+++..+||||||+|+||||..+.+++
T Consensus       160 ~eLidf~R~na~ya~eL~~~qpi~~~~~t~ns~~yRpleGFVaAisPFnftAI~gnLa~aPaLMGN~VLwkPS~ta~lss  239 (561)
T KOG2455|consen  160 AELIDFFRFNAKYASELYAQQPISQTKGTWNSMEYRPLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAALSS  239 (561)
T ss_pred             HHHHHHHHHhHHHHHHhhhcCCccccCCCCcceeeccccceeEEecccceeeeccccccChhhhcceeeecccchhHHHH
Confidence                34554432              245788999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHcCCCCccEEEeeCCChhhhhhhhcCCCeeEEEeeCChhhHHHHHHHHhcccCcccCCCcEEEecCCCceeE
Q psy1960         240 YTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLIGECGGKNFHF  319 (428)
Q Consensus       240 ~~l~~ll~eAGlP~gvv~vv~g~g~~~g~~L~~~~~v~~I~fTGS~~~g~~i~~~~a~~~~~~~~~~~~~lElGGkn~~i  319 (428)
                      +++.++|+|||+|+|++|+||+|+..+++.++++|++.++.||||+.+.+++|++.++++..|++|||+++|+||||.++
T Consensus       240 Yii~~il~EAGlP~GvinFvPad~~~f~dtita~~hfaglnftgS~~~fk~lwk~V~~n~~~Y~~fPrlvgEcgGkNFHf  319 (561)
T KOG2455|consen  240 YIIYRILREAGLPPGVINFVPADGPLFGDTITASPHFAGLNFTGSVPTFKHLWKKVGENVDNYRTFPRLVGECGGKNFHF  319 (561)
T ss_pred             HHHHHHHHHcCCCccceeeccCCCCeecceeccCcccceeeeecccHHHHHHHHHHHhhhhhhhcchhhhccCCCcceEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EcCCCCHHHHHHHHHHHHhhcCCCccccCceEEEeCCchHHHHHHHHHHHhcCCcce
Q psy1960         320 IHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPESLFCFCSCFLLLFLFSASVPV  376 (428)
Q Consensus       320 V~~dADld~Aa~~iv~saf~~~GQ~C~a~srv~V~~si~d~f~~~L~~~l~~l~v~~  376 (428)
                      ||++||++.++..+++++|.++||+|+|+||+||++|+|+++.++|.+...++.+.-
T Consensus       320 VH~SA~VesvV~~TvrsAfey~GQkcsA~SRmYvp~s~wp~i~e~l~~~~~q~~igd  376 (561)
T KOG2455|consen  320 VHASADVESVVSSTVRSAFEYQGQKCSACSRMYVPESLWPQIREELVEEHSQLKIGD  376 (561)
T ss_pred             eccccchHHHHHHHHHHHHhhcccccchhhhcccchhhcHHHHHHHHHHHhhcccCC
Confidence            999999999999999999999999999999999999999999999999999877654



>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>KOG2451|consensus Back     alignment and domain information
>KOG2450|consensus Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>PRK11903 aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>cd07127 ALDH_PAD-PaaZ Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>KOG2456|consensus Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>KOG2452|consensus Back     alignment and domain information
>KOG2454|consensus Back     alignment and domain information
>KOG2453|consensus Back     alignment and domain information
>cd07080 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC Back     alignment and domain information
>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4165|consensus Back     alignment and domain information
>PF05893 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR008670 This family consists of several bacterial Acyl-CoA reductase (LuxC) proteins Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PF07368 DUF1487: Protein of unknown function (DUF1487); InterPro: IPR009961 This family consists of several uncharacterised proteins from Drosophila melanogaster Back     alignment and domain information
>KOG2455|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query428
3v9j_A 563 Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylat 6e-79
3v9g_A 566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 9e-79
3v9h_A 566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 2e-78
3v9i_A 566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 5e-78
1uzb_A 516 1-pyrroline-5-carboxylate Dehydrogenase Length = 51 5e-20
4f9i_A 1026 Crystal Structure Of Proline Utilization A (Puta) F 8e-20
2bhp_A 516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 1e-19
2bja_A 516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 2e-18
3rjl_A 538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 2e-18
3qan_A 538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 8e-18
3i44_A 497 Crystal Structure Of Aldehyde Dehydrogenase From Ba 1e-16
3ed6_A 520 1.7 Angstrom Resolution Crystal Structure Of Betain 2e-15
3jz4_C 481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 4e-15
3jz4_A 481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 4e-15
1euh_A 475 Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase 1e-14
3haz_A 1001 Crystal Structure Of Bifunctional Proline Utilizati 1e-14
1bi9_A 499 Retinal Dehydrogenase Type Two With Nad Bound Lengt 2e-14
2id2_A 475 Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 3e-14
1o9j_A 501 The X-Ray Crystal Structure Of Eta-Crystallin Lengt 4e-14
2d4e_A 515 Crystal Structure Of The Hpcc From Thermus Thermoph 6e-14
1bxs_A 501 Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad 6e-14
2esd_A 475 Crystal Structure Of Thioacylenzyme Intermediate Of 7e-14
1qi1_A 475 Ternary Complex Of An Nadp Dependent Aldehyde Dehyd 1e-13
3prl_A 505 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 5e-13
4a0m_A 496 Crystal Structure Of Betaine Aldehyde Dehydrogenase 6e-13
3ty7_A 478 Crystal Structure Of Aldehyde Dehydrogenase Family 8e-13
4fr8_A 500 Crystal Structure Of Human Aldehyde Dehydrogenase-2 1e-12
1ag8_A 499 Aldehyde Dehydrogenase From Bovine Mitochondria Len 1e-12
3ju8_A 490 Crystal Structure Of Succinylglutamic Semialdehyde 2e-12
4dng_A 485 Crystal Structure Of Putative Aldehyde Dehydrogenas 3e-12
2onn_A 500 Arg475gln Mutant Of Human Mitochondrial Aldehyde De 4e-12
1zum_A 500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 4e-12
1cw3_A 494 Human Mitochondrial Aldehyde Dehydrogenase Complexe 4e-12
1o05_A 500 Apo Form Of Human Mitochondrial Aldehyde Dehydrogen 4e-12
3r31_A 517 Crystal Structure Of Betaine Aldehyde Dehydrogenase 5e-12
3pqa_A 486 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 5e-12
3ifg_A 484 Crystal Structure Of Succinate-Semialdehyde Dehydro 6e-12
4dal_A 498 Crystal Structure Of Putative Aldehyde Dehydrogenas 8e-12
3k2w_A 497 Crystal Structure Of Betaine-Aldehyde Dehydrogenase 1e-11
3n81_A 500 T244a Mutant Of Human Mitochondrial Aldehyde Dehydr 1e-11
1wnb_A 495 Escherichia Coli Ydcw Gene Product Is A Medium-Chai 1e-11
4i8p_A 520 Crystal Structure Of Aminoaldehyde Dehydrogenase 1a 2e-11
2imp_A 479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 3e-11
2opx_A 479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 3e-11
2hg2_A 479 Structure Of Lactaldehyde Dehydrogenase Length = 47 3e-11
2o2p_A 517 Crystal Structure Of The C-Terminal Domain Of Rat 1 4e-11
3inl_A 500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 5e-11
1nzw_A 500 Cys302ser Mutant Of Human Mitochondrial Aldehyde De 5e-11
1a4s_A 503 Betaine Aldehyde Dehydrogenase From Cod Liver Lengt 6e-11
3n80_A 500 Human Mitochondrial Aldehyde Dehydrogenase, Apo For 6e-11
3rhm_A 517 Crystal Structure Of The E673q Mutant Of C-Terminal 8e-11
2w8n_A 487 The Crytal Structure Of The Oxidized Form Of Human 1e-10
4e4g_A 521 Crystal Structure Of Putative Methylmalonate-Semial 1e-10
2wox_A 489 Betaine Aldehyde Dehydrogenase From Pseudomonas Aer 2e-10
2wme_A 490 Crystallographic Structure Of Betaine Aldehyde Dehy 2e-10
3rhj_A 517 Crystal Structure Of The E673a Mutant Of The C-Term 2e-10
1t90_A 486 Crystal Structure Of Methylmalonate Semialdehyde De 3e-10
3rhr_A 517 Crystal Structure Of The C707a Mutant Of The C-Term 4e-10
4gnz_A 517 Crystal Structure Of The C707s Mutant Of C-terminal 5e-10
2xdr_A 489 Crystallographic Structure Of Betaine Aldehyde Dehy 1e-09
2w8p_A 487 The Crystal Structure Of Human C340a Ssadh Length = 1e-09
3zqa_A 490 Crystallographic Structure Of Betaine Aldehyde Dehy 2e-09
3rhl_A 517 Crystal Structure Of The E673aC707A DOUBLE MUTANT O 2e-09
2wme_C 490 Crystallographic Structure Of Betaine Aldehyde Dehy 3e-09
1uxv_A 501 Structural Basis For Allosteric Regulation And Subs 1e-08
1ky8_A 501 Crystal Structure Of The Non-Phosphorylating Glycer 1e-08
1uxn_A 501 Structural Basis For Allosteric Regulation And Subs 1e-08
3iwk_A 503 Crystal Structure Of Aminoaldehyde Dehydrogenase 1 5e-08
3iwj_A 503 Crystal Structure Of Aminoaldehyde Dehydrogenase 2 7e-08
3ek1_A 504 Crystal Structure Of Aldehyde Dehydrogenase From Br 8e-08
2j6l_A 500 Structure Of Aminoadipate-Semialdehyde Dehydrogenas 9e-08
4i9b_A 517 Structure Of Aminoaldehyde Dehydrogenase 1 From Sol 3e-07
3u4j_A 528 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 3e-07
4i8q_A 514 Structure Of The Aminoaldehyde Dehydrogenase 1 E260 6e-07
3r64_A 508 Crystal Structure Of A Nad-Dependent Benzaldehyde D 2e-06
2jg7_A 510 Crystal Structure Of Seabream Antiquitin And Elucid 4e-06
3efv_A 462 Crystal Structure Of A Putative Succinate-Semialdeh 5e-06
4h7n_A 474 The Structure Of Putative Aldehyde Dehydrogenase Pu 9e-05
3b4w_A 495 Crystal Structure Of Mycobacterium Tuberculosis Ald 1e-04
2y51_A 534 Crystal Structure Of E167a Mutant Of The Box Pathwa 2e-04
2vro_A 532 Crystal Structure Of Aldehyde Dehydrogenase From Bu 3e-04
2y52_A 534 Crystal Structure Of E496a Mutant Of The Box Pathwa 3e-04
3lv1_A 457 Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehy 5e-04
2y53_A 534 Crystal Structure Of E257q Mutant Of The Box Pathwa 7e-04
>pdb|3V9J|A Chain A, Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylate Dehydrogenase Complexed With Sulfate Ion Length = 563 Back     alignment and structure

Iteration: 1

Score = 291 bits (744), Expect = 6e-79, Method: Compositional matrix adjust. Identities = 159/349 (45%), Positives = 205/349 (58%), Gaps = 44/349 (12%) Query: 30 NVQETPEWTYLPGSKEREAITAALKRVGSTVEEVPIVIGSKEYKTEHVQYQPMVSLHVQY 89 V P + GS ER+A+ ALK + E +P V+G +E T +QYQ Sbjct: 31 KVANEPILAFSQGSPERDALQKALKDLKGQTEAIPCVVGDEEVWTSDIQYQLS------- 83 Query: 90 QPMPHNHKKKIAKFYYA-TPVLKSALDIVSS------LCPYEKNSVGLLINTEVLHDDLY 142 P NH K+AKF YA +L A+D + L P + L ++L Sbjct: 84 ---PFNHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSGPRR 140 Query: 143 FRCLDDLKYAAGNYYI----------------NDKSTGSVVGQQPFGGGRMSALTFYLEV 186 L G I N K + G+QP + T Y Sbjct: 141 AEVLAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAVELEGEQPISVPPSTNHTVY--- 197 Query: 187 LASNLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIM 246 GL+GFVAA+SPFNFTAIGGNLA PALMG+ VLWKPSDTA+L++Y +Y+I+ Sbjct: 198 --------RGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRIL 249 Query: 247 IEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFP 306 EAG+PP ++ FVPADGP FGDT+T+S +L GINFTGSVPTF LW QV +N++ ++ FP Sbjct: 250 REAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNLDRFRTFP 309 Query: 307 RLIGECGGKNFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPE 355 RL GECGGKNFHF+H+SA+V+SVV+GT+RSAFEY GQKCSACSR+YVP+ Sbjct: 310 RLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPK 358
>pdb|3V9G|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Length = 566 Back     alignment and structure
>pdb|3V9H|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352a Length = 566 Back     alignment and structure
>pdb|3V9I|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352l Length = 566 Back     alignment and structure
>pdb|1UZB|A Chain A, 1-pyrroline-5-carboxylate Dehydrogenase Length = 516 Back     alignment and structure
>pdb|4F9I|A Chain A, Crystal Structure Of Proline Utilization A (Puta) From Geobacter Sulfurreducens Pca Length = 1026 Back     alignment and structure
>pdb|2BHP|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nad. Length = 516 Back     alignment and structure
>pdb|2BJA|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nadh Length = 516 Back     alignment and structure
>pdb|3RJL|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Licheniformis (Target Nysgrc-000337) Length = 538 Back     alignment and structure
>pdb|3QAN|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Halodurans Length = 538 Back     alignment and structure
>pdb|3I44|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Bartonella Henselae At 2.0a Resolution Length = 497 Back     alignment and structure
>pdb|3ED6|A Chain A, 1.7 Angstrom Resolution Crystal Structure Of Betaine Aldehyde Dehydrogenase (Betb) From Staphylococcus Aureus Length = 520 Back     alignment and structure
>pdb|3JZ4|C Chain C, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|3JZ4|A Chain A, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|1EUH|A Chain A, Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase From Streptococcus Mutans Length = 475 Back     alignment and structure
>pdb|3HAZ|A Chain A, Crystal Structure Of Bifunctional Proline Utilization A (Puta) Protein Length = 1001 Back     alignment and structure
>pdb|1BI9|A Chain A, Retinal Dehydrogenase Type Two With Nad Bound Length = 499 Back     alignment and structure
>pdb|2ID2|A Chain A, Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 475 Back     alignment and structure
>pdb|1O9J|A Chain A, The X-Ray Crystal Structure Of Eta-Crystallin Length = 501 Back     alignment and structure
>pdb|2D4E|A Chain A, Crystal Structure Of The Hpcc From Thermus Thermophilus Hb8 Length = 515 Back     alignment and structure
>pdb|1BXS|A Chain A, Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad Bound Length = 501 Back     alignment and structure
>pdb|2ESD|A Chain A, Crystal Structure Of Thioacylenzyme Intermediate Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|1QI1|A Chain A, Ternary Complex Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|3PRL|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Halodurans C-125 Length = 505 Back     alignment and structure
>pdb|4A0M|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Spinach In Complex With Nad Length = 496 Back     alignment and structure
>pdb|3TY7|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase Family Protein From Staphylococcus Aureus Length = 478 Back     alignment and structure
>pdb|4FR8|A Chain A, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In Complex With Nitroglycerin Length = 500 Back     alignment and structure
>pdb|1AG8|A Chain A, Aldehyde Dehydrogenase From Bovine Mitochondria Length = 499 Back     alignment and structure
>pdb|3JU8|A Chain A, Crystal Structure Of Succinylglutamic Semialdehyde Dehydrogenase From Pseudomonas Aeruginosa. Length = 490 Back     alignment and structure
>pdb|4DNG|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Bacillus Subtilis Subsp. Subtilis Str. 168 Length = 485 Back     alignment and structure
>pdb|2ONN|A Chain A, Arg475gln Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|1ZUM|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Apo Form Length = 500 Back     alignment and structure
>pdb|1CW3|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nad+ And Mn2+ Length = 494 Back     alignment and structure
>pdb|1O05|A Chain A, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|3R31|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Agrobacterium Tumefaciens Length = 517 Back     alignment and structure
>pdb|3PQA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Gapn From Methanocaldococcus Jannaschii Dsm 2661 Length = 486 Back     alignment and structure
>pdb|3IFG|A Chain A, Crystal Structure Of Succinate-Semialdehyde Dehydrogenase From Burkholderia Pseudomallei, Part 1 Of 2 Length = 484 Back     alignment and structure
>pdb|4DAL|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 498 Back     alignment and structure
>pdb|3K2W|A Chain A, Crystal Structure Of Betaine-Aldehyde Dehydrogenase From Pseudoalteromonas Atlantica T6c Length = 497 Back     alignment and structure
>pdb|3N81|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|1WNB|A Chain A, Escherichia Coli Ydcw Gene Product Is A Medium-Chain Aldehyde Dehydrogenase (Complexed With Nadh And Betaine Aldehyde) Length = 495 Back     alignment and structure
>pdb|4I8P|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1a From Zea Mays (zmamadh1a) Length = 520 Back     alignment and structure
>pdb|2IMP|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From E. Coli: The Ternary Complex With Product Bound (L)-Lactate And Nadh. Length = 479 Back     alignment and structure
>pdb|2OPX|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From Escherichia Coli Length = 479 Back     alignment and structure
>pdb|2HG2|A Chain A, Structure Of Lactaldehyde Dehydrogenase Length = 479 Back     alignment and structure
>pdb|2O2P|A Chain A, Crystal Structure Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|3INL|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Complexed With Agonist Alda-1 Length = 500 Back     alignment and structure
>pdb|1NZW|A Chain A, Cys302ser Mutant Of Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nadh And Mg2+ Length = 500 Back     alignment and structure
>pdb|1A4S|A Chain A, Betaine Aldehyde Dehydrogenase From Cod Liver Length = 503 Back     alignment and structure
>pdb|3N80|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|3RHM|A Chain A, Crystal Structure Of The E673q Mutant Of C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|2W8N|A Chain A, The Crytal Structure Of The Oxidized Form Of Human Ssadh Length = 487 Back     alignment and structure
>pdb|4E4G|A Chain A, Crystal Structure Of Putative Methylmalonate-Semialdehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 521 Back     alignment and structure
>pdb|2WOX|A Chain A, Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa With Nad(P)h-Catalytic Thiol Adduct. Length = 489 Back     alignment and structure
>pdb|2WME|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|3RHJ|A Chain A, Crystal Structure Of The E673a Mutant Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|1T90|A Chain A, Crystal Structure Of Methylmalonate Semialdehyde Dehydrogenase From Bacillus Subtilis Length = 486 Back     alignment and structure
>pdb|3RHR|A Chain A, Crystal Structure Of The C707a Mutant Of The C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadph Length = 517 Back     alignment and structure
>pdb|4GNZ|A Chain A, Crystal Structure Of The C707s Mutant Of C-terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadp Length = 517 Back     alignment and structure
>pdb|2XDR|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant E252a From Pseudomonas Aeruginosa Length = 489 Back     alignment and structure
>pdb|2W8P|A Chain A, The Crystal Structure Of Human C340a Ssadh Length = 487 Back     alignment and structure
>pdb|3ZQA|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant C286a From Pseudomonas Aeruginosa In Complex With Nadph Length = 490 Back     alignment and structure
>pdb|3RHL|A Chain A, Crystal Structure Of The E673aC707A DOUBLE MUTANT OF THE C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|2WME|C Chain C, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|1UXV|A Chain A, Structural Basis For Allosteric Regulation And Substrate Specificity Of The Non-Phosphorylating Glyceraldehyde-3-Phosphate Dehydrogenase (Gapn) From Thermoproteus Tenax Length = 501 Back     alignment and structure
>pdb|1KY8|A Chain A, Crystal Structure Of The Non-Phosphorylating Glyceraldehyde-3- Phosphate Dehydrogenase Length = 501 Back     alignment and structure
>pdb|1UXN|A Chain A, Structural Basis For Allosteric Regulation And Substrate Specificity Of The Non-Phosphorylating Glyceraldehyde-3-Phosphate Dehydrogenase (Gapn) From Thermoproteus Tenax Length = 501 Back     alignment and structure
>pdb|3IWK|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1 From Pisum Sativum (Psamadh1) Length = 503 Back     alignment and structure
>pdb|3IWJ|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 2 From Pisum Sativum (Psamadh2) Length = 503 Back     alignment and structure
>pdb|3EK1|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Brucella Melitensis Biovar Abortus 2308 Length = 504 Back     alignment and structure
>pdb|2J6L|A Chain A, Structure Of Aminoadipate-Semialdehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|4I9B|A Chain A, Structure Of Aminoaldehyde Dehydrogenase 1 From Solanum Lycopersium (slamadh1) With A Thiohemiacetal Intermediate Length = 517 Back     alignment and structure
>pdb|3U4J|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Sinorhizobium Meliloti Length = 528 Back     alignment and structure
>pdb|4I8Q|A Chain A, Structure Of The Aminoaldehyde Dehydrogenase 1 E260a Mutant From Solanum Lycopersicum (slamadh1-e260a) Length = 514 Back     alignment and structure
>pdb|3R64|A Chain A, Crystal Structure Of A Nad-Dependent Benzaldehyde Dehydrogenase From Corynebacterium Glutamicum Length = 508 Back     alignment and structure
>pdb|2JG7|A Chain A, Crystal Structure Of Seabream Antiquitin And Elucidation Of Its Substrate Specificity Length = 510 Back     alignment and structure
>pdb|3EFV|A Chain A, Crystal Structure Of A Putative Succinate-Semialdehyde Dehydrogenase From Salmonella Typhimurium Lt2 With Bound Nad Length = 462 Back     alignment and structure
>pdb|4H7N|A Chain A, The Structure Of Putative Aldehyde Dehydrogenase Puta From Anabaena Variabilis. Length = 474 Back     alignment and structure
>pdb|3B4W|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Aldehyde Dehydrogenase Complexed With Nad+ Length = 495 Back     alignment and structure
>pdb|2Y51|A Chain A, Crystal Structure Of E167a Mutant Of The Box Pathway Encoded Aldh From Burkholderia Xenovorans Lb400 Length = 534 Back     alignment and structure
>pdb|2VRO|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Burkholderia Xenovorans Lb400 Length = 532 Back     alignment and structure
>pdb|2Y52|A Chain A, Crystal Structure Of E496a Mutant Of The Box Pathway Encoded Aldh From Burkholderia Xenovorans Lb400 Length = 534 Back     alignment and structure
>pdb|3LV1|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehydrogenase, With Bound Nadp+ Length = 457 Back     alignment and structure
>pdb|2Y53|A Chain A, Crystal Structure Of E257q Mutant Of The Box Pathway Encoded Aldh From Burkholderia Xenovorans Lb400 Length = 534 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query428
4e3x_A 563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 3e-98
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 1e-14
4e3x_A 563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 1e-12
3qan_A 538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 2e-63
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 1e-08
4f9i_A 1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 2e-42
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 1e-06
1uzb_A 516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 2e-40
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 7e-07
3haz_A 1001 Proline dehydrogenase; proline utilization A, PUTA 1e-36
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 2e-08
3prl_A 505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 3e-29
1euh_A 475 NADP dependent non phosphorylating glyceraldehyde- 4e-29
3ju8_A 490 Succinylglutamic semialdehyde dehydrogenase; alpha 4e-28
3r64_A 508 NAD dependent benzaldehyde dehydrogenase; structur 7e-28
3ty7_A 478 Putative aldehyde dehydrogenase SAV2122; structura 2e-26
1uxt_A 501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 4e-26
2y53_A 534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 3e-25
3u4j_A 528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 3e-25
2j6l_A 500 Aldehyde dehydrogenase family 7 member A1; NAD, re 4e-25
3pqa_A 486 Lactaldehyde dehydrogenase; structural genomics, p 4e-25
3i44_A 497 Aldehyde dehydrogenase; oxidoreductase, structural 6e-25
4dng_A 485 Uncharacterized aldehyde dehydrogenase ALDY; struc 3e-24
1ez0_A 510 ALDH, aldehyde dehydrogenase; nucleotide binding d 4e-24
2o2p_A 517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 4e-24
3b4w_A 495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 7e-24
3iwj_A 503 Putative aminoaldehyde dehydrogenase; rossmann fol 1e-23
2d4e_A 515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 4e-23
3k9d_A 464 LMO1179 protein, aldehyde dehydrogenase; structura 4e-23
1o04_A 500 Aldehyde dehydrogenase, mitochondrial precursor; A 5e-23
1bxs_A 501 Aldehyde dehydrogenase; retinal, class 1, tetramer 6e-23
2ve5_A 490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 7e-23
3ed6_A 520 Betaine aldehyde dehydrogenase; structural genomic 2e-22
3my7_A 452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 2e-22
3r31_A 517 BADH, betaine aldehyde dehydrogenase; structural g 5e-22
1a4s_A 503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 3e-21
3v4c_A 528 Aldehyde dehydrogenase (NADP+); structural genomic 4e-21
4f3x_A 498 Putative aldehyde dehydrogenase; structural genomi 7e-21
1wnd_A 495 Putative betaine aldehyde dehydrogenase; NADH, flu 2e-20
2imp_A 479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 2e-19
3k2w_A 497 Betaine-aldehyde dehydrogenase; structural genomic 3e-18
3rh9_A 506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 1e-17
3ek1_A 504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 1e-17
3ifg_A 484 Succinate-semialdehyde dehydrogenase (NADP+); niai 2e-17
3jz4_A 481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 2e-17
1t90_A 486 MMSDH, probable methylmalonate-semialdehyde dehydr 1e-15
2w8n_A 487 Succinate-semialdehyde dehydrogenase, mitochondria 1e-15
4e4g_A 521 Methylmalonate-semialdehyde dehydrogenase; structu 2e-15
3etf_A 462 Putative succinate-semialdehyde dehydrogenase; cen 2e-13
3ros_A 484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 4e-13
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
 Score =  303 bits (779), Expect = 3e-98
 Identities = 116/162 (71%), Positives = 144/162 (88%)

Query: 196 GLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGV 255
           GL+GFVAA+SPFNFTAIGGNLA  PALMG+ VLWKPSDTA+L++Y +Y+I+ EAG+PP +
Sbjct: 199 GLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNI 258

Query: 256 VNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLIGECGGK 315
           + FVPADGP FGDT+T+S +L GINFTGSVPTF  LW QV +N++ ++ FPRL GECGGK
Sbjct: 259 IQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNLDRFRTFPRLAGECGGK 318

Query: 316 NFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPESL 357
           NFHF+H+SA+V+SVV+GT+RSAFEY GQKCSACSR+YVP+SL
Sbjct: 319 NFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPKSL 360


>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Length = 478 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500 Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486 Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Length = 497 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Length = 464 Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Length = 452 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497 Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Length = 506 Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Length = 504 Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Length = 484 Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Length = 486 Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487 Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Length = 521 Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Length = 462 Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query428
4e3x_A 563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 100.0
3qan_A 538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 100.0
2wme_A 490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
4f9i_A 1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 100.0
1uzb_A 516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 100.0
3ifg_A 484 Succinate-semialdehyde dehydrogenase (NADP+); niai 100.0
3ed6_A 520 Betaine aldehyde dehydrogenase; structural genomic 100.0
3ek1_A 504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 100.0
3k2w_A 497 Betaine-aldehyde dehydrogenase; structural genomic 100.0
3rh9_A 506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 100.0
4f3x_A 498 Putative aldehyde dehydrogenase; structural genomi 100.0
3u4j_A 528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 100.0
3i44_A 497 Aldehyde dehydrogenase; oxidoreductase, structural 100.0
3iwj_A 503 Putative aminoaldehyde dehydrogenase; rossmann fol 100.0
4e4g_A 521 Methylmalonate-semialdehyde dehydrogenase; structu 100.0
2o2p_A 517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 100.0
1bxs_A 501 Aldehyde dehydrogenase; retinal, class 1, tetramer 100.0
1a4s_A 503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 100.0
2imp_A 479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 100.0
1o04_A 500 Aldehyde dehydrogenase, mitochondrial precursor; A 100.0
2d4e_A 515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 100.0
3b4w_A 495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 100.0
3r31_A 517 BADH, betaine aldehyde dehydrogenase; structural g 100.0
2ve5_A 490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
3jz4_A 481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 100.0
3prl_A 505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 100.0
1wnd_A 495 Putative betaine aldehyde dehydrogenase; NADH, flu 100.0
2w8n_A 487 Succinate-semialdehyde dehydrogenase, mitochondria 100.0
2j6l_A 500 Aldehyde dehydrogenase family 7 member A1; NAD, re 100.0
3r64_A 508 NAD dependent benzaldehyde dehydrogenase; structur 100.0
4dng_A 485 Uncharacterized aldehyde dehydrogenase ALDY; struc 100.0
1t90_A 486 MMSDH, probable methylmalonate-semialdehyde dehydr 100.0
1euh_A 475 NADP dependent non phosphorylating glyceraldehyde- 100.0
3ty7_A 478 Putative aldehyde dehydrogenase SAV2122; structura 100.0
3pqa_A 486 Lactaldehyde dehydrogenase; structural genomics, p 100.0
1uxt_A 501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 100.0
3ju8_A 490 Succinylglutamic semialdehyde dehydrogenase; alpha 100.0
3ros_A 484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 100.0
3v4c_A 528 Aldehyde dehydrogenase (NADP+); structural genomic 100.0
3etf_A 462 Putative succinate-semialdehyde dehydrogenase; cen 100.0
2y53_A 534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 100.0
1ez0_A 510 ALDH, aldehyde dehydrogenase; nucleotide binding d 100.0
3lns_A 457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 100.0
4h7n_A 474 Aldehyde dehydrogenase; structural genomics, PSI-b 100.0
3haz_A 1001 Proline dehydrogenase; proline utilization A, PUTA 100.0
3sza_A 469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 100.0
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 100.0
3my7_A 452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 100.0
3k9d_A 464 LMO1179 protein, aldehyde dehydrogenase; structura 100.0
4ghk_A444 Gamma-glutamyl phosphate reductase; structural gen 100.0
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 100.0
1vlu_A 468 Gamma-glutamyl phosphate reductase; YOR323C, struc 100.0
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
Probab=100.00  E-value=4.3e-70  Score=579.82  Aligned_cols=339  Identities=46%  Similarity=0.755  Sum_probs=311.3

Q ss_pred             hhhhhhhhccccCCCccCCCCCCCCCCCcHHHHHHHHHHHHhccCCcccCeEEcCEEeecCCeeeeccccccccccccCC
Q psy1960          15 QIEYLHFSLLILDRYNVQETPEWTYLPGSKEREAITAALKRVGSTVEEVPIVIGSKEYKTEHVQYQPMVSLHVQYQPMPH   94 (428)
Q Consensus        15 ~~~~~~~~~~~~~~~~~~n~p~~~~~~~s~~r~~~~~al~~~~~~~~~ip~~IgG~~v~s~~~~~~~~~~~~~~~~~~P~   94 (428)
                      --.|.+++++++.+++++|||+++|.++|++|+++++++++++++..++|++|||+|+.+.+...          ++||+
T Consensus        16 ~~~~~~~~~~~~~~~~~~nep~~~~~~~~~~r~~~~~a~~~~~~~~~~~~~~I~G~~~~~~~~~~----------~~~P~   85 (563)
T 4e3x_A           16 PRGSHMLRWKHTSSLKVANEPILAFSQGSPERDALQKALKDLKGQTEAIPCVVGDEEVWTSDIQY----------QLSPF   85 (563)
T ss_dssp             ----CCCCCCCCCCCCCCCCCCCCCCTTCHHHHHHHHHHHTTTTCCEECCEEETTEEECCSCEEE----------EEETT
T ss_pred             cCCcccccccccCCCCcCCCCCCCCCCCcHHHHHHHHHHHHHHhCCccCCeEECCEEeecCCcee----------eeCCC
Confidence            34688899999999999999999999999999999999999988888999999999998876544          78999


Q ss_pred             CCCeeEEEEeCCCHhH-HHHHHHHh-ccCccccCChhhhhhhhhhHHHHHHHHHHHHHHHhhc-cchhHHHHHHHhcCCC
Q psy1960          95 NHKKKIAKFYYATPVL-KSALDIVS-SLCPYEKNSVGLLINTEVLHDDLYFRCLDDLKYAAGN-YYINDKSTGSVVGQQP  171 (428)
Q Consensus        95 ~~g~~ia~v~~a~~~~-~~Av~aA~-A~~~W~~~~~~~R~~~~~~~~~iL~~~~a~l~~L~~~-~~~~~~~~~~l~~gkp  171 (428)
                      ++++++++++.++.++ ++|+++|+ ||+.|+.++.++|.       ++|+++ +++  |+++ ++ ....+..++.||+
T Consensus        86 ~~~~~i~~~~~a~~~dv~~Av~aA~~A~~~W~~~~~~~R~-------~iL~~~-a~~--l~~~~~~-el~~~~~~e~Gk~  154 (563)
T 4e3x_A           86 NHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPMADRA-------QVFLKA-ADM--LSGPRRA-EVLAKTMVGQGKT  154 (563)
T ss_dssp             EEEEEEEEEECCCHHHHHHHHHHHHHHHHHHHHSCHHHHH-------HHHHHH-HHH--HHTTTHH-HHHHHHHHHHCCC
T ss_pred             CCCcEEEEEeCCCHHHHHHHHHHHHHHHHHHhcCCHHHHH-------HHHHHH-HHH--HHhccHH-HHHHHHHHHcCCC
Confidence            8779999999999999 99999999 99999999999999       999999 999  9988 66 5666677899999


Q ss_pred             CCcccch-------hhhhhhcc-------------ccccceeeecccceEEEECCCchhhhhhHhhhhhhcCCCEEEEeC
Q psy1960         172 FGGGRMS-------ALTFYLEV-------------LASNLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKP  231 (428)
Q Consensus       172 ~~~~~~~-------~l~~~~~~-------------~~~~~~~~~~p~GVV~~I~P~NfP~~~~~~~iapALaGN~VVlKP  231 (428)
                      +.+++.+       .++|++..             +..+.+.+++|+|||++|+|||||+....++++|||+||+||+||
T Consensus       155 ~~ea~~e~v~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~r~p~GVV~~I~PwNfP~~~~~~~~apALaGNtVVlKP  234 (563)
T 4e3x_A          155 VIQAEIDAAAELIDFFRFNAKFAVELEGEQPISVPPSTNHTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKP  234 (563)
T ss_dssp             HHHHHHHTTHHHHHHHHHHHHHHHHHTTCCCCCCTTEEEEEECCBCSSEEEEECCSSCHHHHHHHHHHHHHTTCCEEEEC
T ss_pred             HHHHhHHHHHHHHHHHHHHHHHHHHhhCCCccCCCCCcceEEEecCceEEEEECCchHHHHHHHHHHHHhhcCCEEEEEC
Confidence            8776543       45555431             123467889999999999999999999999999999999999999


Q ss_pred             CccchHHHHHHHHHHHHcCCCCccEEEeeCCChhhhhhhhcCCCeeEEEeeCChhhHHHHHHHHhcccCcccCCCcEEEe
Q psy1960         232 SDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLIGE  311 (428)
Q Consensus       232 s~~apl~a~~l~~ll~eAGlP~gvv~vv~g~g~~~g~~L~~~~~v~~I~fTGS~~~g~~i~~~~a~~~~~~~~~~~~~lE  311 (428)
                      |+.+|+++..++++++++|+|+|++|+|+|++.+++++|+.||+|++|+||||+++|+.|++++++++++|+++||+++|
T Consensus       235 s~~tp~sa~~l~~ll~eAGlP~Gvvnvv~g~g~~~g~~L~~hp~v~~I~FTGSt~vG~~i~~~aa~~lk~~~~~prv~lE  314 (563)
T 4e3x_A          235 SDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNLDRFRTFPRLAGE  314 (563)
T ss_dssp             CGGGHHHHHHHHHHHHHTTCCTTSEEECCCCHHHHHHHHTTCTTEEEEEEESCHHHHHHHHHHHHHTTTTCSSCCEEEEE
T ss_pred             CCCChHHHHHHHHHHHHhCCCCCeEEEEeCCcHHHHHHHHhCCCcCEEEEECCHHHHHHHHHHHHhhCCccccCCceecc
Confidence            99999999999999999999999999999999899999999999999999999999999999999999999999999999


Q ss_pred             cCCCceeEEcCCCCHHHHHHHHHHHHhhcCCCccccCceEEEeCCchHHHHHHHHHHHhcCCc
Q psy1960         312 CGGKNFHFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPESLFCFCSCFLLLFLFSASV  374 (428)
Q Consensus       312 lGGkn~~iV~~dADld~Aa~~iv~saf~~~GQ~C~a~srv~V~~si~d~f~~~L~~~l~~l~v  374 (428)
                      +|||||+||++|||+|.|++.+++++|.|+||+|++++|+|||+++||+|+++|+++++++++
T Consensus       315 lGGk~p~IV~~dADld~Aa~~iv~~~f~~~GQ~C~A~~rv~V~~si~d~f~~~l~~~~~~l~v  377 (563)
T 4e3x_A          315 CGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPKSLWPQIKGRLLEEHSRIKV  377 (563)
T ss_dssp             CCCCEEEEECTTSCHHHHHHHHHHHHHGGGGCSTTCEEEEEEEGGGHHHHHHHHHHHHHTCCB
T ss_pred             CCCCCceeeCCCCCHHHHHHHHHHHHHhcCCCCCcCCcEEEEecchHHHHHHHHHHHHHhccC
Confidence            999999999999999999999999999999999999999999999999999999999998764



>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 428
d1o04a_ 494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-33
d1bxsa_ 494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-32
d1a4sa_ 503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-30
d1wnda_ 474 c.82.1.1 (A:) Putative betaine aldehyde dehydrogen 4e-23
d1euha_ 474 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 8e-20
d1uzba_ 516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 8e-17
d1uzba_516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 5e-05
d1ad3a_ 446 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 5e-10
d1ad3a_446 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 3e-04
d1ez0a_504 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 7e-05
d1ky8a_ 499 c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3 3e-04
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Human (Homo sapiens), mitochondrial [TaxId: 9606]
 Score =  128 bits (324), Expect = 2e-33
 Identities = 48/161 (29%), Positives = 75/161 (46%), Gaps = 6/161 (3%)

Query: 199 GFVAAVSPFNFTAIGGNLAYTPALM-GSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVN 257
           G    + P+NF  +       PAL  G+ V+ K ++   L+   +  ++ EAG PPGVVN
Sbjct: 154 GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVN 213

Query: 258 FVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLIGECGGKNF 317
            VP  GP  G  I +   +  + FTGS      + +  G       N  R+  E GGK+ 
Sbjct: 214 IVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGS-----SNLKRVTLELGGKSP 268

Query: 318 HFIHASANVESVVNGTIRSAFEYCGQKCSACSRMYVPESLF 358
           + I + A+++  V     + F   GQ   A SR +V E ++
Sbjct: 269 NIIMSDADMDWAVEQAHFALFFNQGQCSCAGSRTFVQEDIY 309


>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Length = 474 Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Length = 474 Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Length = 504 Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 499 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query428
d1uzba_ 516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 100.0
d1bxsa_ 494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 100.0
d1wnda_ 474 Putative betaine aldehyde dehydrogenase YdcW {Esch 100.0
d1o04a_ 494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 100.0
d1a4sa_ 503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 100.0
d1euha_ 474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 100.0
d1ky8a_ 499 Non-phosphorylating glyceraldehyde-3-phosphate deh 100.0
d1ez0a_ 504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 100.0
d1ad3a_ 446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 100.0
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 100.0
d1vlua_436 Gamma-glutamyl phosphate reductase {Baker's yeast 99.98
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: 1-pyrroline-5-carboxylate dehydrogenase
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=5.4e-63  Score=519.50  Aligned_cols=323  Identities=23%  Similarity=0.277  Sum_probs=292.0

Q ss_pred             ccCCCCCCCCCCCcHHHHHHHHHHHHhccC-CcccCeEEcCEEeecCCeeeeccccccccccccCCCCCeeEEEEeCCCH
Q psy1960          30 NVQETPEWTYLPGSKEREAITAALKRVGST-VEEVPIVIGSKEYKTEHVQYQPMVSLHVQYQPMPHNHKKKIAKFYYATP  108 (428)
Q Consensus        30 ~~~n~p~~~~~~~s~~r~~~~~al~~~~~~-~~~ip~~IgG~~v~s~~~~~~~~~~~~~~~~~~P~~~g~~ia~v~~a~~  108 (428)
                      +|+|||.++|..++ +|.++++++++++.. .+++|+||||+|+.+++...          ++||.++++++++++.++.
T Consensus         5 ~~~nep~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~l~I~G~~v~s~~~~~----------~~nP~~tge~i~~~~~a~~   73 (516)
T d1uzba_           5 PFRNEPIETFQTEE-ARRAMREALRRVREEFGRHYPLYIGGEWVDTKERMV----------SLNPSAPSEVVGTTAKAGK   73 (516)
T ss_dssp             CCCCCCCCCCCSHH-HHHHHHHHHHHHHHTTTEEECEEETTEEECCSSEEE----------EEETTEEEEEEEEEECCCH
T ss_pred             CCCCCCCCCCCCch-HHHHHHHHHHHHHHhcCCCCCeEEcCEEECCCCCeE----------EeCCCCCCeEEEEEcCCCH
Confidence            69999999997655 566799999998766 57889999999999877655          7899766899999999999


Q ss_pred             hH-HHHHHHHh-ccCccccCChhhhhhhhhhHHHHHHHHHHHHHHHhhccchhHHHHHHHhcCCCCCcccch------hh
Q psy1960         109 VL-KSALDIVS-SLCPYEKNSVGLLINTEVLHDDLYFRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGGRMS------AL  180 (428)
Q Consensus       109 ~~-~~Av~aA~-A~~~W~~~~~~~R~~~~~~~~~iL~~~~a~l~~L~~~~~~~~~~~~~l~~gkp~~~~~~~------~l  180 (428)
                      +| ++|+++|+ ||+.|+++|.++|.       ++|+++ +++  |+++.+ ....+...++|+|+.+++.+      .+
T Consensus        74 ~dv~~Av~aA~~A~~~W~~~s~~~R~-------~iL~~~-a~~--l~~~~~-ela~~~~~e~Gk~~~~a~~ev~~~~~~~  142 (516)
T d1uzba_          74 AEAEAALEAAWKAFKTWKDWPQEDRS-------RLLLKA-AAL--MRRRKR-ELEATLVYEVGKNWVEASADVAEAIDFI  142 (516)
T ss_dssp             HHHHHHHHHHHHHHHHHTTSCHHHHH-------HHHHHH-HHH--HHHTHH-HHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhhCCHHHHH-------HHHHHH-HHH--HHHHHH-HHHHHHHHHhCCCccccchhHHHHHHHH
Confidence            99 99999999 99999999999999       999999 999  999988 77778889999998776543      34


Q ss_pred             hhhhcc--------------ccccceeeecccceEEEECCCchhhhhhHhhhhhhcC-CCEEEEeCCccchHHHHHHHHH
Q psy1960         181 TFYLEV--------------LASNLGRGEGLDGFVAAVSPFNFTAIGGNLAYTPALM-GSSVLWKPSDTALLSNYTIYKI  245 (428)
Q Consensus       181 ~~~~~~--------------~~~~~~~~~~p~GVV~~I~P~NfP~~~~~~~iapALa-GN~VVlKPs~~apl~a~~l~~l  245 (428)
                      ++++..              .......++.|+|||++|+|||||+....+++++||+ ||+||+|||+.+|+++..+.++
T Consensus       143 ~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~P~Gvv~~I~PwN~Pl~~~~~~~~~ALaaGN~Vv~Kps~~~p~~~~~l~~~  222 (516)
T d1uzba_         143 EYYARAALRYRYPAVEVVPYPGEDNESFYVPLGAGVVIAPWNFPVAIFTGMIVGPVAVGNTVIAKPAEDAVVVGAKVFEI  222 (516)
T ss_dssp             HHHHHHHGGGCSSCCCCCCCTTEEEEEEEEECCEEEEECCSSSTTHHHHHHHHHHHHTTCEEEEECCGGGHHHHHHHHHH
T ss_pred             HHHHHHHHhhhhcccccccccccceeEEeeccCccccccccccccccccccccchhhhcccccccccchhHHHHHHHHHH
Confidence            444321              1223456677899999999999999999999999998 9999999999999999999999


Q ss_pred             HHHcCCCCccEEEeeCCChhhhhhhhcCCCeeEEEeeCChhhHHHHHHHHhcccCcccCCCcEEEecCCCceeEEcCCCC
Q psy1960         246 MIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVPTFNRLWLQVGKNINVYKNFPRLIGECGGKNFHFIHASAN  325 (428)
Q Consensus       246 l~eAGlP~gvv~vv~g~g~~~g~~L~~~~~v~~I~fTGS~~~g~~i~~~~a~~~~~~~~~~~~~lElGGkn~~iV~~dAD  325 (428)
                      +.++|+|+|++|+|+|+++++++.|+.||+|++|.||||+++|+.|++.+++....+.+++|+++|+|||||+||++|||
T Consensus       223 ~~~aglP~gv~~~v~g~~~~~~~~L~~hp~v~~I~FTGs~~~G~~i~~~aa~~~~~~~~~k~v~lElgG~~p~iV~~dAd  302 (516)
T d1uzba_         223 FHEAGFPPGVVNFLPGVGEEVGAYLVEHPRIRFINFTGSLEVGLKIYEAAGRLAPGQTWFKRAYVETGGKNAIIVDETAD  302 (516)
T ss_dssp             HHHHTCCTTSEEECCCSSSHHHHHHHTCTTCCEEEEESCHHHHHHHHHHHTSCCTTCCSCCEEEEECCCCEEEEECTTSC
T ss_pred             HHHhCcCcCeEEEccCChHHHHHHHHhCCCcCEEecccchhHHHHHHHHHhhcccchhhhhhheeeccCccceeeecchh
Confidence            99999999999999999999999999999999999999999999999999876666677779999999999999999999


Q ss_pred             HHHHHHHHHHHHhhcCCCccccCceEEEeCCchHHHHHHHHHHHhcCCc
Q psy1960         326 VESVVNGTIRSAFEYCGQKCSACSRMYVPESLFCFCSCFLLLFLFSASV  374 (428)
Q Consensus       326 ld~Aa~~iv~saf~~~GQ~C~a~srv~V~~si~d~f~~~L~~~l~~l~v  374 (428)
                      +|.|++.+++++|.++||.|++++|++||++++|+|+++++++++++++
T Consensus       303 ~~~aa~~i~~~~~~~~GQ~C~a~~ri~v~~~i~d~~~~~~~~~~~~l~~  351 (516)
T d1uzba_         303 FDLAAEGVVVSAYGFQGQKCSAASRLILTQGAYEPVLERVLKRAERLSV  351 (516)
T ss_dssp             HHHHHHHHHHHHHGGGGCSTTCEEEEEEEHHHHHHHHHHHHHHHTTCCB
T ss_pred             HHHHHHHHhhhhcccCCCcccccCccccccccccchhhHHHHHHHhccc
Confidence            9999999999999999999999999999999999999999999998775



>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure