Psyllid ID: psy2123


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MEYDWMLTLRCDGEDDDYDYERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAKFRRNERNFISHRNLDAPTSEQPLPPCTNATPLSSAPPSSSHSFDFCAMPHSQCNSTCTFTSP
cccccccccccccccccHHHcccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccHHHcccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccc
meydwmltlrcdgedddydyerrkpkprrnrttfnsHQLNALEKVFErthypdafVREELAKKVCLSEARVQVWFQNRRAKfrrnernfishrnldaptseqplppctnatplssappssshsfdfcamphsqcnstctftsp
meydwmltlrcdgedddydyerrkpkprrnrttfnshqlnALEKVFERTHYPDAFVREELAKkvclsearvqvwfqnrrakfrrnernfishrnldaptseqPLPPCTNATPLSSAPPSSSHSFDFCAMPHSQCNSTCTFTSP
MEYDWMLTLRCDGedddydyerrkpkprrnrttFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAKFRRNERNFISHRNLDAPTSEQPLPPCTNATplssappssshsFDFCAMPHSQCNSTCTFTSP
****WMLTLRC***************************LNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAKFR************************************************************
********************************TFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAK**************************************************************
MEYDWMLTLRCDGEDDDYDYERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAKFRRNERNFISHRNLDAPTSEQPLPPCTNAT***********SFDFCAMPHSQ**********
******L***********************RTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAKFRRNERN*******************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEYDWMLTLRCDGEDDDYDYERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAKFRRNERNFISHRNLDAPTSEQPLPPCTNATPLSSAPPSSSHSFDFCAMPHSQCNSTCTFTSP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query143 2.2.26 [Sep-21-2011]
Q90963165 Paired mesoderm homeobox yes N/A 0.524 0.454 0.682 3e-25
Q99811253 Paired mesoderm homeobox yes N/A 0.643 0.363 0.572 3e-25
P63014245 Paired mesoderm homeobox yes N/A 0.524 0.306 0.650 4e-25
P63013245 Paired mesoderm homeobox yes N/A 0.524 0.306 0.650 4e-25
P54821245 Paired mesoderm homeobox no N/A 0.524 0.306 0.650 4e-25
Q05437245 Paired mesoderm homeobox no N/A 0.524 0.306 0.650 5e-25
Q06348247 Paired mesoderm homeobox no N/A 0.524 0.303 0.682 1e-24
Q9I9D5334 Retinal homeobox protein N/A N/A 0.699 0.299 0.549 1e-21
Q4LAL6397 Homeobox protein aristale no N/A 0.482 0.173 0.666 2e-21
Q9PVX0317 Retinal homeobox protein no N/A 0.615 0.277 0.561 2e-21
>sp|Q90963|PRRX2_CHICK Paired mesoderm homeobox protein 2 (Fragment) OS=Gallus gallus GN=PRRX2 PE=2 SV=1 Back     alignment and function desciption
 Score =  114 bits (284), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 7/82 (8%)

Query: 32  TTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAKFRRNERNFIS 91
           TTFNS QL ALE+VFERTHYPDAFVREELA++V LSEARVQVWFQNRRAKFRRNER  ++
Sbjct: 21  TTFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLA 80

Query: 92  HRNLDAPTS-------EQPLPP 106
           +R+     S       EQP+ P
Sbjct: 81  NRSASLLKSYSQEAAIEQPMAP 102




May play a role in development of the heart.
Gallus gallus (taxid: 9031)
>sp|Q99811|PRRX2_HUMAN Paired mesoderm homeobox protein 2 OS=Homo sapiens GN=PRRX2 PE=2 SV=2 Back     alignment and function description
>sp|P63014|PRRX1_RAT Paired mesoderm homeobox protein 1 OS=Rattus norvegicus GN=Prrx1 PE=2 SV=1 Back     alignment and function description
>sp|P63013|PRRX1_MOUSE Paired mesoderm homeobox protein 1 OS=Mus musculus GN=Prrx1 PE=2 SV=1 Back     alignment and function description
>sp|P54821|PRRX1_HUMAN Paired mesoderm homeobox protein 1 OS=Homo sapiens GN=PRRX1 PE=1 SV=2 Back     alignment and function description
>sp|Q05437|PRRX1_CHICK Paired mesoderm homeobox protein 1 OS=Gallus gallus GN=PRRX1 PE=1 SV=2 Back     alignment and function description
>sp|Q06348|PRRX2_MOUSE Paired mesoderm homeobox protein 2 OS=Mus musculus GN=Prrx2 PE=2 SV=2 Back     alignment and function description
>sp|Q9I9D5|RX1_ASTFA Retinal homeobox protein Rx1 OS=Astyanax fasciatus GN=rx1 PE=2 SV=1 Back     alignment and function description
>sp|Q4LAL6|ALX4_BOVIN Homeobox protein aristaless-like 4 OS=Bos taurus GN=ALX4 PE=2 SV=1 Back     alignment and function description
>sp|Q9PVX0|RX2_CHICK Retinal homeobox protein Rx2 OS=Gallus gallus GN=RX2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
328717151 244 PREDICTED: paired mesoderm homeobox prot 0.713 0.418 0.645 1e-29
242020400 270 Ultrabithorax, putative [Pediculus human 0.552 0.292 0.790 2e-27
443703131195 hypothetical protein CAPTEDRAFT_171492 [ 0.783 0.574 0.528 3e-27
195429318 288 GK19597 [Drosophila willistoni] gi|19415 0.657 0.326 0.656 1e-26
195489018 286 GE11607 [Drosophila yakuba] gi|194178660 0.587 0.293 0.761 2e-26
195380555 288 GJ20984 [Drosophila virilis] gi|19414383 0.762 0.378 0.601 2e-26
24659086 275 CG9876 [Drosophila melanogaster] gi|2162 0.587 0.305 0.75 5e-26
33589354 275 RE60081p [Drosophila melanogaster] 0.587 0.305 0.75 5e-26
269784949242 paired mesoderm homeobox 2-like protein 0.713 0.421 0.592 6e-26
195346972 273 GM15584 [Drosophila sechellia] gi|194135 0.587 0.307 0.75 7e-26
>gi|328717151|ref|XP_003246132.1| PREDICTED: paired mesoderm homeobox protein 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/110 (64%), Positives = 83/110 (75%), Gaps = 8/110 (7%)

Query: 22  RRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAK 81
           +RK KPRRNRTTF+S QL ALEKVFERTHYPDAFVREELA++VCLSEARVQVWFQNRRAK
Sbjct: 41  QRKSKPRRNRTTFSSCQLRALEKVFERTHYPDAFVREELARRVCLSEARVQVWFQNRRAK 100

Query: 82  FRRNERNFISHRN--------LDAPTSEQPLPPCTNATPLSSAPPSSSHS 123
           FRRNER+ +S  N          +P  EQPL P +N   + + PP ++ S
Sbjct: 101 FRRNERSSLSRNNPTLSTVPDCRSPNVEQPLLPRSNTNVVHAEPPFTAGS 150




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242020400|ref|XP_002430643.1| Ultrabithorax, putative [Pediculus humanus corporis] gi|212515815|gb|EEB17905.1| Ultrabithorax, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|443703131|gb|ELU00842.1| hypothetical protein CAPTEDRAFT_171492 [Capitella teleta] Back     alignment and taxonomy information
>gi|195429318|ref|XP_002062710.1| GK19597 [Drosophila willistoni] gi|194158795|gb|EDW73696.1| GK19597 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195489018|ref|XP_002092559.1| GE11607 [Drosophila yakuba] gi|194178660|gb|EDW92271.1| GE11607 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195380555|ref|XP_002049036.1| GJ20984 [Drosophila virilis] gi|194143833|gb|EDW60229.1| GJ20984 [Drosophila virilis] Back     alignment and taxonomy information
>gi|24659086|ref|NP_611756.1| CG9876 [Drosophila melanogaster] gi|21626590|gb|AAF46956.2| CG9876 [Drosophila melanogaster] gi|94400579|gb|ABF17914.1| FI01017p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|33589354|gb|AAQ22444.1| RE60081p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|269784949|ref|NP_001161626.1| paired mesoderm homeobox 2-like protein [Saccoglossus kowalevskii] gi|268054257|gb|ACY92615.1| paired mesoderm homeobox 2-like protein [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|195346972|ref|XP_002040028.1| GM15584 [Drosophila sechellia] gi|194135377|gb|EDW56893.1| GM15584 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
FB|FBgn0034821275 CG9876 [Drosophila melanogaste 0.517 0.269 0.740 2.6e-22
UNIPROTKB|F1NZI9165 PRRX2 "Paired mesoderm homeobo 0.510 0.442 0.675 3.4e-22
UNIPROTKB|Q90963165 PRRX2 "Paired mesoderm homeobo 0.510 0.442 0.675 3.4e-22
UNIPROTKB|E1BF87166 PRRX2 "Uncharacterized protein 0.510 0.439 0.675 4.3e-22
UNIPROTKB|F1RQG1211 PRRX2 "Uncharacterized protein 0.510 0.345 0.675 4.3e-22
UNIPROTKB|F1PD53234 PRRX2 "Uncharacterized protein 0.426 0.260 0.803 5.5e-22
UNIPROTKB|J9P7P0234 PRRX2 "Uncharacterized protein 0.426 0.260 0.803 5.5e-22
UNIPROTKB|A2VE85245 PRRX1 "Paired related homeobox 0.510 0.297 0.641 7e-22
UNIPROTKB|E2RGD6245 PRRX1 "Uncharacterized protein 0.510 0.297 0.641 7e-22
UNIPROTKB|J9P9S0217 PRRX1 "Uncharacterized protein 0.510 0.336 0.641 7e-22
FB|FBgn0034821 CG9876 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 259 (96.2 bits), Expect = 2.6e-22, P = 2.6e-22
 Identities = 57/77 (74%), Positives = 62/77 (80%)

Query:    34 FNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAKFRRNERNFISHR 93
             F+S QL ALEKVFERTHYPDAFVREELA KV LSEARVQVWFQNRRAKFRRNER+  S  
Sbjct:   124 FSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRT 183

Query:    94 NLDAPTSEQPLP-PCTN 109
              LD  T+ Q +P P +N
Sbjct:   184 LLD--TAPQLVPAPISN 198




GO:0005634 "nucleus" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
UNIPROTKB|F1NZI9 PRRX2 "Paired mesoderm homeobox protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q90963 PRRX2 "Paired mesoderm homeobox protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BF87 PRRX2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQG1 PRRX2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PD53 PRRX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7P0 PRRX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A2VE85 PRRX1 "Paired related homeobox 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGD6 PRRX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9S0 PRRX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P63014PRRX1_RATNo assigned EC number0.65060.52440.3061yesN/A
P63013PRRX1_MOUSENo assigned EC number0.65060.52440.3061yesN/A
Q99811PRRX2_HUMANNo assigned EC number0.57270.64330.3636yesN/A
Q90963PRRX2_CHICKNo assigned EC number0.68290.52440.4545yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
pfam0004657 pfam00046, Homeobox, Homeobox domain 2e-27
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 8e-23
smart0038957 smart00389, HOX, Homeodomain 8e-22
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 1e-12
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
 Score = 96.4 bits (241), Expect = 2e-27
 Identities = 36/57 (63%), Positives = 43/57 (75%)

Query: 28 RRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAKFRR 84
          RR RTTF   QL  LEK FE+  YP A  REELAKK+ L+E +V+VWFQNRRAK++R
Sbjct: 1  RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWKR 57


Length = 57

>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 143
KOG0489|consensus261 99.86
KOG0850|consensus245 99.86
KOG0484|consensus125 99.83
KOG0848|consensus317 99.81
KOG0843|consensus197 99.8
KOG0488|consensus309 99.8
KOG2251|consensus228 99.78
KOG0487|consensus308 99.76
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.76
KOG0842|consensus307 99.75
KOG0485|consensus268 99.75
KOG3802|consensus398 99.75
KOG0492|consensus246 99.74
KOG0494|consensus332 99.73
KOG0493|consensus342 99.68
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.65
KOG0491|consensus194 99.65
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.65
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.64
KOG0486|consensus 351 99.62
COG5576156 Homeodomain-containing transcription factor [Trans 99.59
KOG4577|consensus383 99.57
KOG0844|consensus 408 99.56
KOG0483|consensus198 99.53
KOG0847|consensus288 99.42
KOG0775|consensus304 99.42
KOG1168|consensus385 99.38
KOG0490|consensus235 99.29
KOG0849|consensus354 99.28
KOG0774|consensus334 99.12
KOG2252|consensus558 98.89
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.83
KOG0490|consensus235 98.33
KOG1146|consensus 1406 98.09
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.6
KOG3623|consensus 1007 96.96
KOG0773|consensus342 96.95
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 95.57
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 91.57
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 86.76
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 86.65
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 85.7
KOG1146|consensus 1406 83.56
PF1356577 HTH_32: Homeodomain-like domain 83.03
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 81.7
PF1066860 Phage_terminase: Phage terminase small subunit; In 81.52
PRK03975141 tfx putative transcriptional regulator; Provisiona 80.72
KOG3755|consensus769 80.42
>KOG0489|consensus Back     alignment and domain information
Probab=99.86  E-value=1.2e-21  Score=150.19  Aligned_cols=86  Identities=33%  Similarity=0.504  Sum_probs=71.6

Q ss_pred             CcccccccccCCCCCCcccccCCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHcCCChhHHHHHHhhHHHH
Q psy2123           2 EYDWMLTLRCDGEDDDYDYERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAK   81 (143)
Q Consensus         2 ~~~w~~~~~~~~~~~~~~~~~~~~~~rr~R~~~~~~q~~~L~~~f~~~~~p~~~~~~~La~~lgl~~~~V~~WFqNrR~k   81 (143)
                      .|+||.......     .......+.||.||.||..|+..||+.|..|+|.+...|.+||..|.|+++||+|||||||+|
T Consensus       139 ~~p~~~~~~~~~-----~~~~~~~~~kR~RtayT~~QllELEkEFhfN~YLtR~RRiEiA~~L~LtErQIKIWFQNRRMK  213 (261)
T KOG0489|consen  139 IYPWMKSTANYL-----SSSETGGKSKRRRTAFTRYQLLELEKEFHFNKYLTRSRRIEIAHALNLTERQIKIWFQNRRMK  213 (261)
T ss_pred             cccchhhhhccc-----ccccccCCCCCCCcccchhhhhhhhhhhccccccchHHHHHHHhhcchhHHHHHHHHHHHHHH
Confidence            588888766431     111222346788999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhhhhccc
Q psy2123          82 FRRNERNFISH   92 (143)
Q Consensus        82 ~rk~~~~~~~~   92 (143)
                      |||.++.....
T Consensus       214 ~Kk~~k~~~~~  224 (261)
T KOG0489|consen  214 WKKENKAKSSQ  224 (261)
T ss_pred             HHHhhcccccc
Confidence            99988765444



>KOG0850|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13565 HTH_32: Homeodomain-like domain Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information
>PRK03975 tfx putative transcriptional regulator; Provisional Back     alignment and domain information
>KOG3755|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 3e-17
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 7e-17
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 7e-17
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 1e-16
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 2e-16
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 1e-14
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 1e-14
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 3e-12
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 5e-12
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 5e-12
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 4e-11
2dmq_A80 Solution Structure Of The Homeobox Domain Of LimHOM 1e-08
2k40_A67 Nmr Structure Of Hesx-1 Homeodomain Double Mutant R 3e-08
2djn_A70 The Solution Structure Of The Homeobox Domain Of Hu 6e-07
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 2e-06
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 4e-06
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 6e-06
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 1e-05
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 1e-05
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 2e-05
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 2e-05
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 2e-05
3a03_A56 Crystal Structure Of Hox11l1 Homeodomain Length = 5 3e-05
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 3e-05
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 4e-05
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 6e-05
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 6e-05
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 6e-05
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 1e-04
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 1e-04
2l9r_A69 Solution Nmr Structure Of Homeobox Domain Of Homeob 1e-04
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 3e-04
1jgg_A60 Even-Skipped Homeodomain Complexed To At-Rich Dna L 4e-04
1hom_A68 Determination Of The Three-Dimensional Structure Of 4e-04
1nk2_P77 VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES 4e-04
1ftt_A68 Thyroid Transcription Factor 1 Homeodomain (Rattus 5e-04
1bw5_A66 The Nmr Solution Structure Of The Homeodomain Of Th 7e-04
3rkq_A58 Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Lengt 7e-04
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure

Iteration: 1

Score = 83.6 bits (205), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 37/54 (68%), Positives = 43/54 (79%) Query: 34 FNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAKFRRNER 87 F S QL LEK F RTHYPD F REELA K+ L+EAR+QVWFQNRRAK+R+ E+ Sbjct: 6 FTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEK 59
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2DMQ|A Chain A, Solution Structure Of The Homeobox Domain Of LimHOMEOBOX Protein Lhx9 Length = 80 Back     alignment and structure
>pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 Back     alignment and structure
>pdb|2DJN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Dlx-5 Length = 70 Back     alignment and structure
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure
>pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure
>pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 Back     alignment and structure
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 Back     alignment and structure
>pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 Back     alignment and structure
>pdb|1BW5|A Chain A, The Nmr Solution Structure Of The Homeodomain Of The Rat Insulin Gene Enhancer Protein Isl-1, 50 Structures Length = 66 Back     alignment and structure
>pdb|3RKQ|A Chain A, Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Length = 58 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 2e-38
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 3e-37
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 4e-37
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 9e-37
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 1e-36
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-36
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 6e-36
3a02_A60 Homeobox protein aristaless; homeodomain, developm 4e-35
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 4e-35
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 3e-34
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-32
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 4e-30
1uhs_A72 HOP, homeodomain only protein; structural genomics 8e-30
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 2e-27
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 6e-26
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-24
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 7e-24
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 7e-24
3d1n_I151 POU domain, class 6, transcription factor 1; prote 9e-24
2xsd_C164 POU domain, class 3, transcription factor 1; trans 1e-22
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-21
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 5e-21
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 8e-21
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 4e-20
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 3e-19
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-18
3a01_A93 Homeodomain-containing protein; homeodomain, prote 2e-18
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 3e-18
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 5e-18
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 5e-18
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 6e-18
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 9e-18
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 1e-17
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 1e-17
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 2e-17
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-17
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 6e-17
1lfb_A99 Liver transcription factor (LFB1); transcription r 9e-17
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 3e-16
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 4e-16
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 5e-16
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 7e-16
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 3e-15
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 6e-15
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-14
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-14
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 1e-14
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 1e-14
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 5e-14
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 1e-13
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 2e-13
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 4e-13
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 2e-12
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 2e-12
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 5e-12
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 7e-10
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 1e-09
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 2e-07
2e19_A64 Transcription factor 8; homeobox domain, structura 4e-07
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 2e-06
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 7e-05
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 3e-04
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
 Score =  124 bits (312), Expect = 2e-38
 Identities = 38/77 (49%), Positives = 53/77 (68%)

Query: 12 DGEDDDYDYERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARV 71
            + +       K K RR+RTTF++ QL+ LE+ FERT YPD + REELA++  L+EAR+
Sbjct: 3  ISDCESEPGIALKRKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARI 62

Query: 72 QVWFQNRRAKFRRNERN 88
          QVWFQNRRA+ R+   +
Sbjct: 63 QVWFQNRRARLRKQHTS 79


>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.88
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.87
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.87
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.87
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.86
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.86
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.86
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.86
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.86
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.86
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.86
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.85
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.85
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.85
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.85
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.85
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.85
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.85
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.84
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.84
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.84
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.84
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.84
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.84
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.84
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.84
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.84
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.84
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.84
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.84
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.84
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.83
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.83
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.83
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.83
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.83
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.83
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.83
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.83
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.83
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.82
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.82
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.82
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.82
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.82
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.82
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.81
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.81
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.81
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.81
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.81
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.81
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.8
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.8
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.8
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.8
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.8
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.8
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.79
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.79
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.78
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.77
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.77
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.77
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.77
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.76
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.76
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.76
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.74
2e19_A64 Transcription factor 8; homeobox domain, structura 99.74
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.74
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.72
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.68
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.6
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.6
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.58
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.4
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.78
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 96.84
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 88.99
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 88.46
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 88.09
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 87.66
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 83.29
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 81.72
3c57_A95 Two component transcriptional regulatory protein; 80.95
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
Probab=99.88  E-value=1.2e-22  Score=131.09  Aligned_cols=80  Identities=30%  Similarity=0.546  Sum_probs=61.9

Q ss_pred             CcccccccccCCCCCCcccccCCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHcCCChhHHHHHHhhHHHH
Q psy2123           2 EYDWMLTLRCDGEDDDYDYERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAK   81 (143)
Q Consensus         2 ~~~w~~~~~~~~~~~~~~~~~~~~~~rr~R~~~~~~q~~~L~~~f~~~~~p~~~~~~~La~~lgl~~~~V~~WFqNrR~k   81 (143)
                      -|+||.....+.+..     ....+.++.|+.|+..|+.+|+..|..++||+..++..||..+||++.+|++||||||+|
T Consensus         8 ~~pwm~~~~~~~~~~-----~~~~~~rr~Rt~ft~~Ql~~Le~~F~~~~yp~~~~r~~La~~l~l~~~qV~vWFqNRR~k   82 (88)
T 2r5y_A            8 IYPWMKRVHLGTSTV-----NANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMK   82 (88)
T ss_dssp             CCGGGSCC--------------------CCCCCCHHHHHHHHHHHTTCSSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHH
T ss_pred             CCchhhccCCCCCCC-----CCCCCCCCCCCCcCHHHHHHHHHHHhccCCCCHHHHHHHHHHhCcCHHHhhHHhHHHHHH
Confidence            489998765433222     123346788999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhh
Q psy2123          82 FRRNE   86 (143)
Q Consensus        82 ~rk~~   86 (143)
                      +|+..
T Consensus        83 ~kk~~   87 (88)
T 2r5y_A           83 WKKEH   87 (88)
T ss_dssp             HHTTC
T ss_pred             hHhhc
Confidence            99864



>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 143
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-24
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 1e-23
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 7e-23
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-22
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-22
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 7e-22
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-21
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 1e-21
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-20
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 5e-20
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 8e-20
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 8e-20
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 8e-20
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 9e-20
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-19
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 5e-19
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 6e-19
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 9e-19
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 4e-18
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 6e-18
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 9e-18
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-17
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 2e-17
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-17
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5e-17
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 4e-16
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 7e-16
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 1e-15
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-15
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-15
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 9e-12
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 2e-10
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Paired box protein pax6
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 87.9 bits (218), Expect = 1e-24
 Identities = 40/60 (66%), Positives = 47/60 (78%)

Query: 28 RRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAKFRRNER 87
          +RNRT+F   Q+ ALEK FERTHYPD F RE LA K+ L EAR+QVWF NRRAK+RR E+
Sbjct: 2  QRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 61


>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.91
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.89
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.88
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.88
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.88
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.88
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.88
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.88
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.88
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.87
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.87
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.86
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.86
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.85
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.85
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.84
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.84
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.84
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.84
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.83
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.82
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.82
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.79
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.79
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.78
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.78
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.75
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.74
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.72
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.7
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.7
d1hlva166 DNA-binding domain of centromere binding protein B 93.95
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 88.37
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 87.45
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 85.97
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=1e-24  Score=138.92  Aligned_cols=85  Identities=36%  Similarity=0.558  Sum_probs=61.7

Q ss_pred             CcccccccccCCCCCCcccccCCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHcCCChhHHHHHHhhHHHH
Q psy2123           2 EYDWMLTLRCDGEDDDYDYERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVWFQNRRAK   81 (143)
Q Consensus         2 ~~~w~~~~~~~~~~~~~~~~~~~~~~rr~R~~~~~~q~~~L~~~f~~~~~p~~~~~~~La~~lgl~~~~V~~WFqNrR~k   81 (143)
                      -|+||...+....... .......++++.|+.|++.|+.+|+..|..++||+..++++||..|||++++|+|||||||+|
T Consensus         3 ~y~wm~~~r~~p~~~~-~~~~~~~~~kr~Rt~ft~~Ql~~Le~~F~~n~yPs~~~r~~LA~~l~l~~~~V~vWFqNrR~k   81 (88)
T d1b72a_           3 TFDWMKVKRNPPKTAK-VSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMK   81 (88)
T ss_dssp             CCGGGGC---------------------CCCCCCHHHHHHHHHHHTTCSSCCHHHHHHHHHHHTCCHHHHHHHHHHHHHH
T ss_pred             CCCCCcCCCCCCCCCC-CCCCCCCCCCCCCcCCCHHHHHHHHHHHHhCCCCchHHHHHHHHHcCCCHHHeeeccHhHHHH
Confidence            4999976553222111 112222345678999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhh
Q psy2123          82 FRRNER   87 (143)
Q Consensus        82 ~rk~~~   87 (143)
                      +||..+
T Consensus        82 ~Kk~~~   87 (88)
T d1b72a_          82 QKKRER   87 (88)
T ss_dssp             HHHHHT
T ss_pred             HHHhcc
Confidence            998754



>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure