Psyllid ID: psy2137

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380--
ALELDSSDESSEISSINNGTSTTDNGHPGGTSKELTNKQKHQLKQRELFLSRQVETLPATHIRGKCSVTLLNETESLLSYLNKEPRSFVVSLPSTFARALDCSSSVKQPSLHMSAAAASRDITLFHAMDTLDKHKYSLAEAISSLVPSTGPVLCRDEMEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTTDRYVQQKRVKAVEAESKLKQVYIPNYNKPPQGSAATPGVVNNNKLSTSGVVVLEIERSFDDYKFGHAFSTRLAMPRDELDTFFYCLVFDPAQKTLLADKGEIRVGSKYQSDITPYLGEASKDPNCRESKDFETLVWTPHHSLTDKQIDQFLVISRSVGKFQESDREFIVESSSLLR
ccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccEEccccHHHHHHHcccccccEEEcccccHHHccccccccccccccHHHcccccccHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHcccccccccEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEccccccc
ccccccccccccHcccccccccccccccccccccccHHHHHHHHHHHHHHcccHccccHHHHcccccEEccHHHccccccccccHHHEEEEEccHHHHHcccccccccccHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHccccccEEEcccHHHccHHHHHHHHHHHHHHcccHHHHHHHHccccccHHHEEEHHHHccccHHHHHHHHHHHHHHHcccEEEcccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccEEEEEEEEcccccEEccccccEEEcccccccccccccccccccccccHHHHHEEEccccccccHHHHHHHHHHHHHHHHHHHHHccHHcEccHHcc
aleldssdesseissinngtsttdnghpggtskelTNKQKHQLKQRELFLSRQvetlpathirgkcsVTLLNETESLLSYlnkeprsfvvslpstfaraldcsssvkqpslhmsaAAASRDITLFHAMDTLDKHKYSLAEAISslvpstgpvlcrdEMEEWSASEANLFEEALEKYGKDfndirndflpwkTLKNIIEYYYMWKTTDRYVQQKRVKAVEAESKLKQvyipnynkppqgsaatpgvvnnnklstSGVVVLEIErsfddykfghafstrlamprdeldTFFYCLVFDPAQktlladkgeirvgskyqsditpylgeaskdpncreskdfetlvwtphhsltdkqIDQFLVISRSvgkfqesdREFIVESSSLLR
aleldssdesseissinngtsttdnghPGGTSKELTNKQKHQLKQRELFLSRQVEtlpathirgkcsvTLLNETESLLSYLNKEPRSFVVSLPSTFARALDCSSSVKQPSLHMSAAAASRDITLFHAMDTLDKHKYSLAEAISSLVPSTGPVLCRDEMEEWSASEANLFEEALEKYGKDfndirndflpwkTLKNIIEYYYMWKTTDRYVQQKRVKAVEAESKLKQVYIPNYNKPPQGSAATPGVVNNNKLSTSGVVVLEIERSFDDYKFGHAFSTRLAMPRDELDTFFYCLVFDPAQKTlladkgeirvgskyqsditpylgeaskdpncrESKDFETLVWtphhsltdkqidQFLVISRSvgkfqesdrefivesssllr
AleldssdesseissinngtsttdngHPGGTSKELTNKQKHQLKQRELFLSRQVETLPATHIRGKCSVTLLNETESLLSYLNKEPRSFVVSLPSTFARALDCSSSVKQPSLHMSAAAASRDITLFHAMDTLDKHKYSLAEAISSLVPSTGPVLCRDEMEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTTDRYVQQKRVKAVEAESKLKQVYIPNYNKPPQGSAATPGVVNNNKLSTSGVVVLEIERSFDDYKFGHAFSTRLAMPRDELDTFFYCLVFDPAQKTLLADKGEIRVGSKYQSDITPYLGEASKDPNCRESKDFETLVWTPHHSLTDKQIDQFLVISRSVGKFQESDREFIVESSSLLR
***********************************************LFLSRQVETLPATHIRGKCSVTLLNETESLLSYLNKEPRSFVVSLPSTFARALDC****************SRDITLFHAMDTLDKHKYSLAEAISSLVPSTGPVLCRDEMEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTTDRYVQQKRVKAVEAESKLKQVYIPNY*************VNNNKLSTSGVVVLEIERSFDDYKFGHAFSTRLAMPRDELDTFFYCLVFDPAQKTLLADKGEIRVGSKYQSDITPYL*************DFETLVWTPHHSLTDKQIDQFLVISRSVGK*****************
***********************************************LFLSRQVETLPATHIRGKCSVTLLNETESLLSYLNKEPRSFVVSLPSTFA******************AAASRDITLFHAMDTLDKHKYSLAEAISSLVPSTGPVLCRDEMEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTTDRY**********************************************************YKFGHAFSTRLAMPRDELDTFFYCLVFD******************YQSD**************************PHHSLTDKQIDQFLVISRSVGKFQESDREFIVESSSLL*
***************INNGTSTTDNGHPGGTSK***********QRELFLSRQVETLPATHIRGKCSVTLLNETESLLSYLNKEPRSFVVSLPSTFARALDCSSSVKQPSLHMSAAAASRDITLFHAMDTLDKHKYSLAEAISSLVPSTGPVLCRDEMEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTTDRYVQQKRVKAVEAESKLKQVYIPNYNKPPQGSAATPGVVNNNKLSTSGVVVLEIERSFDDYKFGHAFSTRLAMPRDELDTFFYCLVFDPAQKTLLADKGEIRVGSKYQSDITPYLGEASKDPNCRESKDFETLVWTPHHSLTDKQIDQFLVISRSVGKFQESDR***********
********************************KELTNKQKHQLKQRELFLSRQVETLPATHIRGKCSVTLLNETESLLSYLNKEPRSFVVSLPSTFARALDCSSSVKQPSLHMSAAAASRDITLFHAMDTLDKHKYSLAEAISSLVPSTGPVLCRDEMEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTTDRYVQQKRVKAVEAESKLKQVYIPNYNKP***************LSTSGVVVLEIERSFDDYKFGHAFSTRLAMPRDELDTFFYCLVFDPAQKTLLADKGEIRVGSKYQSDITPYLGEASKDPNCRESKDFETLVWTPHHSLTDKQIDQFLVISRSVGKFQESDRE**V*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ALELDSSDESSEISSINNGTSTTDNGHPGGTSKELTNKQKHQLKQRELFLSRQVETLPATHIRGKCSVTLLNETESLLSYLNKEPRSFVVSLPSTFARALDCSSSVKQPSLHMSAAAASRDITLFHAMDTLDKHKYSLAEAISSLVPSTGPVLCRDEMEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTTDRYVQQKRVKAVEAESKLKQVYIPNYNKPPQGSAATPGVVNNNKLSTSGVVVLEIERSFDDYKFGHAFSTRLAMPRDELDTFFYCLVFDPAQKTLLADKGEIRVGSKYQSDITPYLGEASKDPNCRESKDFETLVWTPHHSLTDKQIDQFLVISRSVGKFQESDREFIVESSSLLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query382 2.2.26 [Sep-21-2011]
Q9BTC8594 Metastasis-associated pro yes N/A 0.403 0.259 0.803 4e-70
Q8K4B0 715 Metastasis-associated pro yes N/A 0.397 0.212 0.779 7e-70
Q13330 715 Metastasis-associated pro no N/A 0.410 0.219 0.786 1e-69
Q62599 703 Metastasis-associated pro yes N/A 0.366 0.199 0.859 2e-69
A6QL72590 Metastasis-associated pro yes N/A 0.403 0.261 0.796 1e-68
Q924K8591 Metastasis-associated pro no N/A 0.403 0.260 0.796 8e-68
Q9R190 668 Metastasis-associated pro no N/A 0.366 0.209 0.809 1e-67
O94776 668 Metastasis-associated pro no N/A 0.366 0.209 0.809 1e-67
Q80TZ9 1558 Arginine-glutamic acid di no N/A 0.227 0.055 0.377 2e-09
Q62901 1559 Arginine-glutamic acid di no N/A 0.227 0.055 0.377 3e-09
>sp|Q9BTC8|MTA3_HUMAN Metastasis-associated protein MTA3 OS=Homo sapiens GN=MTA3 PE=1 SV=2 Back     alignment and function desciption
 Score =  265 bits (678), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 136/158 (86%), Gaps = 4/158 (2%)

Query: 95  TFARALDCSSSVKQPSLHMSAAAASRDITLFHAMDTLDKHKYSLAEAISSLVPSTGPVLC 154
           TFARALDCSSSV+QPSLHMSAAAASRDITLFHAMDTL +H Y L+ AIS LVP  GPVLC
Sbjct: 205 TFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHSYDLSSAISVLVPLGGPVLC 264

Query: 155 RDEMEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTTDRYVQQKR 214
           RDEMEEWSASEA+LFEEALEKYGKDFNDIR DFLPWK+L +IIEYYYMWKTTDRYVQQKR
Sbjct: 265 RDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKR 324

Query: 215 VKAVEAESKLKQVYIPNYNKPPQGSAAT----PGVVNN 248
           +KA EAESKLKQVYIP Y+KP     +T    PG VN 
Sbjct: 325 LKAAEAESKLKQVYIPTYSKPNPNQISTSNGKPGAVNG 362
Plays a role in maintenance of the normal epithelial architecture through the repression of SNAI1 transcription in a histone deacetylase-dependent manner, and thus the regulation of E-cadherin levels.
Homo sapiens (taxid: 9606)
>sp|Q8K4B0|MTA1_MOUSE Metastasis-associated protein MTA1 OS=Mus musculus GN=Mta1 PE=1 SV=1 Back     alignment and function description
>sp|Q13330|MTA1_HUMAN Metastasis-associated protein MTA1 OS=Homo sapiens GN=MTA1 PE=1 SV=2 Back     alignment and function description
>sp|Q62599|MTA1_RAT Metastasis-associated protein MTA1 OS=Rattus norvegicus GN=Mta1 PE=1 SV=1 Back     alignment and function description
>sp|A6QL72|MTA3_BOVIN Metastasis-associated protein MTA3 OS=Bos taurus GN=MTA3 PE=2 SV=1 Back     alignment and function description
>sp|Q924K8|MTA3_MOUSE Metastasis-associated protein MTA3 OS=Mus musculus GN=Mta3 PE=1 SV=1 Back     alignment and function description
>sp|Q9R190|MTA2_MOUSE Metastasis-associated protein MTA2 OS=Mus musculus GN=Mta2 PE=1 SV=1 Back     alignment and function description
>sp|O94776|MTA2_HUMAN Metastasis-associated protein MTA2 OS=Homo sapiens GN=MTA2 PE=1 SV=1 Back     alignment and function description
>sp|Q80TZ9|RERE_MOUSE Arginine-glutamic acid dipeptide repeats protein OS=Mus musculus GN=Rere PE=1 SV=3 Back     alignment and function description
>sp|Q62901|RERE_RAT Arginine-glutamic acid dipeptide repeats protein OS=Rattus norvegicus GN=Rere PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query382
357619829 771 hypothetical protein KGM_11481 [Danaus p 0.539 0.267 0.673 2e-90
351706589302 Metastasis-associated protein MTA3 [Hete 0.575 0.728 0.618 2e-82
340714640 914 PREDICTED: metastasis-associated protein 0.424 0.177 0.825 3e-73
347971738 1091 AGAP004341-PA [Anopheles gambiae str. PE 0.392 0.137 0.833 3e-73
350410953 914 PREDICTED: metastasis-associated protein 0.424 0.177 0.825 4e-73
340714642 853 PREDICTED: metastasis-associated protein 0.424 0.189 0.825 4e-73
350410956 853 PREDICTED: metastasis-associated protein 0.424 0.189 0.825 6e-73
328788362 914 PREDICTED: metastasis-associated protein 0.400 0.167 0.851 7e-73
383854322 914 PREDICTED: metastasis-associated protein 0.400 0.167 0.851 8e-73
380025899 957 PREDICTED: LOW QUALITY PROTEIN: metastas 0.400 0.159 0.851 9e-73
>gi|357619829|gb|EHJ72252.1| hypothetical protein KGM_11481 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  338 bits (868), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 177/263 (67%), Positives = 189/263 (71%), Gaps = 57/263 (21%)

Query: 28  PGGTSKELTNKQKHQLKQRELFLSRQVETLPATHIRGKCSVTLLNETESLLSYLNKEPRS 87
           PG  S  L  KQ+HQ KQRELFLSR VETLPATHIRGKC+VTLLNETESLLSYLNK+   
Sbjct: 54  PG--SDGLAPKQRHQAKQRELFLSRHVETLPATHIRGKCTVTLLNETESLLSYLNKDDAF 111

Query: 88  F-------------------------------------VVSLPS---------------- 94
           F                                     ++SL S                
Sbjct: 112 FYCLVFDPSQKTLLADKGEIRVGSKYQTEVTNLLKEGEMISLTSYDESNKIDQFLVVARS 171

Query: 95  --TFARALDCSSSVKQPSLHMSAAAASRDITLFHAMDTLDKHKYSLAEAISSLVPSTGPV 152
             TFARALDCSSSVKQPSLHMSAAAASRDITLFHAMDTL K  YS+  A+SSLVP++GPV
Sbjct: 172 VGTFARALDCSSSVKQPSLHMSAAAASRDITLFHAMDTLHKSGYSIEAALSSLVPASGPV 231

Query: 153 LCRDEMEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTTDRYVQQ 212
           LCRDEMEEWSASEANLFEEALEKYGKDF D+R DFLPWKTLKN++EYYYMWKTTDRYVQQ
Sbjct: 232 LCRDEMEEWSASEANLFEEALEKYGKDFADVRKDFLPWKTLKNLVEYYYMWKTTDRYVQQ 291

Query: 213 KRVKAVEAESKLKQVYIPNYNKP 235
           KRVKAVEAESKLKQVYIPNYNKP
Sbjct: 292 KRVKAVEAESKLKQVYIPNYNKP 314

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|351706589|gb|EHB09508.1| Metastasis-associated protein MTA3 [Heterocephalus glaber] Back     alignment and taxonomy information
>gi|340714640|ref|XP_003395834.1| PREDICTED: metastasis-associated protein MTA1-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|347971738|ref|XP_313620.5| AGAP004341-PA [Anopheles gambiae str. PEST] gi|333469006|gb|EAA09201.5| AGAP004341-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|350410953|ref|XP_003489189.1| PREDICTED: metastasis-associated protein MTA1-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340714642|ref|XP_003395835.1| PREDICTED: metastasis-associated protein MTA1-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350410956|ref|XP_003489190.1| PREDICTED: metastasis-associated protein MTA1-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|328788362|ref|XP_396763.4| PREDICTED: metastasis-associated protein MTA3 [Apis mellifera] Back     alignment and taxonomy information
>gi|383854322|ref|XP_003702670.1| PREDICTED: metastasis-associated protein MTA3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380025899|ref|XP_003696701.1| PREDICTED: LOW QUALITY PROTEIN: metastasis-associated protein MTA3-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query382
FB|FBgn0027951 880 MTA1-like "MTA1-like" [Drosoph 0.450 0.195 0.754 5.7e-86
UNIPROTKB|E1BZ44 594 MTA3 "Uncharacterized protein" 0.405 0.260 0.805 5.7e-86
UNIPROTKB|E1C0L3 594 MTA3 "Uncharacterized protein" 0.405 0.260 0.805 5.7e-86
UNIPROTKB|Q9BTC8594 MTA3 "Metastasis-associated pr 0.400 0.257 0.808 9.2e-86
ZFIN|ZDB-GENE-030131-6485 709 mta3 "metastasis associated 1 0.439 0.236 0.747 2.4e-85
UNIPROTKB|E1C4P2 697 MTA1 "Uncharacterized protein" 0.452 0.248 0.743 3.1e-85
UNIPROTKB|E1C4P3521 MTA1 "Uncharacterized protein" 0.452 0.332 0.743 3.1e-85
UNIPROTKB|F1N9W5 624 MTA1 "Uncharacterized protein" 0.452 0.277 0.743 3.1e-85
UNIPROTKB|F1PXZ3534 MTA3 "Uncharacterized protein" 0.400 0.286 0.820 3.1e-85
UNIPROTKB|D6W5A2537 MTA3 "Metastasis associated 1 0.400 0.284 0.814 8.2e-85
FB|FBgn0027951 MTA1-like "MTA1-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 669 (240.6 bits), Expect = 5.7e-86, Sum P(2) = 5.7e-86
 Identities = 135/179 (75%), Positives = 150/179 (83%)

Query:    71 LNETESLL-----SYLNKEPRSFVVSLPS--TFARALDCSSSVKQPSLHMSAAAASRDIT 123
             L E ESL+     S  +++   F+V   S  TFARALDCSSSVKQPSLHMSAAAASRDIT
Sbjct:   256 LEELESLVWTPEHSLTDRKIDQFLVVSRSIGTFARALDCSSSVKQPSLHMSAAAASRDIT 315

Query:   124 LFHAMDTLDKHKYSLAEAISSLVPSTGPVLCRDEMEEWSASEANLFEEALEKYGKDFNDI 183
             LFHAM+ L KH+YS+ E++SSLVPSTGPVLCRDE+E+WSASEANLFEEALEKYGKDFNDI
Sbjct:   316 LFHAMNILHKHEYSIEESMSSLVPSTGPVLCRDEIEDWSASEANLFEEALEKYGKDFNDI 375

Query:   184 RNDFLPWKTLKNIIEYYYMWKTTDRYVQQKRVKAVEAESKLKQVYIPNYNKPPQGSAAT 242
             R DFLPWKTLK IIEYYYMWKTTDRYVQQKRVKAVEAE KLKQVYIP YN   +G+  +
Sbjct:   376 RQDFLPWKTLKQIIEYYYMWKTTDRYVQQKRVKAVEAELKLKQVYIPQYNNNGKGNGTS 434
GO:0000118 "histone deacetylase complex" evidence=IDA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0003682 "chromatin binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0006911 "phagocytosis, engulfment" evidence=IMP
UNIPROTKB|E1BZ44 MTA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0L3 MTA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BTC8 MTA3 "Metastasis-associated protein MTA3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6485 mta3 "metastasis associated 1 family, member 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4P2 MTA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4P3 MTA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9W5 MTA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXZ3 MTA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D6W5A2 MTA3 "Metastasis associated 1 family, member 3, isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9BTC8MTA3_HUMANNo assigned EC number0.80370.40310.2592yesN/A
A6QL72MTA3_BOVINNo assigned EC number0.79610.40310.2610yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query382
cd1166146 cd11661, SANT_MTA3_like, Myb-Like Dna-Binding Doma 1e-24
cd04709164 cd04709, BAH_MTA, BAH, or Bromo Adjacent Homology 8e-22
cd04709164 cd04709, BAH_MTA, BAH, or Bromo Adjacent Homology 2e-17
pfam0144855 pfam01448, ELM2, ELM2 domain 3e-13
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-06
cd04370123 cd04370, BAH, BAH, or Bromo Adjacent Homology doma 1e-05
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-05
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 3e-05
pfam01426120 pfam01426, BAH, BAH domain 3e-05
smart00439121 smart00439, BAH, Bromo adjacent homology domain 5e-04
>gnl|CDD|212559 cd11661, SANT_MTA3_like, Myb-Like Dna-Binding Domain of MTA3 and related proteins Back     alignment and domain information 
 Score = 94.6 bits (236), Expect = 1e-24
 Identities = 32/46 (69%), Positives = 38/46 (82%)

Query: 160 EWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKT 205
           EWS SEA LFEE L KYGKDF+DIR DFLPWK++  ++E+YYMWK 
Sbjct: 1   EWSESEAKLFEEGLRKYGKDFHDIRQDFLPWKSVGELVEFYYMWKK 46

Members in this SANT/myb family include domains found in mouse metastasis-associated protein 3 (MTA3) proteins and arginine-glutamic dipeptide (RERE) repeats proteins. SANT (SWI3, ADA2, N-CoR and TFIIIB) DNA-binding domains are a diverse set of proteins that share a common 3 alpha-helix bundle. MTA3 has been shown to interact with nucleosome remodeling and deacetylase (NuRD) proteins CHD4 and HDAC1, and the core cohesin complex protein RAD21 in the ovary, and regulate G2/M progression in proliferating granulosa cells. RERE belongs to the atrophin family and has been identified as a nuclear receptor corepressor; altered expression levels of RERE are associated with cancer in humans while mutations of Rere in mice cause failure in closing the anterior neural tube and fusion of the telencephalic and optic vesicles during embryogenesis. Length = 46
>gnl|CDD|240060 cd04709, BAH_MTA, BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>gnl|CDD|240060 cd04709, BAH_MTA, BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>gnl|CDD|216509 pfam01448, ELM2, ELM2 domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|216495 pfam01426, BAH, BAH domain Back     alignment and domain information
>gnl|CDD|214664 smart00439, BAH, Bromo adjacent homology domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 382
KOG3554|consensus 693 100.0
KOG3554|consensus 693 99.97
KOG4329|consensus445 99.91
cd04709164 BAH_MTA BAH, or Bromo Adjacent Homology domain, as 99.86
KOG1194|consensus 534 99.82
KOG4167|consensus907 99.76
PF0144855 ELM2: ELM2 domain; InterPro: IPR000949 The ELM2 (E 99.64
KOG2133|consensus 1229 98.85
cd04710135 BAH_fungalPHD BAH, or Bromo Adjacent Homology doma 98.69
KOG1194|consensus 534 98.42
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 98.2
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.17
cd04711137 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai 97.89
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 97.86
PF01426119 BAH: BAH domain; InterPro: IPR001025 The BAH (brom 97.84
cd04708202 BAH_plantDCM_II BAH, or Bromo Adjacent Homology do 97.51
cd04716122 BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom 97.45
cd04370123 BAH BAH, or Bromo Adjacent Homology domain (also c 97.18
KOG2133|consensus 1229 97.11
cd04714121 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, 97.08
KOG1878|consensus 1672 96.96
cd04713146 BAH_plant_3 BAH, or Bromo Adjacent Homology domain 96.59
smart00439120 BAH Bromo adjacent homology domain. 96.48
KOG4329|consensus 445 96.4
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 96.16
cd04717121 BAH_polybromo BAH, or Bromo Adjacent Homology doma 95.53
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 94.91
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 94.33
cd04760124 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain 93.95
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 93.16
cd04721130 BAH_plant_1 BAH, or Bromo Adjacent Homology domain 92.43
cd04712130 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, 91.24
smart0040152 ZnF_GATA zinc finger binding to DNA consensus sequ 90.87
cd0020254 ZnF_GATA Zinc finger DNA binding domain; binds spe 90.78
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 89.47
cd04720179 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do 88.84
KOG4468|consensus 782 88.8
KOG0457|consensus 438 87.15
PF0032036 GATA: GATA zinc finger; InterPro: IPR000679 Zinc f 86.79
cd04719128 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d 86.12
KOG4167|consensus 907 85.23
cd04715159 BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom 81.46
KOG1279|consensus506 80.65
>KOG3554|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.1e-85  Score=657.95  Aligned_cols=259  Identities=68%  Similarity=1.032  Sum_probs=244.8

Q ss_pred             ccChhhhhhhccccccccccccccccccccCceeeeecccchhhhhccCCCCcee-------------------------
Q psy2137          34 ELTNKQKHQLKQRELFLSRQVETLPATHIRGKCSVTLLNETESLLSYLNKEPRSF-------------------------   88 (382)
Q Consensus        34 ~l~~~~~~~~~~ReLf~S~~~e~~P~t~iRGkC~v~~~~e~e~l~~yl~keDtFf-------------------------   88 (382)
                      .||++|||||+|||||+|||.|++|++||||||+|++++|.|++.+|+++||+||                         
T Consensus        94 dlt~~qrhqLrhrElFlsRQ~EsLPAthIRGKCsV~LLnete~~~~YL~~eDtFfySLVyDP~~kTLLADkGeIRVG~kY  173 (693)
T KOG3554|consen   94 DLTEKQRHQLRHRELFLSRQSESLPATHIRGKCSVTLLNETESLQSYLEKEDTFFYSLVYDPNQKTLLADKGEIRVGEKY  173 (693)
T ss_pred             CCCHHHHHHHHHHHHHHhhhhccCchhhhccceeEEEecChHHHHhhccccceeEEEeeeccchhhhhccCcceeecccc
Confidence            5999999999999999999999999999999999999999999999999999999                         


Q ss_pred             -----------------------eeecC-------------------cchhhhhccCCCcccCccccccccccccchHHH
Q psy2137          89 -----------------------VVSLP-------------------STFARALDCSSSVKQPSLHMSAAAASRDITLFH  126 (382)
Q Consensus        89 -----------------------LlW~P-------------------g~~~rald~~s~~~~~~l~m~~~~asrd~~l~~  126 (382)
                                             +||+|                   |+|+|||||+|+++||+|||++|+||||+||+|
T Consensus       174 QA~i~e~l~EgEeD~req~klEv~VW~ph~pLTDrqIDQflvVARsVGtFARAlDcsSsvrqPsLhmsAAaASRDiTlFH  253 (693)
T KOG3554|consen  174 QADIPEWLEEGEEDDREQSKLEVKVWDPHNPLTDRQIDQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDITLFH  253 (693)
T ss_pred             cccchHHHHhccccccccccceeEeecCCCCcchhcchhhehhhhhhhHHHHhhcccccccCcchhhhhhhhcccchhhh
Confidence                                   78888                   899999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCHHHHHHhcCCCCCCccccccCCCCCHHHHHHHHHHHHHhCCCchhhhcccCCCcChhhhhhhccccccC
Q psy2137         127 AMDTLDKHKYSLAEAISSLVPSTGPVLCRDEMEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTT  206 (382)
Q Consensus       127 AL~~L~~~~ydv~~AL~~L~~~~~p~l~~d~~~~WS~eE~~~Fe~al~~yGKdF~~I~k~~lp~Ksv~eiVefYY~WKKt  206 (382)
                      ||++||+++||+.+|+..|++.++|+||+|+|++||..|..+||+|+.+|||||+.||++|||||++.+||+||||||.|
T Consensus       254 AmdtLhr~~YDl~~Ais~LVPlGGPvLCRDemEEWSasEanLFEeALeKyGKDFndIrqdfLPWKSl~sIveyYYmwKtt  333 (693)
T KOG3554|consen  254 AMDTLHRNNYDLSKAISYLVPLGGPVLCRDEMEEWSASEANLFEEALEKYGKDFNDIRQDFLPWKSLTSIVEYYYMWKTT  333 (693)
T ss_pred             HHHHHHHccccHHHHHHHhhcCCCceeehhhhhhccchhhHHHHHHHHHhcccHHHHHHhhcchHHHHHHHHHHHHHhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chHHHHHHHHHHHHhhhcccccCCCCCCCCCCCC----CCCccccCCCC---CCCCccceecccccCccccCCCCCc-cc
Q psy2137         207 DRYVQQKRVKAVEAESKLKQVYIPNYNKPPQGSA----ATPGVVNNNKL---STSGVVVLEIERSFDDYKFGHAFST-RL  278 (382)
Q Consensus       207 ~ry~~~kr~k~~~~~sKlk~v~i~~~~kp~p~~~----~~~~~~~~~~~---~~~~C~~C~t~~S~qWy~~gp~~~~-~~  278 (382)
                      +||.||||+|++++++|++|||||+||||||||.    ++++ +||..-   .+..|++|+|++|.|||+|||+||+ ||
T Consensus       334 dRYvqqKrlKaaeadsKlkqvYIP~ynKPnpnqI~~~n~k~g-~~gtt~~~~~g~~CEsC~ttqs~qWYsWGppnmqcrL  412 (693)
T KOG3554|consen  334 DRYVQQKRLKAAEADSKLKQVYIPTYNKPNPNQISPYNTKPG-MNGTTFQNQDGRACESCYTTQSLQWYSWGPPNMQCRL  412 (693)
T ss_pred             hHHHHHHhhhhhhhhhhhheeeccCCCCCCcceecccCCCcC-cccccccCCCCCcccccccccccceeccCCCCccchh
Confidence            9999999999999999999999999999999993    3333 333221   2558999999999999999999999 88


Q ss_pred             cccCCCCceeEEEEEEcccc
Q psy2137         279 AMPRDELDTFFYCLVFDPAQ  298 (382)
Q Consensus       279 ~~~~~~~d~f~y~l~ydp~~  298 (382)
                      |-     .||.||..|.--.
T Consensus       413 Ca-----sCWiyWKKygGLk  427 (693)
T KOG3554|consen  413 CA-----SCWIYWKKYGGLK  427 (693)
T ss_pred             hH-----HHHHHHHHhcCcC
Confidence            87     9999999997643

>KOG3554|consensus Back     alignment and domain information
>KOG4329|consensus Back     alignment and domain information
>cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>KOG1194|consensus Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>PF01448 ELM2: ELM2 domain; InterPro: IPR000949 The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown function Back     alignment and domain information
>KOG2133|consensus Back     alignment and domain information
>cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains Back     alignment and domain information
>KOG1194|consensus Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation Back     alignment and domain information
>cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>KOG2133|consensus Back     alignment and domain information
>cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information
>KOG1878|consensus Back     alignment and domain information
>cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>smart00439 BAH Bromo adjacent homology domain Back     alignment and domain information
>KOG4329|consensus Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 Back     alignment and domain information
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p Back     alignment and domain information
>KOG4468|consensus Back     alignment and domain information
>KOG0457|consensus Back     alignment and domain information
>PF00320 GATA: GATA zinc finger; InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins Back     alignment and domain information
>KOG1279|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query382
2crg_A70 Solution Structure Of The Myb-Like Dna-Binding Doma 2e-26
2xaf_B482 Crystal Structure Of Lsd1-Corest In Complex With Pa 5e-05
2yqk_A63 Solution Structure Of The Sant Domain In Arginine-G 7e-05
>pdb|2CRG|A Chain A, Solution Structure Of The Myb-Like Dna-Binding Domain Of Mouse Mta3 Protein Length = 70 Back     alignment and structure 
Iteration: 1

 Score =  116 bits (290), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (94%)
Query: 158 MEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTTDRYVQQKR 214
           MEEWSASEA LFEEALEKYGKDFNDIR DFLPWK+L +IIEYYYMWKTTDRYVQQKR
Sbjct: 8   MEEWSASEACLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKR 64
>pdb|2XAF|B Chain B, Crystal Structure Of Lsd1-Corest In Complex With Para-Bromo- (+)-Cis-2-Phenylcyclopropyl-1-Amine Length = 482 Back     alignment and structure
>pdb|2YQK|A Chain A, Solution Structure Of The Sant Domain In Arginine-Glutamic Acid Dipeptide (Re) Repeats Length = 63 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query382
2crg_A70 Metastasis associated protein MTA3; transcription 7e-27
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 3e-20
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 2e-18
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 6e-18
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 1e-14
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 3e-10
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 2e-06
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 9e-12
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 1e-06
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 6e-04
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 7e-04
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Length = 70 Back     alignment and structure
 Score =  100 bits (251), Expect = 7e-27
 Identities = 52/65 (80%), Positives = 54/65 (83%)

Query: 155 RDEMEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTTDRYVQQKR 214
              MEEWSASEA LFEEALEKYGKDFNDIR DFLPWK+L +IIEYYYMWKTTDRYVQQKR
Sbjct: 5   SSGMEEWSASEACLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKR 64

Query: 215 VKAVE 219
                
Sbjct: 65  SGPSS 69
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Length = 482 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Length = 482 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Length = 482 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query382
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.86
2crg_A70 Metastasis associated protein MTA3; transcription 99.83
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.75
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 99.65
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.56
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 99.23
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.81
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 97.53
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.51
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 97.4
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 97.24
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 96.33
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 97.06
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 96.88
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 96.75
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 96.68
2cjj_A93 Radialis; plant development, DNA-binding protein, 96.65
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 96.57
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 96.5
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 96.45
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 96.44
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 96.43
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 96.28
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 96.02
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 95.52
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 95.26
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 95.12
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 94.82
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 94.81
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 94.77
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 93.96
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 93.9
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 93.68
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 93.61
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 93.6
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 93.6
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 93.57
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 93.1
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 92.96
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 92.56
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 92.56
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 92.28
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 92.15
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 91.69
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 89.89
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 88.62
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 88.62
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 87.34
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 85.71
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 84.38
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
Probab=99.86  E-value=2.3e-23  Score=213.42  Aligned_cols=116  Identities=24%  Similarity=0.477  Sum_probs=0.0

Q ss_pred             ccCCCCceeeeecCcc-hh-hhhccCCCcccCccccccccccccchHHHHHHHHHhcCCCHHHHHHhcCCCCCCcccccc
Q psy2137          80 YLNKEPRSFVVSLPST-FA-RALDCSSSVKQPSLHMSAAAASRDITLFHAMDTLDKHKYSLAEAISSLVPSTGPVLCRDE  157 (382)
Q Consensus        80 yl~keDtFfLlW~Pg~-~~-rald~~s~~~~~~l~m~~~~asrd~~l~~AL~~L~~~~ydv~~AL~~L~~~~~p~l~~d~  157 (382)
                      |...++.-.|||+|.. +. ..++       ..|.+++..+++|  +++||++||+++||+++||..|.+. .|.     
T Consensus       124 ~~~~~~~e~LvW~P~~~l~d~~ld-------eYL~~Ars~~g~n--~EqAL~~L~~~~yDi~~AL~~L~~~-~p~-----  188 (482)
T 2xag_B          124 SQERDNLGMLVWSPNQNLSEAKLD-------EYIAIAKEKHGYN--MEQALGMLFWHKHNIEKSLADLPNF-TPF-----  188 (482)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ccccCccceeEecCCCCCCHHHHH-------HHHHHHHHhcCcc--HHHHHHHHHHccCCHHHHHHHHhcc-ccc-----
Confidence            3334566679999963 22 1122       1234555556666  4599999999999999999999765 342     


Q ss_pred             CCCCCHHHHHHHHHHHHHhCCCchhhhcccCCCcChhhhhhhccccccCchHHH
Q psy2137         158 MEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTTDRYVQ  211 (382)
Q Consensus       158 ~~~WS~eE~~~Fe~al~~yGKdF~~I~k~~lp~Ksv~eiVefYY~WKKt~ry~~  211 (382)
                      ++.||++|+++|+++|.+|||+|++|++ +||+|++++||+|||+|||+.+|++
T Consensus       189 ~d~WT~eE~~lFe~al~~yGKdF~~I~~-~lp~Ksv~e~V~yYY~WKKt~~yk~  241 (482)
T 2xag_B          189 PDEWTVEDKVLFEQAFSFHGKTFHRIQQ-MLPDKSIASLVKFYYSWKKTRTKTS  241 (482)
T ss_dssp             ------------------------------------------------------
T ss_pred             ccccCHHHHHHHHHHHHHcCccHHHHHH-HcCCCCHHHHHHHhccccccccHHH
Confidence            4789999999999999999999999998 8999999999999999999999855
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 382
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 2e-21
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 4e-12
d1m4za_217 b.34.12.1 (A:) Origin-recognition complex protein 2e-09
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-08
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Metastasis associated protein MTA3
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 84.1 bits (208), Expect = 2e-21
 Identities = 52/57 (91%), Positives = 54/57 (94%)

Query: 158 MEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTTDRYVQQKR 214
           MEEWSASEA LFEEALEKYGKDFNDIR DFLPWK+L +IIEYYYMWKTTDRYVQQKR
Sbjct: 1   MEEWSASEACLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKR 57
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query382
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.77
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.25
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.99
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 98.27
d1m4za_217 Origin-recognition complex protein 120kDa subunit, 97.93
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 97.63
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 97.18
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.12
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 97.0
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 96.89
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 96.46
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 96.24
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 95.66
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 94.65
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 93.85
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 89.72
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 87.3
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 85.9
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Metastasis associated protein MTA3
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.77  E-value=1.8e-20  Score=139.38  Aligned_cols=57  Identities=91%  Similarity=1.507  Sum_probs=53.3

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCCchhhhcccCCCcChhhhhhhccccccCchHHHHHH
Q psy2137         158 MEEWSASEANLFEEALEKYGKDFNDIRNDFLPWKTLKNIIEYYYMWKTTDRYVQQKR  214 (382)
Q Consensus       158 ~~~WS~eE~~~Fe~al~~yGKdF~~I~k~~lp~Ksv~eiVefYY~WKKt~ry~~~kr  214 (382)
                      ++.||++|+.+|++|+.+|||||+.|+++++|+||+++||+|||.||||++|+++||
T Consensus         1 ~d~WT~eE~~~F~~~~~~yGKdf~~I~~~~v~~Ks~~~~v~fYY~~Kkt~~y~~~kr   57 (57)
T d2crga1           1 MEEWSASEACLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKR   57 (57)
T ss_dssp             SCCCCHHHHHHHHHHHHHTCSCHHHHHHTTCSSSCHHHHHHHHHHHHTCCSSCSCCC
T ss_pred             CCCCCHHHHHHHHHHHHHHcccHHHHHHHHcCCCCHHHHHHHHHHHhCCchHhhccC
Confidence            478999999999999999999999999867899999999999999999999987654
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure