Psyllid ID: psy2160


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770---
DRSKYVHYEGDVAVYTDPQSRQQYTWDNEKNEWKLRQIDYEFDGSNYFYKDKTGTKYKWDTASNSWVPSVPLVTSDKAADSSDEEEYDENNAQKTAPPIQRQDMSKGSYGYEGDTHTYTDSTDGTVYIWDKEKNAWFPKVDDDFLARYQMSYGFIEQPNTVDEKKPSADLVQSKVEEKSVDATAPMENPKAEEKVVPGQKRKPEPPKWFDIGEESTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQEKLFDWRPDKMRGERSKNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQETAEEREARLKKWETFLGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQENTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQEKLFDWRPDKMRGERSKNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQETAEEREARLKKWETFLEEEDKKKKEAGKGSIDEKESKELQAPLTK
cccccEEEEccEEEEEccccccEEEEcccccccccccccccccccccEEccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEcccccccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHcccccEEcccccccEEEEEEccccccccccEEEEEccccHHHHHHHHHcccccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHccccEEEEEEEccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHccccEEEccccccEEEEEEEccccccccccEEEEccccHHHHHHHHHcccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccEEEEEEccHHHHHHHHHHHcccEEccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc
cccEEEEEcccEEEEEccccccEEEEccccccccccccccccccccccEccccccEEEEccccccccccccccccHHHcccccccccccHHHHHHHHHHccccccccccccccccccccccccccEEEEcHccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccEEEEccccccccHHHHHHHHcccccEcEcccccccEEEEEEEcccccccccEEEEEccHHHHHHHHHHHccccccccEEEEEEEEEccccccccHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccHEEEEEccccHHHHHHcHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEEEccHHHHHHHHHHHcccEEcccEEEEEEEcccccEEEEccHHHHHHHHHHHHHHHcccHHHHccccccccccccccccccccccccHHccccHccccEEEEEcccccccHHHHHHHHHHcccEEEcccccccEEEEEEccccccccccEEEEEccHHHHHHHHHHHccccccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEccccHHHHHccHHHHHHHHHHHHHHHcccccEEEEEEEccccccEEEEEEccHHHHHHHHHHHcccEEccEEEEEEEccccEEEEEEccHHHHHHHHHHHHHHHHccHHcccccccccccccccccccccccc
drskyvhyegdvavytdpqsrqqytwdneknewKLRQIdyefdgsnyfykdktgtkykwdtasnswvpsvplvtsdkaadssdeeeydennaqktappiqrqdmskgsygyegdthtytdstdgtvyiwdkeknawfpkvddDFLARYQMSygfieqpntvdekkpsadlvQSKVeeksvdatapmenpkaeekvvpgqkrkpeppkwfdigeesTKVYVsnlpldltQEEFVEVMQKCGLvmkdvdtnqmkiklytdpytkdfkgdalCTYIKKESVDLALSILDGYEIRGKKIKVERAKFtmkgeaydpklkpkkKRKKDLEKLKKAQEKLFdwrpdkmrgerskneSVIIVKnlfdpalfdkDVTLILEYQQDLREEcskcghvkkvvlhdkhpegvaqiffkepeAADACRELLNgrwfgqrqitaetwdgktrYKIQETAEEREARLKKWETFLGKKIKVERAKFtmkgeaydpklkpkkKRKKDLEKLKKAQENTKVYVsnlpldltQEEFVEVMQKCGLvmkdvdtnqmkiklytdpytkdfkgdalCTYIKKESVDLALSILDGYEIRGKKIKVERAKFtmkgeaydpklkpkkKRKKDLEKLKKAQEKLFdwrpdkmrgerskneSVIIVKnlfdpalfdkDVTLILEYQQDLREEcskcghvkkvvlhdkhpegvaqiffkepeAADACRELLNgrwfgqrqitaetwdgktrYKIQETAEEREARLKKWETFLEEEDKKKkeagkgsidekeskelqapltk
drskyvhyegdvavytdpqsrqqytwdneknewklrQIDYEFDGSNYFYKDKTGTKYKwdtasnswvpsvplvTSDKAADSSDeeeydennaqktappiqrqdmSKGSYGYEGDthtytdstdgtvYIWDKEKNAWFPKVDDDFLARYQMSYGFieqpntvdekkpSADLVQSKVEEksvdatapmenpkaeekvvpgqkrkpeppkwfdigeeSTKVYVSNLPLDLTQEEFVEVMQKCGLvmkdvdtnqMKIKlytdpytkdfkGDALCTYIKKESVDLALSildgyeirgkkikverakftmkgeaydpklkpkkkrkkdleKLKKaqeklfdwrpdkmrgersknesviivknlfdpalfdkDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLngrwfgqrqitaetwdgktryKIQETAEEREARLkkwetflgkkikverakftmkgeaydpklkpkkkrkKDLEKlkkaqentkvyvsnlpldltQEEFVEVMQKCGLvmkdvdtnqMKIKlytdpytkdfkGDALCTYIKKESVDLALSildgyeirgkkikverakftmkgeaydpklkpkkkrkkdleKLKKaqeklfdwrpdkmrgersknesviivknlfdpalfdkDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLngrwfgqrqitaetwdgktrykIQETAEEREARLKKWETfleeedkkkkeagkgsidekeskelqapltk
DRSKYVHYEGDVAVYTDPQSRQQYTWDNEKNEWKLRQIDYEFDGSNYFYKDKTGTKYKWDTASNSWVPSVPLVTsdkaadssdeeeydennaQKTAPPIQRQDMSKGSYGYEGDTHTYTDSTDGTVYIWDKEKNAWFPKVDDDFLARYQMSYGFIEQPNTVDEKKPSADLVQSKVEEKSVDATAPMENPKAEEKVVPGQKRKPEPPKWFDIGEESTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIKVERAKFTMKGEAYDPklkpkkkrkkdleklkkaqeklFDWRPDKMRGERSKNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQETAEEREARLKKWETFLGKKIKVERAKFTMKGEAYDPklkpkkkrkkdleklkkAQENTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIKVERAKFTMKGEAYDPklkpkkkrkkdleklkkaqeklFDWRPDKMRGERSKNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQETAEEREARLKKWETFLeeedkkkkeAGKGSIDEKESKELQAPLTK
****YVHYEGDVAVYTDPQSRQQYTWDNEKNEWKLRQIDYEFDGSNYFYKDKTGTKYKWDTASNSWVPSVP*******************************************THTYTDSTDGTVYIWDKEKNAWFPKVDDDFLARYQMSYGFIE***************************************************WFDIGEESTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIKVERAKF***********************************************SVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQETA***EARLKKWETFLGKKIKVERAKF*******************************KVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIKVERAKF***********************************************SVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKI***********************************************
***KYVHYEGDVAVYTDPQSRQQYTWDNEKNEW*********DGSNYFYKDKTGTKYKWDTASNS************************************************DTHTYTDSTDGTVYIWDKEKNAWFPKVDDDFLARYQMSYGFIE************************************************************KVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIK**************************************************KNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQ*********LKKWETFLGKKIKVERAKFTM************************AQENTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKK****************************************************KNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTR**************************************************
DRSKYVHYEGDVAVYTDPQSRQQYTWDNEKNEWKLRQIDYEFDGSNYFYKDKTGTKYKWDTASNSWVPSVPLVT*************************QRQDMSKGSYGYEGDTHTYTDSTDGTVYIWDKEKNAWFPKVDDDFLARYQMSYGFIEQPNTVDEKKPSADLVQSKVEEKSVDATAP*****************PEPPKWFDIGEESTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQEKLFDWRPDKMRGERSKNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQETAEEREARLKKWETFLGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQENTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQEKLFDWRPDKMRGERSKNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQETAEEREARLKKWETFLEE***************************
*RSKYVHYEGDVAVYTDPQSRQQYTWDNEKNEWKLRQIDYEFDGSNYFYKDKTGTKYKWDTASNSWVPS****************EYDENNAQKTAPPIQRQ************THTYTDSTDGTVYIWDKEKNAWFPKVDDDFLARYQMSYGFIE**************************************************KWFDIGEESTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQEKLFDWRPDKMRGERSKNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQETAEEREARLKKWETFLGKK******************************KLKKAQENTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQEKLFDWRPDKMRGERSKNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQETAEEREARLKKWETFLEEE**************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DRSKYVHYEGDVAVYTDPQSRQQYTWDNEKNEWKLRQIDYEFDGSNYFYKDKTGTKYKWDTASNSWVPSVPLVTSDKAADSSDEEEYDENNAQKTAPPIQRQDMSKGSYGYEGDTHTYTDSTDGTVYIWDKEKNAWFPKVDDDFLARYQMSYGFIEQPNTVDEKKPSADLVQSKVEEKSVDATAPMENPKAEEKVVPGQKRKPEPPKWFDIGEESTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQEKLFDWRPDKMRGERSKNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQETAEEREARLKKWETFLGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQENTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQEKLFDWRPDKMRGERSKNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQETAEEREARLKKWETFLEEEDKKKKEAGKGSIDEKESKELQAPLTK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query773 2.2.26 [Sep-21-2011]
Q8BGC0757 HIV Tat-specific factor 1 yes N/A 0.411 0.420 0.456 8e-72
Q5RB63754 HIV Tat-specific factor 1 yes N/A 0.407 0.417 0.448 4e-69
O43719755 HIV Tat-specific factor 1 yes N/A 0.413 0.423 0.443 5e-69
O43120367 Splicing factor U2AF-asso yes N/A 0.386 0.814 0.312 3e-33
P53830285 Cold sensitive U2 snRNA s yes N/A 0.297 0.807 0.315 6e-18
Q9ZR39555 Splicing factor U2af larg N/A N/A 0.314 0.437 0.24 1e-08
Q9ZR40573 Splicing factor U2af larg N/A N/A 0.250 0.338 0.268 2e-08
Q8L716589 Splicing factor U2af larg no N/A 0.247 0.324 0.252 1e-07
Q8T6B9637 Poly(U)-binding-splicing no N/A 0.112 0.136 0.355 5e-07
Q9WV25564 Poly(U)-binding-splicing no N/A 0.108 0.148 0.295 2e-06
>sp|Q8BGC0|HTSF1_MOUSE HIV Tat-specific factor 1 homolog OS=Mus musculus GN=Htatsf1 PE=1 SV=1 Back     alignment and function desciption
 Score =  272 bits (695), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 151/331 (45%), Positives = 211/331 (63%), Gaps = 13/331 (3%)

Query: 113 GDTHTYTDSTDGTVYIWDKEKNAWFPKVDDDFLARYQMSYGFIEQPNTVDEKKPSADLVQ 172
           G+ H+     D T Y WD +K AWFPK+ +DF+A YQ +YGF     + D    S   VQ
Sbjct: 37  GEAHSLGQPPDDTPYEWDLDKKAWFPKITEDFIATYQANYGF-----SSDGASSSTANVQ 91

Query: 173 SKVEEKSVDATAPMENPKAEEKVVPGQKRKPEPPKWFDIGEE-STKVYVSNLPLDLTQEE 231
                K+V+     E P+  +    G+KRK E   WF + E+ +T VYVS LP D+T +E
Sbjct: 92  D-ANTKAVEEPPQKEVPETPDSKRKGEKRKAES-GWFHVEEDRNTNVYVSGLPPDITVDE 149

Query: 232 FVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIR 291
           F+++M K G++M+D  T + K+KLY D    + KGD LC Y+KKESV+LAL +LD  EIR
Sbjct: 150 FIQLMSKFGIIMRDPQTEEFKVKLYKDDQG-NLKGDGLCCYLKKESVELALKLLDEDEIR 208

Query: 292 GKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQEKLFDWRPDKMRG-ERSKNES 350
           G K+ VE AKF +KGE YD   K KK +    +K    Q+K  DWRP++  G  R ++E 
Sbjct: 209 GYKLHVEVAKFQLKGE-YDASKKKKKCKDY--KKKLSLQQKQLDWRPERRAGPNRLRHER 265

Query: 351 VIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEA 410
           V+I+KN+F P  F+ D  ++ E ++DLR ECSK G ++K++L D+HP+GVA + F+EPE 
Sbjct: 266 VVILKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFREPEE 325

Query: 411 ADACRELLNGRWFGQRQITAETWDGKTRYKI 441
           AD C + L+GRWFG RQITA+ WDG T Y++
Sbjct: 326 ADHCIQTLDGRWFGGRQITAQAWDGTTDYQV 356




Functions as a general transcription factor playing a role in the process of transcriptional elongation. May mediate the reciprocal stimulatory effect of splicing on transcriptional elongation.
Mus musculus (taxid: 10090)
>sp|Q5RB63|HTSF1_PONAB HIV Tat-specific factor 1 homolog OS=Pongo abelii GN=HTATSF1 PE=2 SV=1 Back     alignment and function description
>sp|O43719|HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens GN=HTATSF1 PE=1 SV=1 Back     alignment and function description
>sp|O43120|UAP2_SCHPO Splicing factor U2AF-associated protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uap2 PE=1 SV=1 Back     alignment and function description
>sp|P53830|CUS2_YEAST Cold sensitive U2 snRNA suppressor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZR39|U2A2A_NICPL Splicing factor U2af large subunit A OS=Nicotiana plumbaginifolia GN=U2AF65A PE=2 SV=1 Back     alignment and function description
>sp|Q9ZR40|U2A2B_NICPL Splicing factor U2af large subunit B OS=Nicotiana plumbaginifolia GN=U2AF65B PE=2 SV=1 Back     alignment and function description
>sp|Q8L716|U2A2B_ARATH Splicing factor U2af large subunit B OS=Arabidopsis thaliana GN=U2AF65B PE=2 SV=2 Back     alignment and function description
>sp|Q8T6B9|PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster GN=pUf68 PE=1 SV=2 Back     alignment and function description
>sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query773
156552643583 PREDICTED: HIV Tat-specific factor 1 hom 0.557 0.739 0.525 1e-121
380027330482 PREDICTED: HIV Tat-specific factor 1 hom 0.496 0.796 0.516 1e-110
194875554554 GG13238 [Drosophila erecta] gi|190655403 0.557 0.777 0.494 1e-109
195495582554 GE22336 [Drosophila yakuba] gi|194181430 0.557 0.777 0.494 1e-109
350418587488 PREDICTED: HIV Tat-specific factor 1 hom 0.510 0.809 0.505 1e-109
321479438460 hypothetical protein DAPPUDRAFT_299831 [ 0.552 0.928 0.473 1e-108
195376801541 GJ12075 [Drosophila virilis] gi|19415433 0.576 0.824 0.482 1e-107
198466675601 GA19321 [Drosophila pseudoobscura pseudo 0.562 0.723 0.493 1e-107
158295648665 AGAP006266-PA [Anopheles gambiae str. PE 0.575 0.669 0.474 1e-107
21357269556 barricade, isoform A [Drosophila melanog 0.579 0.805 0.479 1e-107
>gi|156552643|ref|XP_001603250.1| PREDICTED: HIV Tat-specific factor 1 homolog [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  442 bits (1138), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 247/470 (52%), Positives = 320/470 (68%), Gaps = 39/470 (8%)

Query: 3   SKYVHYEGDVAVYTDPQSRQQYTWDNEKNEWKLR-----------QIDYEFDGSNYFYKD 51
           S+ + Y+GD  +YT+P + +Q  W++++N+W                +YEFDG NY Y D
Sbjct: 119 SENITYKGDKCIYTEPGTGRQLIWNSKENKWCAEGGSTSADTTDAMKNYEFDGKNYVYTD 178

Query: 52  KT-GTKYKWDTASNSWVPSVPLVTSDKAADSSDEEEYDENNAQKTAPPIQRQDMSKGSYG 110
           KT    YK+    N WV     V  DK +++ D    +EN+      P Q     +G YG
Sbjct: 179 KTTNVTYKFIQDKNEWV-----VKDDKHSETKD----NENDNADVPKPAQ-----EGVYG 224

Query: 111 YEGDTHTYTDSTDGTVYIWDKEKNAWFPKVDDDFLARYQMSYGFIEQPNTVDEKKPSADL 170
           +E DTHTYTD +DGT YIWD+EKNAWFPKVDDDF+ARYQMSYGF +  NT       +D 
Sbjct: 225 FENDTHTYTDPSDGTSYIWDREKNAWFPKVDDDFMARYQMSYGFTD--NT------KSDT 276

Query: 171 VQSKVEEKSVDATAPMENPKAEEKVVPGQKRKPEPPKWFDIGE-ESTKVYVSNLPLDLTQ 229
            +S+V +   +   P +    EEK    +++  EPP WFDI E  +T +Y+SNLPLD+T 
Sbjct: 277 TESEVPKNPSNEPEPPKKLTKEEKKAENKRKNQEPPTWFDIDEAHNTTIYISNLPLDVTM 336

Query: 230 EEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYE 289
           EE  E++ KCGL+ +D +  + K+KLYTD    + KGDA CTYIK ESVDLAL+ILDG++
Sbjct: 337 EELKELVTKCGLLARD-EKGKDKLKLYTDA-DGEPKGDARCTYIKIESVDLALNILDGWQ 394

Query: 290 IRGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQEKLFDWRPDKMRGERSKNE 349
           +R K + V+RAKF +KG AYDP LK  K++KKD +K KK  EKL DWRPDK++GE  K E
Sbjct: 395 MRDKTLSVQRAKFQLKG-AYDPSLK-PKRKKKDKDKQKKIHEKLLDWRPDKLKGEPLKCE 452

Query: 350 SVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPE 409
            V+I+KNLF P  FDKDVTL+LEYQQD+R+EC KCG VKKV ++D+HPEGVAQ+ FKEPE
Sbjct: 453 RVVIIKNLFKPEDFDKDVTLLLEYQQDVRKECIKCGEVKKVTIYDRHPEGVAQVTFKEPE 512

Query: 410 AADACRELLNGRWFGQRQITAETWDGKTRYKIQETAEEREARLKKWETFL 459
            A AC +LLNGRWF QR+ITAE WDGKT+YKI ET E+ EAR+ KW+ FL
Sbjct: 513 EAQACIQLLNGRWFDQRRITAEIWDGKTKYKILETEEQIEARINKWDKFL 562




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380027330|ref|XP_003697380.1| PREDICTED: HIV Tat-specific factor 1 homolog [Apis florea] Back     alignment and taxonomy information
>gi|194875554|ref|XP_001973620.1| GG13238 [Drosophila erecta] gi|190655403|gb|EDV52646.1| GG13238 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195495582|ref|XP_002095329.1| GE22336 [Drosophila yakuba] gi|194181430|gb|EDW95041.1| GE22336 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|350418587|ref|XP_003491906.1| PREDICTED: HIV Tat-specific factor 1 homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|321479438|gb|EFX90394.1| hypothetical protein DAPPUDRAFT_299831 [Daphnia pulex] Back     alignment and taxonomy information
>gi|195376801|ref|XP_002047181.1| GJ12075 [Drosophila virilis] gi|194154339|gb|EDW69523.1| GJ12075 [Drosophila virilis] Back     alignment and taxonomy information
>gi|198466675|ref|XP_001354089.2| GA19321 [Drosophila pseudoobscura pseudoobscura] gi|198150709|gb|EAL29828.2| GA19321 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|158295648|ref|XP_316330.4| AGAP006266-PA [Anopheles gambiae str. PEST] gi|157016137|gb|EAA10753.4| AGAP006266-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|21357269|ref|NP_649313.1| barricade, isoform A [Drosophila melanogaster] gi|24668057|ref|NP_730629.1| barricade, isoform C [Drosophila melanogaster] gi|16769348|gb|AAL28893.1| LD27763p [Drosophila melanogaster] gi|23094232|gb|AAN12166.1| barricade, isoform A [Drosophila melanogaster] gi|23094233|gb|AAN12167.1| barricade, isoform C [Drosophila melanogaster] gi|220946898|gb|ACL85992.1| CG6049-PA [synthetic construct] gi|220956554|gb|ACL90820.1| CG6049-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query773
FB|FBgn0037081556 barc "barricade" [Drosophila m 0.593 0.825 0.442 9.5e-105
ZFIN|ZDB-GENE-040426-1578450 htatsf1 "HIV TAT specific fact 0.441 0.757 0.470 1.9e-85
MGI|MGI:1919709757 Htatsf1 "HIV TAT specific fact 0.434 0.443 0.446 7.4e-84
RGD|1563377776 Htatsf1 "HIV-1 Tat specific fa 0.434 0.432 0.444 6.6e-83
UNIPROTKB|G3N370756 HTATSF1 "Uncharacterized prote 0.437 0.447 0.436 1e-80
UNIPROTKB|F1P1G7450 HTATSF1 "Uncharacterized prote 0.455 0.782 0.453 2.2e-80
UNIPROTKB|I3LC46760 HTATSF1 "Uncharacterized prote 0.434 0.442 0.441 2e-79
UNIPROTKB|E2R8T8750 HTATSF1 "Uncharacterized prote 0.434 0.448 0.432 1.4e-78
UNIPROTKB|J9NZQ1768 HTATSF1 "Uncharacterized prote 0.434 0.437 0.432 1.4e-78
UNIPROTKB|O43719755 HTATSF1 "HIV Tat-specific fact 0.437 0.447 0.440 1.4e-76
FB|FBgn0037081 barc "barricade" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1037 (370.1 bits), Expect = 9.5e-105, P = 9.5e-105
 Identities = 215/486 (44%), Positives = 298/486 (61%)

Query:     4 KYVHYEGDV-AVYTDPQSRQQYTWDNEKNEWKLRQIDYEFDG-SNYFYKDKTGTKYKWDT 61
             +++ Y  D  A+YTDP ++Q+Y W    N W+   +D + DG +   Y+++    YKW  
Sbjct:    74 EHMTYGADGGAIYTDPSTKQKYKWCATGNNWQPLGVDEDVDGQAEDPYENE---HYKWCP 130

Query:    62 ASNSWVPSVPLVTXXXXXXXXXXXXXXXXXXQKTAPPIQRQDMSKGSYGY-EGDTHTYTD 120
              S  W+P                        QK   P       +G  G  E    TYTD
Sbjct:   131 KSQQWLPK---------KQETETEHYKWDDEQKKWVPKHPNPGQEGVCGVDEHGERTYTD 181

Query:   121 STDGTVYIWDKEKNAWFPKVDDDFLARYQMSYGFIEQPNTVDEKKPSADLVQSKVEEKSV 180
               DG  + WD  K+AWFPK+DDDF+ARYQM+YGFI+  +  +++K   +  ++K +E+ +
Sbjct:   182 K-DGVEFFWDATKSAWFPKIDDDFMARYQMNYGFIDNTSAGEKEKAEKEAAEAKRKEEEL 240

Query:   181 -----DATAPM--ENPKAEEKVVPGQKRKPEPPKWFDIGE-ESTKVYVSNLPLDLTQEEF 232
                  +A A M  +NP +   V  G+++  EPPKWF++   ++TKVYVSNLPLD+T +EF
Sbjct:   241 KRMTAEAEAAMSRDNPASSAAVPTGKRKAQEPPKWFEMDPLQNTKVYVSNLPLDITMDEF 300

Query:   233 VEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRG 292
              ++M KCG+VM+D  T + K+KLY +      KGD LC YIK ESV+LAL ILD Y +RG
Sbjct:   301 ADLMGKCGMVMRDPQTQKFKLKLYAEK-DGQIKGDGLCDYIKVESVNLALKILDEYNLRG 359

Query:   293 KKIKVERAKFTMKGEAYDPXXXXXXXXXXXXXXXXXXXXXXFDWRPDKMRGERSKNESVI 352
              KI+V+RA+F M+GE Y+P                      FDWRPDK+RGERSKNE  +
Sbjct:   360 HKIRVQRAQFQMRGE-YNPALKPKRKKKDKEKLQKMKEKL-FDWRPDKLRGERSKNEKTV 417

Query:   353 IVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAAD 412
             I+KNLF P LF+K+V LILEYQ +LREECSKCG V+KVV++D+HP+GVAQI    PE AD
Sbjct:   418 IIKNLFTPELFEKEVELILEYQNNLREECSKCGMVRKVVIYDRHPDGVAQINMASPEEAD 477

Query:   413 ACRELLNGRWFGQRQITAETWDGKTRYKIQETAEEREARLKKWETFLGKKIKVERAKFTM 472
                +++ GR+FGQRQ++AE WDGKT+YKI+E+A E   RL KW+ FL ++   ++A   M
Sbjct:   478 LVIQMMQGRYFGQRQLSAEAWDGKTKYKIEESAVEAHERLSKWDEFLAEEETDKKASEDM 537

Query:   473 KGEAYD 478
             K E  D
Sbjct:   538 KEEDVD 543


GO:0003729 "mRNA binding" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0030182 "neuron differentiation" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
ZFIN|ZDB-GENE-040426-1578 htatsf1 "HIV TAT specific factor 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1919709 Htatsf1 "HIV TAT specific factor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1563377 Htatsf1 "HIV-1 Tat specific factor 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3N370 HTATSF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1G7 HTATSF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LC46 HTATSF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8T8 HTATSF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZQ1 HTATSF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43719 HTATSF1 "HIV Tat-specific factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query773
cd1228291 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 6e-42
cd1228291 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 6e-42
cd1228192 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 5e-40
cd1228192 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 5e-39
cd1228585 cd12285, RRM3_RBM39_like, RNA recognition motif 3 2e-25
cd1228585 cd12285, RRM3_RBM39_like, RNA recognition motif 3 2e-25
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 4e-15
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 4e-15
cd1237485 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti 8e-12
cd1237485 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti 8e-12
smart0036073 smart00360, RRM, RNA recognition motif 1e-11
smart0036073 smart00360, RRM, RNA recognition motif 1e-11
cd1264898 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 i 1e-11
cd1264898 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 i 1e-11
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-10
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-10
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 6e-10
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 6e-10
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 8e-10
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 8e-10
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 8e-10
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 1e-09
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-09
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-09
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 3e-09
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 3e-09
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 3e-09
cd1253483 cd12534, RRM_SARFH, RNA recognition motif in Droso 1e-08
cd1253483 cd12534, RRM_SARFH, RNA recognition motif in Droso 1e-08
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 2e-08
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 2e-08
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 5e-08
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 5e-08
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 5e-08
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 5e-08
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-07
cd1253384 cd12533, RRM_EWS, RNA recognition motif in vertebr 2e-07
cd1253384 cd12533, RRM_EWS, RNA recognition motif in vertebr 2e-07
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 5e-07
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 5e-07
cd1264796 cd12647, RRM_UHM_SPF45, RNA recognition motif in U 6e-07
cd1264796 cd12647, RRM_UHM_SPF45, RNA recognition motif in U 6e-07
smart0036073 smart00360, RRM, RNA recognition motif 8e-07
smart0036073 smart00360, RRM, RNA recognition motif 8e-07
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 1e-06
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 1e-06
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-06
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-06
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 3e-06
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 3e-06
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 3e-06
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 3e-06
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-06
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 8e-06
cd12287102 cd12287, RRM_U2AF35_like, RNA recognition motif in 8e-06
cd12287102 cd12287, RRM_U2AF35_like, RNA recognition motif in 8e-06
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-05
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-05
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-05
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-05
cd1253586 cd12535, RRM_FUS_TAF15, RNA recognition motif in v 3e-05
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 3e-05
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 3e-05
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 5e-05
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 5e-05
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 5e-05
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 5e-05
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 6e-05
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 6e-05
pfam0007670 pfam00076, RRM_1, RNA recognition motif 7e-05
pfam0007670 pfam00076, RRM_1, RNA recognition motif 7e-05
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 1e-04
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 1e-04
pfam1389356 pfam13893, RRM_5, RNA recognition motif 1e-04
pfam1389356 pfam13893, RRM_5, RNA recognition motif 1e-04
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-04
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-04
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 1e-04
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 1e-04
cd1253586 cd12535, RRM_FUS_TAF15, RNA recognition motif in v 2e-04
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 2e-04
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 2e-04
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 2e-04
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 2e-04
TIGR01648578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 3e-04
cd1230493 cd12304, RRM_Set1, RNA recognition motif in the Se 4e-04
cd1230493 cd12304, RRM_Set1, RNA recognition motif in the Se 4e-04
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 4e-04
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 4e-04
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 6e-04
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 6e-04
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 7e-04
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 7e-04
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 7e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 0.001
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 0.002
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 0.002
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 0.002
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 0.002
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 0.002
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 0.002
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 0.002
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 0.002
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 0.003
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 0.003
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 0.003
cd1229671 cd12296, RRM1_Prp24, RNA recognition motif 1 in fu 0.003
cd1229671 cd12296, RRM1_Prp24, RNA recognition motif 1 in fu 0.003
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 0.003
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 0.003
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 0.003
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 0.003
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 0.003
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 0.003
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 0.003
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 0.003
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 0.004
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 0.004
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 0.004
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 0.004
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 0.004
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 0.004
>gnl|CDD|240728 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
 Score =  146 bits (372), Expect = 6e-42
 Identities = 58/91 (63%), Positives = 68/91 (74%)

Query: 349 ESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEP 408
           E V+I+KNLF P  F++D TLI E + DLREEC K G VKKVV+ D+HP+GVA + FKEP
Sbjct: 1   EKVVILKNLFSPEEFEEDPTLINELRDDLREECEKFGQVKKVVVFDRHPDGVASVKFKEP 60

Query: 409 EAADACRELLNGRWFGQRQITAETWDGKTRY 439
           E AD C E LNGRWF  RQ+ AE WDGKT Y
Sbjct: 61  EEADRCIEALNGRWFAGRQLEAERWDGKTDY 91


This subfamily corresponds to the RRM2 of Tat-SF1 and CUS2. Tat-SF1 is the cofactor for stimulation of transcriptional elongation by human immunodeficiency virus-type 1 (HIV-1) Tat. It is a substrate of an associated cellular kinase. Tat-SF1 contains two RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and a highly acidic carboxyl-terminal half. The family also includes CUS2, a yeast homolog of human Tat-SF1. CUS2 interacts with U2 RNA in splicing extracts and functions as a splicing factor that aids assembly of the splicing-competent U2 snRNP in vivo. CUS2 also associates with PRP11 that is a subunit of the conserved splicing factor SF3a. Like Tat-SF1, CUS2 contains two RRMs as well. . Length = 91

>gnl|CDD|240728 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240727 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240727 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241092 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 in UHM domain of poly(U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241092 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 in UHM domain of poly(U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240978 cd12534, RRM_SARFH, RNA recognition motif in Drosophila melanogaster RNA-binding protein cabeza and similar proteins Back     alignment and domain information
>gnl|CDD|240978 cd12534, RRM_SARFH, RNA recognition motif in Drosophila melanogaster RNA-binding protein cabeza and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240977 cd12533, RRM_EWS, RNA recognition motif in vertebrate Ewing Sarcoma Protein (EWS) Back     alignment and domain information
>gnl|CDD|240977 cd12533, RRM_EWS, RNA recognition motif in vertebrate Ewing Sarcoma Protein (EWS) Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241091 cd12647, RRM_UHM_SPF45, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|241091 cd12647, RRM_UHM_SPF45, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240733 cd12287, RRM_U2AF35_like, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor U2AF 35 kDa subunit (U2AF35) and similar proteins Back     alignment and domain information
>gnl|CDD|240733 cd12287, RRM_U2AF35_like, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor U2AF 35 kDa subunit (U2AF35) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240979 cd12535, RRM_FUS_TAF15, RNA recognition motif in vertebrate fused in Ewing's sarcoma protein (FUS), TATA-binding protein-associated factor 15 (TAF15) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240979 cd12535, RRM_FUS_TAF15, RNA recognition motif in vertebrate fused in Ewing's sarcoma protein (FUS), TATA-binding protein-associated factor 15 (TAF15) and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240750 cd12304, RRM_Set1, RNA recognition motif in the Set1-like family of histone-lysine N-methyltransferases Back     alignment and domain information
>gnl|CDD|240750 cd12304, RRM_Set1, RNA recognition motif in the Set1-like family of histone-lysine N-methyltransferases Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 773
KOG1548|consensus382 100.0
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 100.0
KOG1548|consensus382 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 100.0
KOG0123|consensus369 100.0
KOG0127|consensus678 100.0
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
KOG0117|consensus506 100.0
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 100.0
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
KOG0124|consensus544 100.0
KOG0145|consensus360 100.0
KOG0147|consensus549 100.0
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.97
KOG0145|consensus360 99.97
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.97
KOG0110|consensus725 99.97
KOG0117|consensus 506 99.96
KOG0148|consensus321 99.96
KOG0144|consensus510 99.95
KOG0127|consensus 678 99.95
KOG0148|consensus321 99.94
KOG0123|consensus369 99.94
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.93
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.92
KOG0144|consensus 510 99.91
KOG1190|consensus492 99.91
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.91
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.91
KOG0110|consensus725 99.9
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.9
KOG0120|consensus500 99.89
KOG4212|consensus 608 99.88
KOG0147|consensus549 99.87
KOG0131|consensus203 99.85
KOG0131|consensus203 99.82
KOG1456|consensus494 99.76
KOG0109|consensus 346 99.75
KOG0146|consensus371 99.75
KOG1190|consensus492 99.72
KOG4211|consensus510 99.71
KOG0124|consensus 544 99.7
KOG0120|consensus500 99.68
KOG0109|consensus346 99.68
KOG0146|consensus371 99.62
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.56
KOG4205|consensus311 99.55
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.54
KOG4206|consensus221 99.52
KOG1365|consensus508 99.5
KOG4206|consensus221 99.5
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.45
KOG0105|consensus241 99.44
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.43
KOG0105|consensus241 99.41
KOG0121|consensus153 99.4
KOG0122|consensus270 99.4
KOG0122|consensus270 99.39
KOG4205|consensus311 99.39
KOG1456|consensus494 99.37
KOG0126|consensus219 99.36
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.35
KOG0126|consensus219 99.32
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.31
KOG1457|consensus284 99.31
PLN03120260 nucleic acid binding protein; Provisional 99.3
KOG1457|consensus284 99.29
KOG4211|consensus 510 99.28
KOG0106|consensus216 99.28
KOG0107|consensus195 99.27
PLN03120260 nucleic acid binding protein; Provisional 99.25
KOG0121|consensus153 99.25
PLN03213 759 repressor of silencing 3; Provisional 99.24
KOG0125|consensus376 99.24
KOG0149|consensus247 99.24
KOG1365|consensus508 99.24
KOG0114|consensus124 99.23
PLN03121243 nucleic acid binding protein; Provisional 99.23
KOG0107|consensus195 99.22
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.22
KOG4212|consensus 608 99.21
KOG4207|consensus256 99.19
PLN03213 759 repressor of silencing 3; Provisional 99.19
KOG0149|consensus247 99.18
smart0036272 RRM_2 RNA recognition motif. 99.18
smart0036272 RRM_2 RNA recognition motif. 99.17
KOG4207|consensus256 99.17
KOG0130|consensus170 99.17
KOG0113|consensus335 99.15
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.15
PLN03121243 nucleic acid binding protein; Provisional 99.15
smart0036071 RRM RNA recognition motif. 99.14
KOG0106|consensus216 99.13
smart0036071 RRM RNA recognition motif. 99.13
KOG0111|consensus298 99.13
KOG0114|consensus124 99.13
KOG0130|consensus170 99.12
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.11
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.11
KOG0125|consensus376 99.11
KOG0113|consensus335 99.11
smart0036170 RRM_1 RNA recognition motif. 99.09
KOG0108|consensus435 99.09
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.06
KOG0108|consensus 435 99.05
KOG0111|consensus298 99.03
smart0036170 RRM_1 RNA recognition motif. 98.92
KOG0128|consensus881 98.89
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.88
KOG1996|consensus378 98.88
KOG4307|consensus944 98.85
KOG4208|consensus214 98.79
KOG4307|consensus944 98.79
KOG1995|consensus351 98.78
KOG4208|consensus214 98.68
KOG0415|consensus479 98.63
KOG0415|consensus479 98.6
KOG0128|consensus881 98.6
KOG1995|consensus351 98.55
KOG4660|consensus549 98.53
KOG0226|consensus290 98.5
KOG4661|consensus 940 98.49
KOG0533|consensus243 98.44
KOG0129|consensus520 98.42
KOG4661|consensus940 98.41
KOG0129|consensus520 98.36
KOG0132|consensus 894 98.35
KOG0132|consensus894 98.33
KOG0153|consensus377 98.28
KOG4209|consensus231 98.28
KOG0533|consensus243 98.27
KOG4454|consensus267 98.26
KOG4454|consensus267 98.24
KOG0226|consensus290 98.2
KOG0153|consensus377 98.16
KOG1996|consensus378 98.13
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.11
KOG0116|consensus419 98.08
KOG4209|consensus231 98.08
KOG4210|consensus285 98.04
KOG0151|consensus 877 97.98
KOG0116|consensus419 97.96
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.95
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.94
KOG0151|consensus 877 97.94
KOG0112|consensus 975 97.94
KOG2202|consensus260 97.92
KOG0112|consensus 975 97.86
KOG4676|consensus479 97.84
KOG4210|consensus285 97.72
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.7
KOG4660|consensus 549 97.67
KOG2193|consensus 584 97.31
KOG2202|consensus260 97.31
KOG4676|consensus 479 97.11
KOG2314|consensus 698 97.1
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.02
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.98
KOG2193|consensus584 96.95
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.83
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.78
KOG2314|consensus698 96.66
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.65
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.45
KOG0115|consensus275 96.45
KOG3152|consensus278 96.42
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.21
KOG3152|consensus278 96.19
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.02
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.02
KOG4849|consensus498 95.87
KOG4849|consensus 498 95.86
KOG0115|consensus275 95.23
KOG1855|consensus484 95.22
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 95.03
PF15023166 DUF4523: Protein of unknown function (DUF4523) 94.94
KOG1855|consensus484 94.6
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 94.52
KOG2416|consensus 718 94.35
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 94.34
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 94.29
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 94.24
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 93.81
KOG2416|consensus718 92.89
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 92.11
KOG4285|consensus350 91.91
PF15023166 DUF4523: Protein of unknown function (DUF4523) 91.86
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 91.61
KOG2068|consensus327 86.21
KOG4285|consensus350 85.36
KOG2253|consensus668 85.32
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 85.25
KOG2068|consensus327 85.06
KOG4574|consensus 1007 84.94
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 84.93
KOG4574|consensus 1007 83.73
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 83.18
KOG0804|consensus 493 82.53
KOG2591|consensus 684 82.23
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 81.49
>KOG1548|consensus Back     alignment and domain information
Probab=100.00  E-value=3.3e-61  Score=488.58  Aligned_cols=332  Identities=48%  Similarity=0.859  Sum_probs=288.1

Q ss_pred             CCCcEEEEeCcCCceecccChHHHHHHHhhcCcccCCCCCCCCCCchhhhhhhhhccccCCCCCCCCCccccccCCCCCC
Q psy2160         122 TDGTVYIWDKEKNAWFPKVDDDFLARYQMSYGFIEQPNTVDEKKPSADLVQSKVEEKSVDATAPMENPKAEEKVVPGQKR  201 (773)
Q Consensus       122 ~dg~~~~~d~~~~~w~p~~~~~~~~~~q~~y~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~k~~~~~~~~~  201 (773)
                      .++..|+||.++++|||+|+++||+.||++|||+. +.+.+.+........+++++....     +.++.+.+...+.++
T Consensus        46 ~~~edy~wd~~k~~W~pki~~df~a~yq~nyg~~~-d~s~~~~e~~e~~~a~~~~e~e~~-----k~~~r~~~~~~~~kk  119 (382)
T KOG1548|consen   46 SETEDYIWDDEKKAWVPKIPEDFIAEYQANYGFED-DTSADATELEEDGHAKKKKEDELL-----KNPKRKYKVGKGEKK  119 (382)
T ss_pred             CccccceeehhhccccCCCchhHHHhhhcccCccc-cccccchhhhhhhhhhhcccchhh-----hcccccccCcccccc
Confidence            34444999999999999999999999999999994 332333222211112222111110     112222334456677


Q ss_pred             CCCCCCCccCCC-CccEEEEcCCCCCCCHHHHHHHHhhcCcccccccCCceeEEEEecCCCCCcceEEEEEecChHHHHH
Q psy2160         202 KPEPPKWFDIGE-ESTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDL  280 (773)
Q Consensus       202 ~~~~~~~~~~~~-~~~~VyV~nLP~~~te~el~~~Fs~~G~I~~~~~~~~p~i~l~~d~~tg~~kG~AfV~F~~~esA~~  280 (773)
                      .+.++.|+.+.| .|++|||+|||.++|.+++.++|++||.|+.||+||+|+|+||++.+ |+.+|.|+|+|.+.+|+.+
T Consensus       120 ~~~e~~~~~~~~~~Nt~VYVsgLP~DiT~dE~~~~~sKcGiI~~d~~t~epk~KlYrd~~-G~lKGDaLc~y~K~ESVeL  198 (382)
T KOG1548|consen  120 QKEEGEWFNPEPKVNTSVYVSGLPLDITVDEFAEVMSKCGIIMRDPQTGEPKVKLYRDNQ-GKLKGDALCCYIKRESVEL  198 (382)
T ss_pred             ccCCCcccCcccccCceEEecCCCCcccHHHHHHHHHhcceEeccCCCCCeeEEEEecCC-CCccCceEEEeecccHHHH
Confidence            777888999999 99999999999999999999999999999999999999999999999 9999999999999999999


Q ss_pred             HHHHcCCceecCeEEEEEeecccccCCCCCCCCchhhhhHHHHHHHHHHHhhhccCCCCccCCCCCCCCcEEEEecCCCc
Q psy2160         281 ALSILDGYEIRGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQEKLFDWRPDKMRGERSKNESVIIVKNLFDP  360 (773)
Q Consensus       281 Al~~lng~~l~g~~I~V~~A~~~~k~~~~~p~~~~~~~~~k~~~~~~k~~~k~~~~~~~~~~~~~~~~~~~v~l~Nl~~p  360 (773)
                      |+++||+..|+|+.|+|++|+|++++. ++++.+. +.+++.+++++++++++++|.|+.....+.+..++|+|+|||+|
T Consensus       199 A~~ilDe~~~rg~~~rVerAkfq~Kge-~~~~~k~-k~k~~~~kk~~k~q~k~~dw~pd~~~~sk~r~~~tVi~kn~Ftp  276 (382)
T KOG1548|consen  199 AIKILDEDELRGKKLRVERAKFQMKGE-YDASKKE-KGKCKDKKKLKKQQQKLLDWRPDRDDPSKARADRTVILKNMFTP  276 (382)
T ss_pred             HHHHhCcccccCcEEEEehhhhhhccC-cCccccc-ccccccHHHHHHHHHhhcccCCCccccccccCCcEEEeeecCCH
Confidence            999999999999999999999999999 9998876 55677888999999999999999988888999999999999999


Q ss_pred             cccchhhHHHHHHHHHHHHHhhccCCEEEEEeeCCCCCeEEEEEecCHHHHHHHHHHhCCcccCCeeEEEEecCCCcccc
Q psy2160         361 ALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYK  440 (773)
Q Consensus       361 ~~~~~d~~~~~ei~edL~e~f~k~G~V~~V~i~d~~~~G~afV~F~~~e~A~~Ai~~lng~~~~Gr~I~v~~~~~~~~~~  440 (773)
                      ..+..+|.++++|+++|++.|.+||.|.+|+++++||.|++.|.|.+.+.|..||+.|+||+|+||+|.+++|+|+++|+
T Consensus       277 ~~~~~~~~l~~dlkedl~eec~K~G~v~~vvv~d~hPdGvvtV~f~n~eeA~~ciq~m~GR~fdgRql~A~i~DG~t~~~  356 (382)
T KOG1548|consen  277 EDFEKNPDLLNDLKEDLTEECEKFGQVRKVVVYDRHPDGVVTVSFRNNEEADQCIQTMDGRWFDGRQLTASIWDGKTKFQ  356 (382)
T ss_pred             HHhccCHHHHHHHHHHHHHHHHHhCCcceEEEeccCCCceeEEEeCChHHHHHHHHHhcCeeecceEEEEEEeCCcceee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchhHHHHHHHHHHHHHHhhhh
Q psy2160         441 IQETAEEREARLKKWETFLGKK  462 (773)
Q Consensus       441 ~~~~~~e~~~r~~~~~~~l~~~  462 (773)
                      ++++.++...|+..|..|+...
T Consensus       357 ~eet~~D~e~e~~~~e~f~~~~  378 (382)
T KOG1548|consen  357 TEETNEDEEEELKRLEKFAAEL  378 (382)
T ss_pred             eecccchHHHHHHHHHHHHhhh
Confidence            9988777777777777776543



>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query773
2dit_A112 Solution Structure Of The Rrm_1 Domain Of Hiv Tat S 1e-25
2dit_A112 Solution Structure Of The Rrm_1 Domain Of Hiv Tat S 1e-25
2dny_A119 Solution Structure Of The Third Rna Binding Domain 7e-07
2dny_A119 Solution Structure Of The Third Rna Binding Domain 7e-07
2cpe_A113 Solution Structure Of The Rna Recognition Motif Of 2e-06
3dxb_A222 Structure Of The Uhm Domain Of Puf60 Fused To Thior 3e-06
3dxb_A222 Structure Of The Uhm Domain Of Puf60 Fused To Thior 3e-06
3ue2_A118 Crystal Structure Of A Rna Binding Domain Of Poly-U 7e-06
3ue2_A118 Crystal Structure Of A Rna Binding Domain Of Poly-U 7e-06
2lcw_A116 Solution Structure Of FusTLS RRM DOMAIN Length = 11 2e-05
2la6_A99 Solution Nmr Structure Of Rrm Domain Of Rna-Binding 3e-05
>pdb|2DIT|A Chain A, Solution Structure Of The Rrm_1 Domain Of Hiv Tat Specific Factor 1 Variant Length = 112 Back     alignment and structure

Iteration: 1

Score = 114 bits (286), Expect = 1e-25, Method: Composition-based stats. Identities = 52/103 (50%), Positives = 74/103 (71%), Gaps = 5/103 (4%) Query: 338 PDKMRGERSKNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHP 397 P +MR ER V+I+KN+F P F+ D ++ E ++DLR ECSK G ++K++L D+HP Sbjct: 9 PSRMRHER-----VVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHP 63 Query: 398 EGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYK 440 +GVA + F++PE AD C + L+GRWFG RQITA+ WDG T Y+ Sbjct: 64 DGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDYQ 106
>pdb|2DIT|A Chain A, Solution Structure Of The Rrm_1 Domain Of Hiv Tat Specific Factor 1 Variant Length = 112 Back     alignment and structure
>pdb|2DNY|A Chain A, Solution Structure Of The Third Rna Binding Domain Of Fbp- Interacting Repressor, Siahbp1 Length = 119 Back     alignment and structure
>pdb|2DNY|A Chain A, Solution Structure Of The Third Rna Binding Domain Of Fbp- Interacting Repressor, Siahbp1 Length = 119 Back     alignment and structure
>pdb|2CPE|A Chain A, Solution Structure Of The Rna Recognition Motif Of Ewing Sarcoma(Ews) Protein Length = 113 Back     alignment and structure
>pdb|3DXB|A Chain A, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin Length = 222 Back     alignment and structure
>pdb|3DXB|A Chain A, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin Length = 222 Back     alignment and structure
>pdb|3UE2|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 1.23 A Resolution Length = 118 Back     alignment and structure
>pdb|3UE2|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 1.23 A Resolution Length = 118 Back     alignment and structure
>pdb|2LCW|A Chain A, Solution Structure Of FusTLS RRM DOMAIN Length = 116 Back     alignment and structure
>pdb|2LA6|A Chain A, Solution Nmr Structure Of Rrm Domain Of Rna-Binding Protein Fus From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6430a Length = 99 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query773
2dit_A112 HIV TAT specific factor 1 variant; structural geno 2e-33
2dit_A112 HIV TAT specific factor 1 variant; structural geno 2e-33
2la6_A99 RNA-binding protein FUS; structural genomics, nort 3e-32
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-31
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 4e-32
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 4e-31
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 1e-30
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 1e-29
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 4e-25
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 4e-25
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-22
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-18
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-16
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 6e-22
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-18
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-12
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 5e-05
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 2e-21
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 2e-21
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 5e-20
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 5e-20
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 1e-19
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 1e-19
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-17
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-16
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-14
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-10
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-17
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-17
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-11
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-05
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-16
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 8e-16
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-14
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-16
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 3e-16
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 3e-16
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 4e-16
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 6e-16
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 4e-10
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-05
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-16
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-10
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-10
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-06
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-06
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 7e-15
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-11
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-06
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 6e-05
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 5e-14
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 7e-10
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-09
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-06
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-04
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 7e-14
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-13
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 4e-07
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-13
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 5e-13
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 6e-11
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-10
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 4e-13
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 5e-13
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-12
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 8e-09
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 5e-13
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 1e-12
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 1e-12
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-11
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-05
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-05
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 4e-12
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 6e-12
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-06
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 4e-12
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 1e-11
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 5e-12
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-11
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 9e-12
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 1e-11
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-08
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-08
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 1e-11
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 1e-11
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-11
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 9e-09
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 2e-11
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 4e-11
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 4e-11
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-10
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 6e-11
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-10
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 8e-11
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 8e-11
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 1e-04
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 1e-04
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-10
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 3e-10
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 1e-10
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 7e-10
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-10
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 3e-09
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-10
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 6e-10
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 2e-10
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-05
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 6e-05
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-04
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-10
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-09
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 3e-10
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 7e-09
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 8e-04
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 8e-04
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-10
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-09
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-04
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-04
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-10
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-10
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-05
3q2s_C229 Cleavage and polyadenylation specificity factor S; 4e-10
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-07
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 5e-10
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 7e-10
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 9e-04
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 5e-10
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 1e-09
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 1e-05
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 1e-05
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 7e-10
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 1e-09
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 7e-10
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 6e-09
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-09
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 5e-08
2cpj_A99 Non-POU domain-containing octamer-binding protein; 1e-09
2cpj_A99 Non-POU domain-containing octamer-binding protein; 6e-09
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-09
1x4e_A85 RNA binding motif, single-stranded interacting pro 3e-09
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-09
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 3e-09
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-09
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 4e-09
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-09
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 3e-09
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-09
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-09
2dis_A109 Unnamed protein product; structural genomics, RRM 2e-09
2dis_A109 Unnamed protein product; structural genomics, RRM 3e-08
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 2e-09
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 8e-09
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-09
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-09
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 3e-09
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 4e-09
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-04
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-04
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 4e-09
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 9e-09
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 9e-04
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 9e-04
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 4e-09
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 4e-09
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 4e-09
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 4e-08
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 4e-09
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 4e-09
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 5e-09
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-08
3n9u_C156 Cleavage and polyadenylation specificity factor S; 5e-09
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-06
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 8e-09
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 6e-08
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 8e-09
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 3e-08
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 9e-09
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-08
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 1e-08
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 3e-08
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-08
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 3e-08
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 4e-07
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 4e-07
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-08
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-08
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 5e-04
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-08
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-08
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-08
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-08
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-08
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-08
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 2e-08
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 7e-08
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 3e-08
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 6e-08
2f3j_A177 RNA and export factor binding protein 2; RRM domai 3e-08
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-07
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-06
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-06
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 3e-08
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 5e-08
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-08
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-07
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-04
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-04
2kt5_A124 RNA and export factor-binding protein 2; chaperone 3e-08
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-06
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-05
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-05
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 3e-08
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 4e-08
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 4e-08
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 5e-08
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 5e-08
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-07
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 6e-08
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-07
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 9e-08
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 1e-06
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 4e-04
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 4e-04
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-07
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-07
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-07
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 4e-06
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 2e-07
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-06
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 3e-07
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 1e-06
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 3e-07
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 8e-07
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 3e-07
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 3e-06
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 4e-07
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 2e-06
3p5t_L90 Cleavage and polyadenylation specificity factor S; 5e-07
3p5t_L90 Cleavage and polyadenylation specificity factor S; 5e-07
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 8e-07
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-06
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 8e-07
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 1e-06
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 8e-07
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 8e-07
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 9e-07
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 1e-06
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 9e-07
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-06
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-06
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-06
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-06
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 8e-06
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 1e-06
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 2e-06
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-06
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-06
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 1e-06
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 5e-06
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-06
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-05
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-06
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 5e-06
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-06
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-06
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-06
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 5e-06
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-06
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-06
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-05
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 7e-05
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-06
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-06
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-06
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-05
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-06
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 8e-06
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 5e-04
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 5e-04
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 2e-06
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 2e-06
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-06
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 9e-06
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 3e-06
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-05
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-04
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-04
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 3e-06
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 5e-06
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-06
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 7e-06
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-05
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-05
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 4e-06
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-05
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-06
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 5e-06
2i2y_A150 Fusion protein consists of immunoglobin G- binding 7e-06
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-05
2i2y_A150 Fusion protein consists of immunoglobin G- binding 9e-05
2i2y_A150 Fusion protein consists of immunoglobin G- binding 9e-05
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 8e-06
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 3e-05
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 8e-06
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-05
2cph_A107 RNA binding motif protein 19; RNA recognition moti 9e-06
2cph_A107 RNA binding motif protein 19; RNA recognition moti 3e-05
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 1e-05
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 1e-05
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 1e-05
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 1e-05
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 1e-05
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-05
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-05
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 1e-04
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-05
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-05
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-05
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 4e-05
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 3e-05
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 1e-04
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 3e-05
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-04
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 3e-05
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 5e-05
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 5e-05
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 3e-04
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 5e-05
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 5e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 5e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 9e-05
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-05
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-04
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 7e-05
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 3e-04
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 1e-04
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 3e-04
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 2e-04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 6e-04
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-04
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-04
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-04
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 8e-04
1x5p_A97 Negative elongation factor E; structure genomics, 3e-04
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 3e-04
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 3e-04
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 5e-04
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 4e-04
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 7e-04
1x5o_A114 RNA binding motif, single-stranded interacting pro 4e-04
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 6e-04
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 8e-04
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 8e-04
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 9e-04
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
 Score =  123 bits (311), Expect = 2e-33
 Identities = 49/102 (48%), Positives = 74/102 (72%)

Query: 344 ERSKNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQI 403
            R ++E V+I+KN+F P  F+ D  ++ E ++DLR ECSK G ++K++L D+HP+GVA +
Sbjct: 10  SRMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASV 69

Query: 404 FFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQETA 445
            F++PE AD C + L+GRWFG RQITA+ WDG T Y+   ++
Sbjct: 70  SFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDYQSGPSS 111


>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, alternative splicing, FBP interacting repressor, RRM, electron transport; 2.20A {Escherichia coli O157} Length = 222 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, alternative splicing, FBP interacting repressor, RRM, electron transport; 2.20A {Escherichia coli O157} Length = 222 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query773
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.95
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.95
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.95
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.94
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.94
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.94
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.94
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.94
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.94
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.94
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.93
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.93
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.93
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.93
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.92
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.92
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.92
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.91
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.91
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.91
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.91
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.91
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.91
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.91
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.91
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.89
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.89
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.89
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.89
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.88
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.88
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.87
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.76
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.76
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.74
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.73
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.73
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.7
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.7
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.7
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.7
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.69
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.69
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.68
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.67
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.67
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.67
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.66
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.66
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.66
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.66
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.65
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.65
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.65
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.64
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.64
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.64
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.64
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.64
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.63
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.63
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.63
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.63
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.63
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.63
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.63
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.63
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.63
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.62
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.62
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.62
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.62
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.62
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.62
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.62
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.62
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.62
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.62
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.62
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.62
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.61
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.61
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.61
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.61
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.61
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.61
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.61
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.61
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.61
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.61
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.61
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.61
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.61
2div_A99 TRNA selenocysteine associated protein; structural 99.61
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.6
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.6
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.6
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.6
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.6
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.6
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.6
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.6
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.6
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.59
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.59
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.59
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.59
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.59
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.59
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.59
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.59
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.59
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.59
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.59
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.59
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.59
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.59
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.59
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.59
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.58
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.58
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.58
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.58
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.58
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.58
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.58
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.58
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.58
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.58
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.58
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.58
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.58
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.58
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.57
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.57
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.57
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.57
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.57
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.57
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.57
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.57
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.57
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.57
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.57
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.57
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.57
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.57
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.56
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.56
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.56
2div_A99 TRNA selenocysteine associated protein; structural 99.56
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.56
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.56
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.56
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.56
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.56
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.56
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.56
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.56
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.56
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.56
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.56
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.56
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.56
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.56
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.55
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.55
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.55
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.55
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.55
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.55
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.55
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.55
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.55
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.55
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.55
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.55
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.55
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.55
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.55
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.55
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.54
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.54
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.54
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.54
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.54
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.54
2dis_A109 Unnamed protein product; structural genomics, RRM 99.54
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.54
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.54
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.54
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.54
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.54
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.54
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.54
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.54
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.54
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.53
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.53
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.53
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.53
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.53
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.53
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.53
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.29
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.53
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.53
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.53
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.53
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.53
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.53
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.52
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.52
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.52
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.52
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.52
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.52
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.52
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.52
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.52
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.52
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.52
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.52
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.52
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.52
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.51
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.51
2dis_A109 Unnamed protein product; structural genomics, RRM 99.51
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.51
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.51
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.51
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.51
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.51
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.51
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.51
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.51
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.51
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.5
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.5
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.5
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.5
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.5
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.5
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.5
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.5
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.5
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.5
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.49
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.49
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.49
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.49
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.49
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.49
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.49
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.48
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.48
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.48
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.48
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.48
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.48
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.48
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.48
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.48
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.48
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.48
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.47
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.47
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.47
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.21
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.47
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.47
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.47
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.47
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.47
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.47
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.47
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.47
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.47
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.47
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.46
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.46
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.46
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.46
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.46
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.46
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.46
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.45
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.45
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.45
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.45
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.45
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.45
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.45
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.45
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.45
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.44
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.44
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.44
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.44
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.44
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.44
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.44
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.44
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.44
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.43
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.43
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.43
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.43
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.43
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.43
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.43
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.42
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.42
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.42
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.42
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.41
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.41
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.41
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.41
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.41
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.41
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.41
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.41
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.4
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.4
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.4
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.4
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.4
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.39
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.39
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.39
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.39
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.38
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.38
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.38
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.38
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.38
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.37
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.37
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.37
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.36
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.36
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.36
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.36
1x5p_A97 Negative elongation factor E; structure genomics, 99.35
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.35
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.34
1x5p_A97 Negative elongation factor E; structure genomics, 99.34
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.34
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.34
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.34
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.33
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.32
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.32
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.3
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.3
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.29
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.29
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.27
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.27
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.24
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.19
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.19
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.19
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.15
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.93
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.91
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 98.87
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 98.86
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.74
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.71
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.63
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.6
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.54
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.53
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.37
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.29
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.21
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.73
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.23
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.79
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.58
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.57
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.38
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.38
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 96.18
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.09
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.04
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 95.97
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 95.9
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 95.84
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 94.8
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 94.59
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 93.34
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.24
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 92.91
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
Probab=100.00  E-value=1e-36  Score=324.06  Aligned_cols=238  Identities=18%  Similarity=0.265  Sum_probs=208.7

Q ss_pred             CccEEEEcCCCCCCCHHHHHHHHhhcCcccccccCCceeEEEEecCCCCCcceEEEEEecChHHHHHHHHHcCCceecCe
Q psy2160         214 ESTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGK  293 (773)
Q Consensus       214 ~~~~VyV~nLP~~~te~el~~~Fs~~G~I~~~~~~~~p~i~l~~d~~tg~~kG~AfV~F~~~esA~~Al~~lng~~l~g~  293 (773)
                      .+++|||+|||.++|+++|+++|+.|| |..        |++      |+++|||||.|.+.++|..|+..|||..|.|+
T Consensus        21 ~~~~l~V~nLp~~~te~~l~~~F~~~G-i~~--------~~~------~~~~g~afV~f~~~~~A~~A~~~l~~~~~~g~   85 (284)
T 3smz_A           21 NRRKILIRGLPGDVTNQEVHDLLSDYE-LKY--------CFV------DKYKGTAFVTLLNGEQAEAAINAFHQSRLRER   85 (284)
T ss_dssp             CCCEEEEECCCTTCCHHHHHHHTTTSC-EEE--------EEE------ETTTTEEEEEESSHHHHHHHHHHHTTCEETTE
T ss_pred             CCCEEEEeCCCCCCCHHHHHHHHHHcC-CEE--------EEE------ecCCCEEEEEeCCHHHHHHHHHHcCCCeeCCe
Confidence            669999999999999999999999999 776        776      56789999999999999999999999999999


Q ss_pred             EEEEEeecccccCCCCCCCCchhhhhHHHHHHHHHHHhhhccCCCCccCCCCCCCCcEEEEecCCCccccchhhHHHHHH
Q psy2160         294 KIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQEKLFDWRPDKMRGERSKNESVIIVKNLFDPALFDKDVTLILEY  373 (773)
Q Consensus       294 ~I~V~~A~~~~k~~~~~p~~~~~~~~~k~~~~~~k~~~k~~~~~~~~~~~~~~~~~~~v~l~Nl~~p~~~~~d~~~~~ei  373 (773)
                      +|.|.++.                                              ..++|+|+||+  ..+.+        
T Consensus        86 ~i~v~~~~----------------------------------------------~~~~l~v~nlp--~~~t~--------  109 (284)
T 3smz_A           86 ELSVQLQP----------------------------------------------TDALLCVANLP--PSLTQ--------  109 (284)
T ss_dssp             ECEEEECC----------------------------------------------CSCEEEEESCC--TTCCH--------
T ss_pred             EEEEEecC----------------------------------------------CCCEEEEcCCC--CcCCH--------
Confidence            99997632                                              24689999993  33332        


Q ss_pred             HHHHHHHhhccCCEEEEEeeC----CCCCeEEEEEecCHHHHHHHHHHhCCcccCCeeEEEEecCCCcccccchhHHHHH
Q psy2160         374 QQDLREECSKCGHVKKVVLHD----KHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQETAEERE  449 (773)
Q Consensus       374 ~edL~e~f~k~G~V~~V~i~d----~~~~G~afV~F~~~e~A~~Ai~~lng~~~~Gr~I~v~~~~~~~~~~~~~~~~e~~  449 (773)
                       ++|+++|+.||.|..|.+..    +.+.|+|||.|.+.++|.+|+..|||..++|+.|.+.+......           
T Consensus       110 -~~l~~~f~~~G~i~~~~i~~~~~~g~~~g~afV~f~~~~~a~~A~~~l~~~~~~g~~i~v~~a~~~~~-----------  177 (284)
T 3smz_A          110 -QQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWTDAGQL-----------  177 (284)
T ss_dssp             -HHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECCGGGC-----------
T ss_pred             -HHHHHHHHhcCCeeEEEEEeeCCCCccceEEEEEECCHHHHHHHHHHhCCCEeCCcEEEEEECCCCCC-----------
Confidence             88999999999999997652    34689999999999999999999999999999999987643210           


Q ss_pred             HHHHHHHHHhhhhhhhhhhhcccCCCCCCCCCCchHHhhhhHhhhhcCCCCCEEEEcCCCCCC-CHHHHHHHHHhcCcce
Q psy2160         450 ARLKKWETFLGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQENTKVYVSNLPLDL-TQEEFVEVMQKCGLVM  528 (773)
Q Consensus       450 ~r~~~~~~~l~~~~~~~~~~~~~~G~~~~p~~~~~~~r~~~~~~~~~~~~~~~l~V~nLp~~~-t~e~L~~~F~~~G~I~  528 (773)
                                                                  .......++|||+|||.++ |+++|+++|+.||.|.
T Consensus       178 --------------------------------------------~~~~~~~~~l~v~nlp~~~~~~~~l~~~f~~~G~i~  213 (284)
T 3smz_A          178 --------------------------------------------TPALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPT  213 (284)
T ss_dssp             --------------------------------------------CTTTTSCSEEEEECCCTTCCCHHHHHHHTCSSSCCS
T ss_pred             --------------------------------------------CcccCCccEEEEecCCcccCCHHHHHHHhhCCCCeE
Confidence                                                        0112356899999999995 9999999999999998


Q ss_pred             eccCCCceEEEEEecCCCCCCcceEEEEeCChHHHHHHHHHhCCceecCeEEEEEEccc
Q psy2160         529 KDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIKVERAKF  587 (773)
Q Consensus       529 ~~~~~~~~~i~l~~d~~tg~~kG~afV~f~~~e~A~~Ai~~lng~~i~g~~i~V~~a~~  587 (773)
                              .|+|+.++ +|.++|+|||+|.+.++|.+|+..|||..|.|++|+|.+|..
T Consensus       214 --------~v~i~~~~-~g~~~g~afV~f~~~~~A~~A~~~l~g~~~~g~~l~v~~a~~  263 (284)
T 3smz_A          214 --------FCQLACGQ-DGQLKGFAVLEYETAEMAEEAQQQADGLSLGGSHLRVSFCAP  263 (284)
T ss_dssp             --------EEEEEECS-SCCEEEEEEEECSSHHHHHHHHHHHTTCEETTEECEEEECCS
T ss_pred             --------EEEEEECC-CCCcccEEEEEeCCHHHHHHHHHHhCCCccCCeEEEEEEecC
Confidence                    79999998 489999999999999999999999999999999999999983



>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 773
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 2e-21
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 2e-21
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 7e-15
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-14
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-13
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 4e-13
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 1e-07
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 1e-07
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-12
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-12
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-12
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 7e-12
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 8e-05
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 8e-05
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-12
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-11
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-11
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-11
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-05
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-05
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-11
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-11
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 0.002
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 0.002
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 6e-11
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 7e-11
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 0.003
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 0.003
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 9e-11
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 5e-10
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-10
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-10
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-10
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-09
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-10
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-10
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-10
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 3e-10
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 1e-10
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 7e-10
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 7e-04
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 7e-04
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 2e-10
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 2e-10
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-10
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-10
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 7e-05
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 7e-05
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 4e-10
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 4e-10
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 5e-10
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-09
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 6e-04
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 6e-04
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 5e-10
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 2e-09
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 0.001
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 0.001
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 6e-10
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 6e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 6e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 6e-08
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 8e-10
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 3e-09
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 1e-09
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 6e-09
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-09
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 4e-09
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-09
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 4e-09
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 4e-05
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 4e-05
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 2e-09
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 9e-09
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 0.001
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 0.001
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-09
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-09
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-06
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-06
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-09
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-09
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 4e-09
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 8e-09
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 0.002
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 0.002
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 5e-09
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 5e-09
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-04
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-04
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 5e-09
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 5e-09
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 6e-09
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 1e-08
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 7e-09
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 1e-08
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 7e-09
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 8e-09
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 3e-04
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 3e-04
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 7e-09
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 1e-07
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-08
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-08
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-08
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-08
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-08
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 9e-08
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 3e-08
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 8e-08
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 4e-04
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 4e-04
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 3e-08
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 3e-08
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 3e-08
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 4e-08
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 5e-08
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-07
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 5e-08
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 7e-08
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 0.004
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 0.004
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 6e-08
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 6e-08
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 5e-05
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 5e-05
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 7e-08
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 7e-08
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 8e-08
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 1e-07
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-08
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-08
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 1e-07
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 3e-07
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 1e-07
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 2e-07
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 1e-07
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 5e-07
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 1e-07
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 9e-07
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 2e-07
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 4e-07
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-07
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-07
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-07
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 6e-07
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 3e-07
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 5e-07
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 3e-07
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 5e-07
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 3e-07
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 4e-07
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 3e-07
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 9e-07
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 4e-07
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 3e-06
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 5e-07
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 5e-07
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-07
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-07
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 6e-07
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 9e-07
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 7e-07
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-06
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-06
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-06
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-06
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-06
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-06
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 8e-06
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 4e-06
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 4e-06
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 1e-05
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 2e-05
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 1e-05
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 4e-05
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 1e-05
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 1e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 9e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 8e-04
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 0.001
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-05
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 8e-05
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 5e-05
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 5e-05
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-04
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 2e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 5e-04
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 2e-04
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 4e-04
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 3e-04
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 3e-04
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 5e-04
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 5e-04
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: HIV Tat-specific factor 1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 87.3 bits (216), Expect = 2e-21
 Identities = 49/96 (51%), Positives = 72/96 (75%)

Query: 345 RSKNESVIIVKNLFDPALFDKDVTLILEYQQDLREECSKCGHVKKVVLHDKHPEGVAQIF 404
           R ++E V+I+KN+F P  F+ D  ++ E ++DLR ECSK G ++K++L D+HP+GVA + 
Sbjct: 4   RMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVS 63

Query: 405 FKEPEAADACRELLNGRWFGQRQITAETWDGKTRYK 440
           F++PE AD C + L+GRWFG RQITA+ WDG T Y+
Sbjct: 64  FRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDYQ 99


>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query773
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.92
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.9
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.84
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.75
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.73
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.73
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.73
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.73
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.72
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.71
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.71
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.71
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.71
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.71
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.71
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.71
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.71
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.71
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.71
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.7
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.7
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.7
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.7
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.7
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.7
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.7
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.69
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.69
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.69
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.69
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.69
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.69
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.69
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.69
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.69
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.68
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.68
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.68
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.68
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.68
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.68
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.68
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.67
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.67
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.67
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.67
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.67
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.67
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.67
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.66
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.66
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.66
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.66
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.66
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.65
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.65
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.65
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.65
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.65
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.65
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.65
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.65
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.65
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.65
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.64
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.64
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.64
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.64
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.64
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.64
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.63
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.63
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.63
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.63
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.62
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.62
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.62
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.62
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.62
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.61
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.61
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.61
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.61
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.61
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.6
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.6
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.6
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.59
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.59
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.58
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.58
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.58
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.58
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.58
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.58
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.57
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.57
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.57
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.57
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.57
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.56
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.56
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.56
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.55
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.55
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.55
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.54
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.54
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.54
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.54
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.54
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.53
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.53
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.53
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.53
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.53
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.53
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.52
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.52
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.52
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.52
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.52
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.52
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.51
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.51
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.51
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.51
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.5
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.5
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.5
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.5
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.49
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.49
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.49
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.48
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.48
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.48
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.47
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.47
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.46
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.46
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.45
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.45
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.45
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.44
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.44
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.43
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.42
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.42
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.42
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.42
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.41
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.4
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.4
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.39
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.39
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.38
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.36
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.36
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.35
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.35
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.33
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.29
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.28
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.26
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.24
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.18
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.17
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.08
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.07
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.04
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.01
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.73
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.25
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.99
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.92
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.47
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.34
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 94.04
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 92.66
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=1.6e-24  Score=212.28  Aligned_cols=170  Identities=21%  Similarity=0.308  Sum_probs=143.9

Q ss_pred             CccEEEEcCCCCCCCHHHHHHHHhhcCcccccccCCceeEEEEecCCCCCcceEEEEEecChHHHHHHHHHcCCceecCe
Q psy2160         214 ESTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDTNQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGK  293 (773)
Q Consensus       214 ~~~~VyV~nLP~~~te~el~~~Fs~~G~I~~~~~~~~p~i~l~~d~~tg~~kG~AfV~F~~~esA~~Al~~lng~~l~g~  293 (773)
                      ..++|||+|||+++|+++|+++|++||.|..        |.++++..+|.++|||||+|.+.++|..|+. +++..+.++
T Consensus         5 ~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~--------~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~-~~~~~~~~~   75 (183)
T d1u1qa_           5 QLRKLFIGGLSFETTDESLRSHFEQWGTLTD--------CVVMRDPNTKRSRGFGFVTYATVEEVDAAMN-ARPHKVDGR   75 (183)
T ss_dssp             HHHEEEEESCCTTCCHHHHHHHHGGGSCEEE--------EEEEECTTTCCEEEEEEEEESSHHHHHHHHH-TCSCEETTE
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHcCCEEE--------EEeeecccCCCccCceecccCCHHHHHHHHH-hcCCccccc
Confidence            6689999999999999999999999999998        9999999999999999999999999999998 455556666


Q ss_pred             EEEEEeecccccCCCCCCCCchhhhhHHHHHHHHHHHhhhccCCCCccCCCCCCCCcEEEEecCCCccccchhhHHHHHH
Q psy2160         294 KIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQEKLFDWRPDKMRGERSKNESVIIVKNLFDPALFDKDVTLILEY  373 (773)
Q Consensus       294 ~I~V~~A~~~~k~~~~~p~~~~~~~~~k~~~~~~k~~~k~~~~~~~~~~~~~~~~~~~v~l~Nl~~p~~~~~d~~~~~ei  373 (773)
                      .+.+....                                                          +....         
T Consensus        76 ~~~~~~~~----------------------------------------------------------~~~~~---------   88 (183)
T d1u1qa_          76 VVEPKRAV----------------------------------------------------------SREDS---------   88 (183)
T ss_dssp             ECEEEECC----------------------------------------------------------CTTGG---------
T ss_pred             chhhhhhh----------------------------------------------------------hcccc---------
Confidence            65553211                                                          00000         


Q ss_pred             HHHHHHHhhccCCEEEEEeeCCCCCeEEEEEecCHHHHHHHHHHhCCcccCCeeEEEEecCCCcccccchhHHHHHHHHH
Q psy2160         374 QQDLREECSKCGHVKKVVLHDKHPEGVAQIFFKEPEAADACRELLNGRWFGQRQITAETWDGKTRYKIQETAEEREARLK  453 (773)
Q Consensus       374 ~edL~e~f~k~G~V~~V~i~d~~~~G~afV~F~~~e~A~~Ai~~lng~~~~Gr~I~v~~~~~~~~~~~~~~~~e~~~r~~  453 (773)
                                            . .                                                       
T Consensus        89 ----------------------~-~-------------------------------------------------------   90 (183)
T d1u1qa_          89 ----------------------Q-R-------------------------------------------------------   90 (183)
T ss_dssp             ----------------------G-S-------------------------------------------------------
T ss_pred             ----------------------c-c-------------------------------------------------------
Confidence                                  0 0                                                       


Q ss_pred             HHHHHhhhhhhhhhhhcccCCCCCCCCCCchHHhhhhHhhhhcCCCCCEEEEcCCCCCCCHHHHHHHHHhcCcceeccCC
Q psy2160         454 KWETFLGKKIKVERAKFTMKGEAYDPKLKPKKKRKKDLEKLKKAQENTKVYVSNLPLDLTQEEFVEVMQKCGLVMKDVDT  533 (773)
Q Consensus       454 ~~~~~l~~~~~~~~~~~~~~G~~~~p~~~~~~~r~~~~~~~~~~~~~~~l~V~nLp~~~t~e~L~~~F~~~G~I~~~~~~  533 (773)
                                                              .......++|||+|||..+|+++|+++|+.||.|.     
T Consensus        91 ----------------------------------------~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~-----  125 (183)
T d1u1qa_          91 ----------------------------------------PGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIE-----  125 (183)
T ss_dssp             ----------------------------------------TTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEE-----
T ss_pred             ----------------------------------------cccccccceeEEccCCCcCCHHHHhhhhccCCcee-----
Confidence                                                    00012357899999999999999999999999999     


Q ss_pred             CceEEEEEecCCCCCCcceEEEEeCChHHHHHHHHHhCCceecCeEEEEEEcc
Q psy2160         534 NQMKIKLYTDPYTKDFKGDALCTYIKKESVDLALSILDGYEIRGKKIKVERAK  586 (773)
Q Consensus       534 ~~~~i~l~~d~~tg~~kG~afV~f~~~e~A~~Ai~~lng~~i~g~~i~V~~a~  586 (773)
                         .+.|+.+..+|.++|||||+|.++++|.+||. +++..|.|++|+|.+|.
T Consensus       126 ---~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~~~~~~G~~i~V~~A~  174 (183)
T d1u1qa_         126 ---VIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKYHTVNGHNCEVRKAL  174 (183)
T ss_dssp             ---EEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-SSCEEETTEEEEEEECC
T ss_pred             ---eeeeecccccCccceeEEEEECCHHHHHHHHH-hCCCeECCEEEEEEecC
Confidence               79999999999999999999999999999996 79999999999999987



>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure