Psyllid ID: psy2207


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRSLTQSSIPELNLGKVAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLVQEFDDEDSNMFERVKAVANVEDNHQVTNMMDIIRSNFKEMGTAGRRKPSKKYRKYVPQRLIEVTANDSGSQHSGWLHKKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREATTLS
cEEEcccccccccEEEEEEccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccEEEEEEEcccEEEEEcccccccccccccccccEEEEcccccccccEEEEEEcccccEEEEcccHHHHHHHHHHHHHHHccc
ccEEcccccccccEEEEEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHcHHccccccccccccccccccccccEcccHHHccEccccccEcccccccEEccccccEEcHHHcccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHccccccccEEEEEEcccEEEEEEcccccccHcccccccEEEcccccccccccEEEEEEccEEEEEEEcccHHHHHHHHHHHHHHHHcc
mkvclpqtedynnEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRrsltqssipelnlgkvaplwipdsrvsmcqRCTSVFTVTFRrhhcracgkvvcgpcsdylapleykkfrnfrvCEECYHYLVQEFDDEDSNMFERVKAVAnvednhqvtNMMDIIRSNFKemgtagrrkpskkyrkYVPQRLIEvtandsgsqhsgwlhkksgrnwKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFKYVFQLkhqgqdplvfgadnEQSYERWMKAMREATTLS
mkvclpqtedynnefsVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRSLTqssipelnlgkvAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLVQEFDDEDSNMFERVKAVanvednhqvtnmMDIIRSNFKemgtagrrkpskkyrkyVPQRLIEvtandsgsqhsgwlhkksgrnwkRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREATTLS
MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRSLTQSSIPELNLGKVAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLVQEFDDEDSNMFERVKAVANVEDNHQVTNMMDIIRSNFKEMGTAGRRKPSKKYRKYVPQRLIEVTANDSGSQHSGWLHKKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREATTLS
*********DYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRSLTQSSIPELNLGKVAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLVQEFDDEDSNMFERVKAVANVEDNHQVTNMMDIIR********************YVPQRLIEV**********GWLHKKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFKYVFQLKHQGQDPLVFGA********************
*KVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAI*********************************IPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLVQEFDDEDSNMFERVKAVANVEDN*********************RRKPSKK***********************************YWFVLKDQVMYKYKASEDIKALLSIPVLGYEL***********VFQLKHQGQDPLVFGADNEQSYERWMKAMREATTL*
MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRSLTQSSIPELNLGKVAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLVQEFDDEDSNMFERVKAVANVEDNHQVTNMMDIIRSNFKEM************RKYVPQRLIEVTA**********LHKKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREATTLS
*KVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLS***************NLGKVAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLVQE****************************************************************DSGSQHSGWLHKKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREATTL*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRSLTQSSIPELNLGKVAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLVQEFDDEDSNMFERVKAVANVEDNHQVTNMMDIIRSNFKEMGTAGRRKPSKKYRKYVPQRLIEVTANDSGSQHSGWLHKKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREATTLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query305 2.2.26 [Sep-21-2011]
Q69ZL11399 FYVE, RhoGEF and PH domai yes N/A 0.940 0.205 0.401 1e-57
Q6ZV731430 FYVE, RhoGEF and PH domai yes N/A 0.940 0.200 0.393 4e-56
Q6ZNL61462 FYVE, RhoGEF and PH domai no N/A 0.947 0.197 0.332 2e-36
Q80UZ01219 FYVE, RhoGEF and PH domai no N/A 0.970 0.242 0.329 3e-34
Q96M96766 FYVE, RhoGEF and PH domai no N/A 0.845 0.336 0.303 2e-33
Q91ZT5766 FYVE, RhoGEF and PH domai no N/A 0.842 0.335 0.305 3e-33
O88387766 FYVE, RhoGEF and PH domai no N/A 0.842 0.335 0.311 1e-32
P98174961 FYVE, RhoGEF and PH domai no N/A 0.813 0.258 0.302 3e-29
P52734960 FYVE, RhoGEF and PH domai no N/A 0.796 0.253 0.307 4e-29
Q7Z6J4655 FYVE, RhoGEF and PH domai no N/A 0.842 0.392 0.323 5e-29
>sp|Q69ZL1|FGD6_MOUSE FYVE, RhoGEF and PH domain-containing protein 6 OS=Mus musculus GN=Fgd6 PE=1 SV=2 Back     alignment and function desciption
 Score =  223 bits (568), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 179/309 (57%), Gaps = 22/309 (7%)

Query: 1    MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRS 60
            MKV  P  E Y NE  + ++ RSF L A SA ER +W++AI ++I+E  +  ++F   RS
Sbjct: 1108 MKVRKPTQEAYQNELKIESVERSFILSASSAAERDDWLEAISSSIEEYAKKRITFCPSRS 1167

Query: 61   LTQSS--IPELN-LGKVAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDY 117
            L + S    E++ LG  AP+WIPD+R +MC  CTS FT+T+RRHHCRACGK+VC  CS  
Sbjct: 1168 LDEDSERKEEVSPLGAKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSN 1227

Query: 118  LAPLEYKKFRNFRVCEECYHYLVQEFDDEDSNMFERVKAVANVEDNHQVTNMMDIIRSNF 177
               L+Y K +  RVCE C+    QE    D  +  RV +  N              +S  
Sbjct: 1228 KYGLDYLKGQLARVCEHCF----QELQKLDHQLSPRVGSPGN-------------HKSPS 1270

Query: 178  KEMGTAGRRKPSKKYRKYVPQRLIEVTANDSGSQHSGWLHKKSG--RNWKRYWFVLKDQV 235
              + +     PS + +K +P  L EV+AN   S  SG+L++  G  + WK  WFV+K++V
Sbjct: 1271 SALSSVLHSIPSGRKQKKIPAALKEVSANTEDSTMSGYLYRSKGSKKPWKHLWFVIKNKV 1330

Query: 236  MYKYKASEDIKALLSIPVLGYELEALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWM 295
            +Y Y ASED+ AL S P+LG+ +  + ++++   VFQL H+G    VF AD+  S +RW+
Sbjct: 1331 LYTYAASEDVAALESQPLLGFTVTLVKDENSESKVFQLLHKGMVFYVFKADDAHSTQRWI 1390

Query: 296  KAMREATTL 304
             A +E T L
Sbjct: 1391 DAFQEGTVL 1399




May activate CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. May play a role in regulating the actin cytoskeleton and cell shape.
Mus musculus (taxid: 10090)
>sp|Q6ZV73|FGD6_HUMAN FYVE, RhoGEF and PH domain-containing protein 6 OS=Homo sapiens GN=FGD6 PE=1 SV=2 Back     alignment and function description
>sp|Q6ZNL6|FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens GN=FGD5 PE=1 SV=3 Back     alignment and function description
>sp|Q80UZ0|FGD5_MOUSE FYVE, RhoGEF and PH domain-containing protein 5 OS=Mus musculus GN=Fgd5 PE=1 SV=2 Back     alignment and function description
>sp|Q96M96|FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens GN=FGD4 PE=1 SV=2 Back     alignment and function description
>sp|Q91ZT5|FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus GN=Fgd4 PE=1 SV=1 Back     alignment and function description
>sp|O88387|FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus GN=Fgd4 PE=1 SV=1 Back     alignment and function description
>sp|P98174|FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens GN=FGD1 PE=1 SV=2 Back     alignment and function description
>sp|P52734|FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus GN=Fgd1 PE=1 SV=2 Back     alignment and function description
>sp|Q7Z6J4|FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens GN=FGD2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
328700485 862 PREDICTED: FYVE, RhoGEF and PH domain-co 0.967 0.342 0.517 8e-84
321456107 1317 hypothetical protein DAPPUDRAFT_331275 [ 0.993 0.230 0.430 9e-64
242010240 1001 FYVE, RhoGEF and PH domain-containing pr 0.865 0.263 0.428 1e-61
427780591 1673 hypothetical protein [Rhipicephalus pulc 0.898 0.163 0.420 4e-59
427780589 1700 hypothetical protein [Rhipicephalus pulc 0.898 0.161 0.420 5e-59
427780127 1097 hypothetical protein [Rhipicephalus pulc 0.898 0.249 0.420 5e-59
443695700 482 hypothetical protein CAPTEDRAFT_180983 [ 0.957 0.605 0.402 5e-57
117616870 431 ethanol decreased 4 [synthetic construct 0.940 0.665 0.404 5e-56
26382536 465 unnamed protein product [Mus musculus] 0.940 0.617 0.404 5e-56
114325429 943 Fgd6 protein [Mus musculus] 0.940 0.304 0.401 6e-56
>gi|328700485|ref|XP_001945183.2| PREDICTED: FYVE, RhoGEF and PH domain-containing protein 6-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  316 bits (809), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 161/311 (51%), Positives = 220/311 (70%), Gaps = 16/311 (5%)

Query: 1   MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRS 60
           MKV LP T++  NEFS+I I+RSFTLRA+SA E  EW++ ++ AI+E+    LSFLN + 
Sbjct: 560 MKVFLPITDNCLNEFSIITITRSFTLRAKSAVELKEWVNILEKAIREHTNKQLSFLNMKF 619

Query: 61  LTQSSIPE-LNLGKVAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLA 119
           ++++   E L LG  AP+WI D RV+MCQ C S FTVTFRRHHCRACGKVVC  CS+  A
Sbjct: 620 VSKNIGREPLQLGYEAPIWIQDCRVTMCQSCASEFTVTFRRHHCRACGKVVCSSCSENKA 679

Query: 120 PLEYKKFRNFRVCEECYHYLVQEFDDEDSNMFERVKAVANVEDNHQVTNMMDIIRSNFKE 179
           PL Y KF++ RVC++CY YL++EF+D+   + E  ++ +N   + ++  M+D ++++FK+
Sbjct: 680 PLRYMKFQSARVCDDCYDYLLKEFEDK---ILEMRQSSSN--SDLEILKMVDTVKNSFKK 734

Query: 180 MGTAGRRKPSKKYRKYVPQRLIEVTANDSGSQHSGWLHKKSGR-NWKRYWFVLKDQVMYK 238
            G       SKK  KYVPQRL EV ANDSGSQ SGWL+++  R +WKR+WFVLK+QV+Y 
Sbjct: 735 SGVWS----SKKLVKYVPQRLKEVMANDSGSQMSGWLYRREKRKSWKRFWFVLKEQVLYM 790

Query: 239 YKASEDIKALLSIPVLGYELEALNEQDNFKY-----VFQLKHQGQDPLVFGADNEQSYER 293
           YKASED+ AL +IPVLGY ++   E  N++      VFQL H GQ+PL+F +D EQ  +R
Sbjct: 791 YKASEDVVALNTIPVLGYSVQTFPEGTNYEEFDSSCVFQLAHAGQNPLIFCSDTEQLAKR 850

Query: 294 WMKAMREATTL 304
           W+  + EAT L
Sbjct: 851 WINTLNEATKL 861




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321456107|gb|EFX67223.1| hypothetical protein DAPPUDRAFT_331275 [Daphnia pulex] Back     alignment and taxonomy information
>gi|242010240|ref|XP_002425878.1| FYVE, RhoGEF and PH domain-containing protein, putative [Pediculus humanus corporis] gi|212509844|gb|EEB13140.1| FYVE, RhoGEF and PH domain-containing protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|427780591|gb|JAA55747.1| hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427780589|gb|JAA55746.1| hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427780127|gb|JAA55515.1| hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|443695700|gb|ELT96558.1| hypothetical protein CAPTEDRAFT_180983 [Capitella teleta] Back     alignment and taxonomy information
>gi|117616870|gb|ABK42453.1| ethanol decreased 4 [synthetic construct] Back     alignment and taxonomy information
>gi|26382536|dbj|BAB30510.2| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|114325429|gb|AAH26860.2| Fgd6 protein [Mus musculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
MGI|MGI:12614191399 Fgd6 "FYVE, RhoGEF and PH doma 0.947 0.206 0.384 8.6e-48
RGD|15656091390 Fgd6 "FYVE, RhoGEF and PH doma 0.947 0.207 0.384 1.8e-47
UNIPROTKB|D4A3Y71406 Fgd6 "Protein Fgd6" [Rattus no 0.947 0.205 0.384 1.8e-47
UNIPROTKB|Q6ZV731430 FGD6 "FYVE, RhoGEF and PH doma 0.947 0.202 0.373 8.3e-47
UNIPROTKB|F1MQ301434 FGD6 "Uncharacterized protein" 0.947 0.201 0.373 1.1e-46
UNIPROTKB|J9NYT01422 FGD6 "Uncharacterized protein" 0.947 0.203 0.370 1.7e-46
UNIPROTKB|F1Q2801423 FGD6 "Uncharacterized protein" 0.947 0.203 0.370 1.7e-46
UNIPROTKB|F1SQP81431 FGD6 "Uncharacterized protein" 0.947 0.201 0.370 3.6e-46
UNIPROTKB|F1NVP21430 FGD6 "Uncharacterized protein" 0.947 0.202 0.363 1.1e-44
UNIPROTKB|E1C246762 FGD4 "Uncharacterized protein" 0.514 0.206 0.385 7.3e-37
MGI|MGI:1261419 Fgd6 "FYVE, RhoGEF and PH domain containing 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 512 (185.3 bits), Expect = 8.6e-48, P = 8.6e-48
 Identities = 118/307 (38%), Positives = 174/307 (56%)

Query:     1 MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRS 60
             MKV  P  E Y NE  + ++ RSF L A SA ER +W++AI ++I+E  +  ++F   RS
Sbjct:  1108 MKVRKPTQEAYQNELKIESVERSFILSASSAAERDDWLEAISSSIEEYAKKRITFCPSRS 1167

Query:    61 LTQSSI--PELN-LGKVAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDY 117
             L + S    E++ LG  AP+WIPD+R +MC  CTS FT+T+RRHHCRACGK+VC  CS  
Sbjct:  1168 LDEDSERKEEVSPLGAKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSN 1227

Query:   118 LAPLEYKKFRNFRVCEECYHYLVQEFDDEDSNMFERVKAVANVEDNHQVTNMMDIIRSNF 177
                L+Y K +  RVCE C+    QE    D  +  RV +  N +       +  ++ S  
Sbjct:  1228 KYGLDYLKGQLARVCEHCF----QELQKLDHQLSPRVGSPGNHKSPSSA--LSSVLHSI- 1280

Query:   178 KEMGTAGRRKPSKKYRKYVPQRLIEVTANDSGSQHSGWLHKKSGRNWKRYWFVLKDQVMY 237
                  +GR++  KK    + +  +     DS      +  K S + WK  WFV+K++V+Y
Sbjct:  1281 ----PSGRKQ--KKIPAALKE--VSANTEDSTMSGYLYRSKGSKKPWKHLWFVIKNKVLY 1332

Query:   238 KYKASEDIKALLSIPVLGYELEALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKA 297
              Y ASED+ AL S P+LG+ +  + ++++   VFQL H+G    VF AD+  S +RW+ A
Sbjct:  1333 TYAASEDVAALESQPLLGFTVTLVKDENSESKVFQLLHKGMVFYVFKADDAHSTQRWIDA 1392

Query:   298 MREATTL 304
              +E T L
Sbjct:  1393 FQEGTVL 1399




GO:0003674 "molecular_function" evidence=ND
GO:0005085 "guanyl-nucleotide exchange factor activity" evidence=IEA
GO:0005089 "Rho guanyl-nucleotide exchange factor activity" evidence=IEA
GO:0005543 "phospholipid binding" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005856 "cytoskeleton" evidence=IEA
GO:0008150 "biological_process" evidence=ND
GO:0035023 "regulation of Rho protein signal transduction" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
RGD|1565609 Fgd6 "FYVE, RhoGEF and PH domain containing 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A3Y7 Fgd6 "Protein Fgd6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZV73 FGD6 "FYVE, RhoGEF and PH domain-containing protein 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MQ30 FGD6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NYT0 FGD6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q280 FGD6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQP8 FGD6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NVP2 FGD6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C246 FGD4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
cd1323790 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain 2e-29
cd13248104 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate 5e-26
pfam0136368 pfam01363, FYVE, FYVE zinc finger 1e-23
smart0006468 smart00064, FYVE, Protein present in Fab1, YOTB, V 5e-21
cd0006557 cd00065, FYVE, FYVE domain; Zinc-binding domain; t 1e-16
pfam00169101 pfam00169, PH, PH domain 4e-16
cd13389125 cd13389, PH1_FGD5_FGD6, FYVE, RhoGEF and PH domain 9e-16
cd01260114 cd01260, PH_CNK_mammalian-like, Connector enhancer 2e-15
smart00233102 smart00233, PH, Pleckstrin homology domain 3e-15
cd13236105 cd13236, PH2_FGD1-4, FYVE, RhoGEF and PH domain co 3e-14
cd13263114 cd13263, PH_RhoGap25-like, Rho GTPase activating p 7e-14
cd1331695 cd13316, PH_Boi, Boi family Pleckstrin homology do 8e-12
cd13235113 cd13235, PH2_FARP1-like, FERM, RhoGEF and pleckstr 2e-11
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 9e-11
cd13281139 cd13281, PH_PLEKHD1, Pleckstrin homology (PH) doma 2e-09
cd1332690 cd13326, PH_CNK_insect-like, Connector enhancer of 3e-08
cd13288120 cd13288, PH_Ses, Sesquipedalian family Pleckstrin 3e-08
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 1e-07
cd13296111 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P 2e-07
cd13299102 cd13299, PH2_PH_fungal, Fungal proteins Pleckstrin 2e-07
cd13215130 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 6e-07
cd13308113 cd13308, PH_3BP2, SH3 domain-binding protein 2 Ple 8e-07
cd13379114 cd13379, PH_RhoGap24, Rho GTPase activating protei 1e-06
cd13298106 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin 2e-06
cd13378116 cd13378, PH_RhoGAP2, Rho GTPase activating protein 3e-06
cd01259124 cd01259, PH_APBB1IP, Amyloid beta (A4) Precursor p 1e-05
cd01252118 cd01252, PH_GRP1-like, General Receptor for Phosph 2e-05
cd01265101 cd01265, PH_TBC1D2A, TBC1 domain family member 2A 4e-05
cd13306107 cd13306, PH1_AFAP, Actin filament associated prote 7e-05
cd01253113 cd01253, PH_ARHGAP21-like, ARHGAP21 and related pr 2e-04
cd1325098 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin 2e-04
cd1328296 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology 2e-04
cd01237110 cd01237, PH_fermitin, Fermitin family pleckstrin h 3e-04
cd13272116 cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bis 4e-04
cd1323896 cd13238, PH2_FGD4_insect-like, FYVE, RhoGEF and PH 6e-04
cd01238140 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstr 7e-04
cd13267125 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D sub 0.001
cd01235106 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als 0.001
cd13260103 cd13260, PH_RASA1, RAS p21 protein activator (GTPa 0.001
cd13273110 cd13273, PH_SWAP-70, Switch-associated protein-70 0.001
cd13255110 cd13255, PH_TAAP2-like, Tandem PH-domain-containin 0.002
cd01218123 cd01218, PH_Phafin2-like, Phafin2 (also called EAP 0.002
cd13297123 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin h 0.002
cd13301108 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin 0.002
cd01219107 cd01219, PH1_FGD1, FYVE, RhoGEF and PH domain cont 0.003
cd13387107 cd13387, PH1_FGD3, FYVE, RhoGEF and PH domain cont 0.004
>gnl|CDD|241391 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins 5 and 6 pleckstrin homology (PH) domain, C-terminus Back     alignment and domain information
 Score =  107 bits (268), Expect = 2e-29
 Identities = 44/89 (49%), Positives = 62/89 (69%), Gaps = 4/89 (4%)

Query: 213 SGWLH--KKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNF--K 268
           SG+L+  K+  ++WKR WFVLKD+V+Y YKASED+ AL SIP+LGY +    E       
Sbjct: 2   SGYLYRRKRKKKSWKRLWFVLKDKVLYTYKASEDVVALESIPLLGYTVVPAKEGFEGDES 61

Query: 269 YVFQLKHQGQDPLVFGADNEQSYERWMKA 297
            VFQL H+GQ P +F AD+ ++ +RW++A
Sbjct: 62  LVFQLLHKGQLPYIFRADDAETAQRWIEA 90


FGD5 regulates promotes angiogenesis of vascular endothelial growth factor (VEGF) in vascular endothelial cells, including network formation, permeability, directional movement, and proliferation. The specific function of FGD6 is unknown. In general, FGDs have a RhoGEF (DH) domain, followed by a PH domain, a FYVE domain and a C-terminal PH domain. All FGDs are guanine nucleotide exchange factors that activate the Rho GTPase Cdc42, an important regulator of membrane trafficking. The RhoGEF domain is responsible for GEF catalytic activity, while the PH domain is involved in intracellular targeting of the DH domain. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 90

>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|216454 pfam01363, FYVE, FYVE zinc finger Back     alignment and domain information
>gnl|CDD|214499 smart00064, FYVE, Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
>gnl|CDD|238022 cd00065, FYVE, FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
>gnl|CDD|241540 cd13389, PH1_FGD5_FGD6, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins 5 and 6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|241291 cd01260, PH_CNK_mammalian-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|241390 cd13236, PH2_FGD1-4, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins pleckstrin homology (PH) domain, C-terminus Back     alignment and domain information
>gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|241389 cd13235, PH2_FARP1-like, FERM, RhoGEF and pleckstrin domain-containing protein 1 and related proteins Pleckstrin Homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241435 cd13281, PH_PLEKHD1, Pleckstrin homology (PH) domain containing, family D (with coiled-coil domains) member 1 PH domain Back     alignment and domain information
>gnl|CDD|241480 cd13326, PH_CNK_insect-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information
>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241453 cd13299, PH2_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241530 cd13379, PH_RhoGap24, Rho GTPase activating protein 24 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241290 cd01259, PH_APBB1IP, Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for Phosphoinositides-1-like Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241460 cd13306, PH1_AFAP, Actin filament associated protein family Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241284 cd01253, PH_ARHGAP21-like, ARHGAP21 and related proteins pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241270 cd01237, PH_fermitin, Fermitin family pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241426 cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bisphosphate 4-phosphatase and Type II inositol 3,4-bisphosphate 4-phosphatase Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241392 cd13238, PH2_FGD4_insect-like, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia protein 4 pleckstrin homology (PH) domain, C-terminus, in insect and related arthropods Back     alignment and domain information
>gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241421 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D subfamily Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|241414 cd13260, PH_RASA1, RAS p21 protein activator (GTPase activating protein) 1 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241253 cd01218, PH_Phafin2-like, Phafin2 (also called EAPF, FLJ13187, ZFYVE18 or PLEKHF2) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|241451 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin homology (PH) domain, repeat 3 Back     alignment and domain information
>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241254 cd01219, PH1_FGD1, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia protein 1 pleckstrin homology (PH), N-terminal domain Back     alignment and domain information
>gnl|CDD|241538 cd13387, PH1_FGD3, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia protein 3 pleckstrin homology (PH), N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 305
KOG4424|consensus623 99.97
KOG1729|consensus288 99.94
KOG1117|consensus 1186 99.87
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.82
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.8
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.79
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.78
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.76
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 99.76
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.75
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.75
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.73
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.72
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.72
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.71
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.7
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.68
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.68
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.67
smart0006468 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 99.67
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.66
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 99.63
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.61
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 99.6
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 99.59
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.58
KOG0930|consensus395 99.57
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 99.54
KOG1818|consensus 634 99.5
PTZ00303 1374 phosphatidylinositol kinase; Provisional 99.48
KOG1819|consensus990 99.47
PF1540989 PH_8: Pleckstrin homology domain 99.45
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 99.44
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 99.44
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 99.42
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 99.41
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.39
cd0006557 FYVE FYVE domain; Zinc-binding domain; targets pro 99.37
KOG1841|consensus 1287 99.37
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 99.34
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 99.33
KOG3531|consensus1036 99.33
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 99.32
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.31
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 99.25
KOG1090|consensus1732 99.19
KOG1842|consensus505 99.1
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.08
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 99.07
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.04
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 98.76
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 98.75
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 98.74
KOG1843|consensus473 98.73
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 98.71
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 98.57
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 98.53
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 98.51
KOG0690|consensus 516 98.49
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 98.49
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 98.47
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 98.46
KOG3640|consensus1116 98.43
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 98.39
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 98.32
KOG1409|consensus404 98.31
KOG0521|consensus 785 98.27
KOG2059|consensus 800 98.26
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 98.21
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 98.19
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 98.17
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 98.16
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 98.14
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 98.13
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 98.07
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 98.03
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 98.0
KOG3751|consensus 622 97.96
KOG0705|consensus749 97.96
KOG0932|consensus 774 97.95
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 97.92
KOG0521|consensus 785 97.91
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 97.86
KOG3543|consensus 1218 97.85
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 97.85
cd01240116 PH_beta-ARK Beta adrenergic receptor kinase 1(beta 97.84
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 97.81
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 97.79
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 97.78
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 97.78
PLN02866 1068 phospholipase D 97.78
PTZ00267478 NIMA-related protein kinase; Provisional 97.74
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 97.74
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 97.73
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 97.65
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 97.61
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 97.59
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 97.56
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 97.55
KOG0248|consensus 936 97.53
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 97.5
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 97.42
KOG1811|consensus 1141 97.39
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 97.28
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 97.26
PF02318118 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 97.22
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 97.22
KOG0230|consensus 1598 97.19
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 97.16
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 97.15
PTZ00283496 serine/threonine protein kinase; Provisional 97.14
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 97.14
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 97.11
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 97.09
KOG1117|consensus 1186 97.08
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 97.07
PF15408104 PH_7: Pleckstrin homology domain 96.96
KOG1739|consensus 611 96.93
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 96.89
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 96.87
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 96.87
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 96.86
PF15406112 PH_6: Pleckstrin homology domain 96.83
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 96.75
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 96.68
KOG1738|consensus638 96.64
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 96.57
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 96.53
PF12814123 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin 96.45
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 96.41
KOG4236|consensus 888 96.4
PF15404185 PH_4: Pleckstrin homology domain 96.38
KOG1451|consensus 812 96.3
KOG0930|consensus395 96.29
KOG3723|consensus851 96.2
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 96.14
KOG1841|consensus 1287 95.82
KOG3727|consensus 664 95.53
KOG0703|consensus287 95.49
KOG3549|consensus 505 95.46
KOG0230|consensus 1598 95.23
KOG0248|consensus 936 95.17
PF1540989 PH_8: Pleckstrin homology domain 94.93
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 94.65
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 94.62
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 94.58
COG5347319 GTPase-activating protein that regulates ARFs (ADP 94.56
KOG3551|consensus 506 94.53
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 94.5
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 94.12
cd01248115 PH_PLC Phospholipase C (PLC) pleckstrin homology ( 93.68
PF12814123 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin 93.52
KOG4424|consensus 623 93.52
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 93.52
smart00105112 ArfGap Putative GTP-ase activating proteins for th 93.32
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 93.22
cd01255160 PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM 93.15
PF01412116 ArfGap: Putative GTPase activating protein for Arf 93.13
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 93.08
PF15406112 PH_6: Pleckstrin homology domain 92.83
KOG0690|consensus 516 92.82
KOG0932|consensus774 92.76
PLN03119 648 putative ADP-ribosylation factor GTPase-activating 92.26
KOG1737|consensus 799 92.23
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 92.16
PLN03131 705 hypothetical protein; Provisional 90.65
PF08458110 PH_2: Plant pleckstrin homology-like region; Inter 90.64
KOG2070|consensus 661 90.48
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 90.15
KOG1729|consensus288 90.02
PLN03114 395 ADP-ribosylation factor GTPase-activating protein 88.58
KOG4407|consensus 1973 88.55
KOG4807|consensus 593 87.51
KOG0704|consensus 386 87.25
PRK00464154 nrdR transcriptional regulator NrdR; Validated 85.64
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 85.58
KOG2059|consensus800 85.36
KOG0517|consensus2473 84.96
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 83.95
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 83.86
KOG2996|consensus 865 83.66
KOG1264|consensus 1267 83.51
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 82.53
KOG0706|consensus 454 80.51
>KOG4424|consensus Back     alignment and domain information
Probab=99.97  E-value=2e-31  Score=245.55  Aligned_cols=255  Identities=30%  Similarity=0.487  Sum_probs=205.8

Q ss_pred             CeeecCCCcCCCceEEEEEeceEEEEEeCCHHHHHHHHHHHHHHHHHHHhccccccccccccc------CCCcccCcCCC
Q psy2207           1 MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRSLTQ------SSIPELNLGKV   74 (305)
Q Consensus         1 m~v~~~~~~~~~~~f~i~~~~ksf~~~a~s~~ek~~W~~~i~~ai~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~   74 (305)
                      |+|+..++.++++.|.|.+++|+..|+|.|++|+++|+++|+++|+.+.+...+|........      +......++..
T Consensus       325 ~~v~~~~~~~~~~tF~~~G~~r~vel~a~t~~ek~eWv~~I~~~Id~~kq~~eTfr~~s~t~~~~~d~~s~~~~~~l~~r  404 (623)
T KOG4424|consen  325 MQVQEDDNEELPHTFILTGKKRGVELQARTEQEKKEWVQAIQDAIDKHKQCRETFRKDSRTPISDNDMKSFSSDYVLGKR  404 (623)
T ss_pred             chhcccccccCCceEEEecccceEEeecCchhhHHHHHHHHHHHHHHHHHHHHHHHhccCCchhhccccccccccccccc
Confidence            789999999999999999999999999999999999999999999999999999876542211      22334444443


Q ss_pred             ---CCeeeecCCCccccccccccc-ccccccccccccceeccCccCCeecccCCCCccccccHhhHHHHHhccCCCcchh
Q psy2207          75 ---APLWIPDSRVSMCQRCTSVFT-VTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLVQEFDDEDSNM  150 (305)
Q Consensus        75 ---~p~w~~d~~~~~C~~C~~~f~-~~~rrhhCr~cg~v~C~~Cs~~~~~l~~~~~~~~rvC~~C~~~~~~~~~~~~~~~  150 (305)
                         +|.|  +.++++|+.|..+|+ .+.|||||+.||.++|+.|+.+...+.+++++..|||..||....+....+    
T Consensus       405 ~~~~~r~--~~k~~~c~~c~e~~~s~t~~R~~~k~~~~vlc~~cs~~~~~l~~~~s~ssrv~~~~~~~~~~a~~s~----  478 (623)
T KOG4424|consen  405 KRKAPRR--DNKVTSCDSCEETFNSITFRRHRCKAKGAVLCDKCSDFMAKLSYDNSRSSRVCMDRYLTPSGAPGSP----  478 (623)
T ss_pred             cccCccc--ccccccchhhcCchhhHHHhhhhhhhccceeeccccchhhhhcccccchhhhhhhhccCCCCCCCCc----
Confidence               6777  888999999999998 688999999999999999999999999999999999999988665431111    


Q ss_pred             hhhhhhccccccccccccceeeecCCccccCCCCcccCCCcccccccccccccccCCCCCceeeeeeecc--CCCceEEE
Q psy2207         151 FERVKAVANVEDNHQVTNMMDIIRSNFKEMGTAGRRKPSKKYRKYVPQRLIEVTANDSGSQHSGWLHKKS--GRNWKRYW  228 (305)
Q Consensus       151 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~L~~~~--~~~wkrrw  228 (305)
                                                        +  ++.     .+...+..+...++..++++|.+..  ++.|...|
T Consensus       479 ----------------------------------~--~rr-----~~~l~~~~a~~s~~~~~~s~l~~~~~~~~~g~~a~  517 (623)
T KOG4424|consen  479 ----------------------------------P--KRR-----QSILEIELATVSKENVICSHLKYMEAAGKTGILAW  517 (623)
T ss_pred             ----------------------------------h--hcc-----cccccccccccCCCceehhhHHHHhhcCccceeee
Confidence                                              0  111     2334455555556667888776655  78999999


Q ss_pred             EEEE---CCEEEEEccCccCccceEEEecCeEEEEcccc--CCcceeEEEEeCCceeEEEEcCCHHHHHHHHHHHHHHHc
Q psy2207         229 FVLK---DQVMYKYKASEDIKALLSIPVLGYELEALNEQ--DNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREATT  303 (305)
Q Consensus       229 ~vL~---~~~L~~y~~~~d~~p~~~i~L~~~~v~~~~~~--~~~~~~F~l~~~~~~~~~f~a~s~e~~~~Wi~al~~a~~  303 (305)
                      +++.   +.++|.|.+++|..+...|||.|+.|.+++..  .+..++|.++ .....|+|.|+|++..++|++.|-.|+.
T Consensus       518 ~~vP~~d~~~~~~Yg~~qDv~a~~~iPl~~~~v~~pe~~~~~D~~~~~k~~-~s~~~~~~~a~~~q~qq~wl~~l~~A~~  596 (623)
T KOG4424|consen  518 SVVPKSDPLVDYSYGSPQDVRAQATIPLPGVEVTIPEFVRREDLFHVFKLV-QSHLSWHLAADDEQLQQRWLEVLLLAVS  596 (623)
T ss_pred             eeccCCCCccccccCCccccccccccccCccccCCCcccccchhcchhhhh-hhcceeeeccCCHHHHHHHHHHHHhhhc
Confidence            9984   57999999999999999999999999854422  2344778876 4555799999999999999999988763



>KOG1729|consensus Back     alignment and domain information
>KOG1117|consensus Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0930|consensus Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG1818|consensus Back     alignment and domain information
>PTZ00303 phosphatidylinositol kinase; Provisional Back     alignment and domain information
>KOG1819|consensus Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; Back     alignment and domain information
>KOG1841|consensus Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>KOG1090|consensus Back     alignment and domain information
>KOG1842|consensus Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3640|consensus Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0932|consensus Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG3543|consensus Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1811|consensus Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>PF02318 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0230|consensus Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1117|consensus Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>PF15408 PH_7: Pleckstrin homology domain Back     alignment and domain information
>KOG1739|consensus Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG0930|consensus Back     alignment and domain information
>KOG3723|consensus Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1841|consensus Back     alignment and domain information
>KOG3727|consensus Back     alignment and domain information
>KOG0703|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG0230|consensus Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain Back     alignment and domain information
>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain Back     alignment and domain information
>PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG0932|consensus Back     alignment and domain information
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional Back     alignment and domain information
>KOG1737|consensus Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>PLN03131 hypothetical protein; Provisional Back     alignment and domain information
>PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1729|consensus Back     alignment and domain information
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>KOG4807|consensus Back     alignment and domain information
>KOG0704|consensus Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>KOG0517|consensus Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0706|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
3mpx_A434 Crystal Structure Of The Dh And Ph-1 Domains Of Hum 1e-15
1wgq_A109 Solution Structure Of The Pleckstrin Homology Domai 2e-15
3t7l_A90 Crystal Structure Of The Fyve Domain Of Endofin (Zf 1e-12
2yry_A122 Solution Structure Of The Ph Domain Of Pleckstrin H 1e-10
2d9y_A117 Solution Structure Of The Ph Domain Of Pepp-3 From 1e-10
1z2q_A84 High-Resolution Solution Structure Of The Lm5-1 Fyv 5e-10
3zyq_A226 Crystal Structure Of The Tandem Vhs And Fyve Domain 5e-09
1dvp_A220 Crystal Structure Of The Vhs And Fyve Tandem Domain 7e-09
1joc_A125 Eea1 Homodimer Of C-Terminal Fyve Domain Bound To I 9e-09
2yqm_A89 Solution Structure Of The Fyve Domain In Zinc Finge 2e-08
2dkp_A128 Solution Structure Of The Ph Domain Of Pleckstrin H 5e-08
2yw8_A82 Crystal Structure Of Human Run And Fyve Domain-Cont 9e-08
1hyi_A65 Solution Structure Of The Eea1 Fyve Domain Complexe 2e-07
1upq_A123 Crystal Structure Of The Pleckstrin Homology (Ph) D 3e-07
1v89_A118 Solution Structure Of The Pleckstrin Homology Domai 7e-07
1vfy_A73 Phosphatidylinositol-3-Phosphate Binding Fyve Domai 9e-05
>pdb|3MPX|A Chain A, Crystal Structure Of The Dh And Ph-1 Domains Of Human Fgd5 Length = 434 Back     alignment and structure

Iteration: 1

Score = 80.5 bits (197), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 47/137 (34%), Positives = 65/137 (47%), Gaps = 4/137 (2%) Query: 2 KVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKEN--EQHLLSFLNRR 59 KV P E + L A S ER EW + A+ E+ Q L +F Sbjct: 293 KVSRPVXEKVPYALKIETSESCLXLSASSCAERDEWYGCLSRALPEDYKAQALAAF--HH 350 Query: 60 SLTQSSIPELNLGKVAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLA 119 S+ ++LG+ P +P + V C C F++T RRHHC ACGK+VC CS Sbjct: 351 SVEIRERLGVSLGERPPTLVPVTHVXXCXNCGCDFSLTLRRHHCHACGKIVCRNCSRNKY 410 Query: 120 PLEYKKFRNFRVCEECY 136 PL+Y K R +VC+ C+ Sbjct: 411 PLKYLKDRXAKVCDGCF 427
>pdb|1WGQ|A Chain A, Solution Structure Of The Pleckstrin Homology Domain Of Mouse Ethanol Decreased 4 Protein Length = 109 Back     alignment and structure
>pdb|3T7L|A Chain A, Crystal Structure Of The Fyve Domain Of Endofin (Zfyve16) At 1.1a Resolution Length = 90 Back     alignment and structure
>pdb|2YRY|A Chain A, Solution Structure Of The Ph Domain Of Pleckstrin Homology Domain-Containing Family A Member 6 From Human Length = 122 Back     alignment and structure
>pdb|2D9Y|A Chain A, Solution Structure Of The Ph Domain Of Pepp-3 From Human Length = 117 Back     alignment and structure
>pdb|1Z2Q|A Chain A, High-Resolution Solution Structure Of The Lm5-1 Fyve Domain From Leishmania Major Length = 84 Back     alignment and structure
>pdb|3ZYQ|A Chain A, Crystal Structure Of The Tandem Vhs And Fyve Domains Of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) At 1.48 A Resolution Length = 226 Back     alignment and structure
>pdb|1DVP|A Chain A, Crystal Structure Of The Vhs And Fyve Tandem Domains Of Hrs, A Protein Involved In Membrane Trafficking And Signal Transduction Length = 220 Back     alignment and structure
>pdb|1JOC|A Chain A, Eea1 Homodimer Of C-Terminal Fyve Domain Bound To Inositol 1,3-Diphosphate Length = 125 Back     alignment and structure
>pdb|2YQM|A Chain A, Solution Structure Of The Fyve Domain In Zinc Finger Fyve Domain-Containing Protein 12 Length = 89 Back     alignment and structure
>pdb|2DKP|A Chain A, Solution Structure Of The Ph Domain Of Pleckstrin Homology Domain-Containing Protein Family A Member 5 From Human Length = 128 Back     alignment and structure
>pdb|2YW8|A Chain A, Crystal Structure Of Human Run And Fyve Domain-Containing Protein Length = 82 Back     alignment and structure
>pdb|1HYI|A Chain A, Solution Structure Of The Eea1 Fyve Domain Complexed With Inositol 1,3-Bisphosphate Length = 65 Back     alignment and structure
>pdb|1UPQ|A Chain A, Crystal Structure Of The Pleckstrin Homology (Ph) Domain Of Pepp1 Length = 123 Back     alignment and structure
>pdb|1V89|A Chain A, Solution Structure Of The Pleckstrin Homology Domain Of Human Kiaa0053 Protein Length = 118 Back     alignment and structure
>pdb|1VFY|A Chain A, Phosphatidylinositol-3-Phosphate Binding Fyve Domain Of Vps27p Protein From Saccharomyces Cerevisiae Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 5e-37
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 3e-33
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 2e-30
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 1e-28
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 2e-27
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 2e-26
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 2e-26
2d9y_A117 Pleckstrin homology domain-containing protein fami 3e-26
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 9e-26
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 3e-25
2yry_A122 Pleckstrin homology domain-containing family A mem 3e-25
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 1e-24
2dkp_A128 Pleckstrin homology domain-containing family A mem 2e-24
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 7e-23
3cxb_B112 Pleckstrin homology domain-containing family M mem 9e-23
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 1e-22
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 1e-20
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 1e-20
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 2e-20
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 8e-20
1u5e_A211 SRC-associated adaptor protein; novel dimerization 1e-19
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 5e-19
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 4e-18
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 2e-17
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 7e-04
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 3e-17
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 4e-17
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 3e-04
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 5e-17
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 4e-05
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 7e-17
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 1e-05
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 7e-17
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 1e-16
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 1e-16
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 3e-06
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 1e-16
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 2e-05
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 1e-16
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 3e-05
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 2e-16
1wi1_A126 Calcium-dependent activator protein for secretion, 8e-16
1wi1_A126 Calcium-dependent activator protein for secretion, 8e-06
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 8e-16
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 1e-05
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 3e-15
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 3e-15
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 2e-06
1v5p_A126 Pleckstrin homology domain-containing, family A; T 4e-15
1v5p_A126 Pleckstrin homology domain-containing, family A; T 2e-05
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 9e-15
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 1e-14
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 4e-04
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 1e-14
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 2e-14
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 8e-04
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 4e-14
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 5e-14
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 5e-14
2d9v_A130 Pleckstrin homology domain-containing protein fami 5e-14
1v88_A130 Oxysterol binding protein-related protein 8; vesic 7e-14
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 1e-13
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 8e-06
3aj4_A112 Pleckstrin homology domain-containing family B ME; 2e-13
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 2e-13
3a8n_A 279 TIAM-1, T-lymphoma invasion and metastasis-inducin 2e-13
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 4e-13
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 1e-04
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 4e-13
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 9e-13
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 1e-12
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 7e-12
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 7e-12
3rcp_A103 Pleckstrin homology domain-containing family A ME; 8e-12
3rcp_A103 Pleckstrin homology domain-containing family A ME; 1e-04
3a8p_A 263 T-lymphoma invasion and metastasis-inducing protei 1e-11
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 2e-11
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 2e-11
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 3e-11
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 8e-06
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 6e-09
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 7e-09
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 2e-08
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 4e-08
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 3e-04
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 1e-07
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 9e-04
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 2e-07
2zet_C153 Melanophilin; complex, GTP-binding protein, GTPase 2e-07
1qqg_A 264 IRS-1, insulin receptor substrate 1; beta-sandwhic 3e-07
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 4e-07
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 4e-07
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 2e-06
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 6e-06
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 7e-05
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 8e-05
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 9e-05
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 1e-04
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-04
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 Back     alignment and structure
 Score =  135 bits (342), Expect = 5e-37
 Identities = 47/142 (33%), Positives = 66/142 (46%)

Query: 1   MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRS 60
           MKV  P  E       +        L A S  ER EW   +  A+ E+ +         S
Sbjct: 292 MKVSRPVMEKVPYALKIETSESCLMLSASSCAERDEWYGCLSRALPEDYKAQALAAFHHS 351

Query: 61  LTQSSIPELNLGKVAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAP 120
           +       ++LG+  P  +P + V MC  C   F++T RRHHC ACGK+VC  CS    P
Sbjct: 352 VEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLRRHHCHACGKIVCRNCSRNKYP 411

Query: 121 LEYKKFRNFRVCEECYHYLVQE 142
           L+Y K R  +VC+ C+  L + 
Sbjct: 412 LKYLKDRMAKVCDGCFGELKKR 433


>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Length = 90 Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Length = 82 Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Length = 84 Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Length = 125 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Length = 88 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Length = 73 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Length = 226 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Length = 220 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Length = 173 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Length = 120 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 132 Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 132 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Length = 124 Back     alignment and structure
>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} Length = 153 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Length = 113 Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Length = 256 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Length = 353 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Length = 117 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 99.94
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.88
1wi1_A126 Calcium-dependent activator protein for secretion, 99.88
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.87
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.86
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 99.84
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 99.84
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 99.84
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.83
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.83
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.83
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.82
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 99.82
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.82
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.82
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 99.81
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.81
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.81
2yry_A122 Pleckstrin homology domain-containing family A mem 99.8
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 99.8
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.8
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.8
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.8
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.8
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 99.8
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.79
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.79
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.79
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.78
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.78
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.78
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.78
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.78
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.77
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.77
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.77
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.77
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.77
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.77
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.77
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.77
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.77
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.76
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.76
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.75
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.75
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.75
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 99.75
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.74
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.74
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.74
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.74
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.74
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 99.74
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 99.74
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.73
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.73
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.72
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 99.72
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.72
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.71
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 99.7
3a8p_A 263 T-lymphoma invasion and metastasis-inducing protei 99.7
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.68
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 99.67
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.66
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.66
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 99.65
1qqg_A 264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.64
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 99.63
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 99.62
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.58
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 99.57
3a8n_A 279 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.53
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 99.49
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 99.48
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 99.35
2d9w_A127 Docking protein 2; PH domain, structural genomics, 99.33
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 99.31
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.23
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 99.19
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 99.12
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 98.92
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 98.83
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 98.54
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 98.42
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 98.4
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 98.36
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 98.35
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 98.33
3ml4_A 224 Protein DOK-7; tyrosine phosphorylation, adapter p 98.32
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 98.32
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 98.27
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 98.2
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 98.2
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 98.16
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 98.14
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 98.12
2d9v_A130 Pleckstrin homology domain-containing protein fami 98.11
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 98.11
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 98.1
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 98.09
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 98.06
3aj4_A112 Pleckstrin homology domain-containing family B ME; 98.05
3cxb_B112 Pleckstrin homology domain-containing family M mem 98.04
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 98.03
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 98.02
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 98.02
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 98.02
1v5p_A126 Pleckstrin homology domain-containing, family A; T 98.01
1wi1_A126 Calcium-dependent activator protein for secretion, 98.01
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 97.99
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 97.98
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 97.96
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 97.93
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 97.93
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 97.93
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 97.92
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 97.9
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 97.9
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 97.89
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 97.89
3rcp_A103 Pleckstrin homology domain-containing family A ME; 97.88
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 97.87
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 97.85
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 97.83
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 97.81
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 97.78
2yry_A122 Pleckstrin homology domain-containing family A mem 97.77
2d9y_A117 Pleckstrin homology domain-containing protein fami 97.76
2dkp_A128 Pleckstrin homology domain-containing family A mem 97.75
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 97.75
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.73
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 97.69
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 97.69
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 97.68
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 97.68
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 97.64
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 97.62
1v88_A130 Oxysterol binding protein-related protein 8; vesic 97.62
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 97.61
2d9w_A127 Docking protein 2; PH domain, structural genomics, 97.52
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 97.44
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 97.37
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 97.37
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 97.36
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 97.34
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 97.29
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 97.1
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.08
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 97.06
1zbd_B134 Rabphilin-3A; G protein, effector, RABCDR, synapti 97.06
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 97.05
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 97.05
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 97.02
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 96.91
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 96.88
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 96.74
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 96.67
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 96.63
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 96.61
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 96.51
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 96.51
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 96.47
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 96.47
2zet_C153 Melanophilin; complex, GTP-binding protein, GTPase 96.46
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 96.45
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 96.35
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 96.2
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 96.03
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 96.01
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 95.97
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 95.93
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 95.78
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 95.72
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 95.62
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 95.61
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 95.57
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 95.43
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 95.43
1foe_A377 T-lymphoma invasion and metastasis inducing protei 94.57
2owa_A138 Arfgap-like finger domain containing protein; zinc 94.34
2olm_A140 Nucleoporin-like protein RIP; arfgap, GTPase-activ 94.3
2iqj_A134 Stromal membrane-associated protein 1-like; zinc, 94.25
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 94.21
2crw_A149 ARF GAP 3, ADP-ribosylation factor GTPase-activati 93.9
3sub_A163 ADP-ribosylation factor GTPase-activating protein; 93.77
2crr_A141 Stromal membrane-associated protein SMAP1B; arfgap 93.7
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 93.51
2csz_A76 Synaptotagmin-like protein 4; exophilin 2, granuph 93.06
3dwd_A147 ADP-ribosylation factor GTPase-activating protein; 92.93
2p57_A144 GTPase-activating protein ZNF289; zinc finger, GAP 92.88
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 92.73
2adz_A178 Alpha-1-syntrophin; protein binding; NMR {Mus musc 91.79
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 90.46
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 90.05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 89.75
3o47_A329 ADP-ribosylation factor GTPase-activating protein 89.37
1wff_A85 Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc 89.14
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 88.74
1wfh_A64 Zinc finger (AN1-like) family protein; ZF-AN1 doma 88.66
1wfl_A74 Zinc finger protein 216; ZF-AN1 domain, zinc bindi 88.51
1wfp_A74 Zinc finger (AN1-like) family protein; ZF-AN1 doma 87.45
3jue_A 368 Arfgap with coiled-coil, ANK repeat and PH domain 86.95
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 86.43
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 86.34
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 84.66
1wg2_A64 Zinc finger (AN1-like) family protein; riken struc 84.35
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 84.11
2a20_A62 Regulating synaptic membrane exocytosis protein 2; 83.65
3a98_B203 Engulfment and cell motility protein 1; protein-pr 82.94
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 82.54
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 82.4
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
Probab=99.94  E-value=9.1e-28  Score=226.36  Aligned_cols=139  Identities=35%  Similarity=0.637  Sum_probs=39.1

Q ss_pred             CeeecCCCcCCCceEEEEEeceEEEEEeCCHHHHHHHHHHHHHHHHHHHhc--ccccccccccccCCCcccCcCCCCCee
Q psy2207           1 MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQH--LLSFLNRRSLTQSSIPELNLGKVAPLW   78 (305)
Q Consensus         1 m~v~~~~~~~~~~~f~i~~~~ksf~~~a~s~~ek~~W~~~i~~ai~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~p~w   78 (305)
                      |.|..+++++.+|.|.|.++.++|.|+|.|++||++|+++|+++|.+....  ..+|...  .+.++......+..+|.|
T Consensus       292 l~v~~~~~~~~~~~f~i~~~~~~~~l~a~s~~ek~~W~~~i~~ai~e~~~~~~~~~f~~~--~e~~~~~~~~~~~~~p~w  369 (434)
T 3mpx_A          292 MKVSRPVMEKVPYALKIETSESCLMLSASSCAERDEWYGCLSRALPEDYKAQALAAFHHS--VEIRERLGVSLGERPPTL  369 (434)
T ss_dssp             ---CCCCCTTSCSEEEEECSSCEEEEECSSHHHHHHHHHHHHHC------------------------------------
T ss_pred             cEEEecCCCCCCeeEEEecCCeEEEEecCCHHHHHHHHHHHHHHHHHHHhhhcccccCCc--cchhhcccCccccCCCcC
Confidence            456677778899999999999999999999999999999999999875332  2233221  122233455677889999


Q ss_pred             eecCCCcccccccccccccccccccccccceeccCccCCeecccCCCCccccccHhhHHHHHh
Q psy2207          79 IPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLVQ  141 (305)
Q Consensus        79 ~~d~~~~~C~~C~~~f~~~~rrhhCr~cg~v~C~~Cs~~~~~l~~~~~~~~rvC~~C~~~~~~  141 (305)
                      +||..+..|+.|+.+|+++.|+||||+||.+||..||++++++++.+.+++|||+.||..+..
T Consensus       370 ~~~~~~~~c~~c~~~f~~~~r~h~Cr~Cg~~~C~~Cs~~~~~~~~~~~~~~rvC~~C~~~l~~  432 (434)
T 3mpx_A          370 VPVTHVMMCMNCGCDFSLTLRRHHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCFGELKK  432 (434)
T ss_dssp             ---------------------------------------------------------------
T ss_pred             CCcccCCcCCCcCCCCCCcchhhhcccCcCEeehhhCCCeeeCCCCCCCcCEecHHHHHHHHh
Confidence            999999999999999999999999999999999999999999998888999999999998754



>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1 Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Back     alignment and structure
>2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Back     alignment and structure
>2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>2csz_A Synaptotagmin-like protein 4; exophilin 2, granuphilin, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Back     alignment and structure
>2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2a20_A Regulating synaptic membrane exocytosis protein 2; zinc-finger domain, metal binding protein; NMR {Rattus norvegicus} PDB: 2cjs_C Back     alignment and structure
>3a98_B Engulfment and cell motility protein 1; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} PDB: 2vsz_A Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 305
d1wfka_88 g.50.1.1 (A:) Zinc finger FYVE domain containing p 4e-18
d1joca164 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) 7e-18
d1dvpa272 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila me 7e-17
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 2e-15
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 7e-15
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 2e-14
d1plsa_113 b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta 4e-14
d1v88a_130 b.55.1.1 (A:) Oxysterol binding protein-related pr 5e-14
d1v89a_118 b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI 8e-14
d1vfya_67 g.50.1.1 (A:) vps27p protein {Baker's yeast (Sacch 1e-13
d1wgqa_109 b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin 1e-13
d2cofa195 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) 2e-13
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 5e-13
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9e-05
d1y02a251 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger pro 1e-12
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 1e-12
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 0.001
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 2e-12
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 7e-12
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 0.001
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 1e-11
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 0.002
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 3e-11
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 0.001
d1zbdb_124 g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat 5e-11
d2coca199 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont 7e-11
d2coda1102 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo 1e-10
d2coda1102 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo 0.001
d1v5pa_126 b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 1e-10
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 1e-10
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 0.001
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 2e-10
d2dyna_111 b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId 2e-10
d2elba2101 b.55.1.1 (A:274-374) DCC-interacting protein 13-al 3e-10
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 3e-10
d1wjma_123 b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), 5e-10
d1wg7a_150 b.55.1.1 (A:) Dedicator of cytokinesis protein 9, 5e-10
d1wi1a_126 b.55.1.1 (A:) Calcium-dependent activator protein 1e-09
d1x1fa1136 b.55.1.1 (A:8-143) Signal-transducing adaptor prot 2e-09
d2j59m1133 b.55.1.1 (M:931-1063) Rho GTPase-activating protei 5e-09
d2fjla1101 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph 2e-08
d1btna_106 b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), 2e-08
d1unqa_118 b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H 4e-08
d1omwa2119 b.55.1.1 (A:550-668) G-protein coupled receptor ki 7e-08
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 2e-07
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 3e-05
d1qqga1103 b.55.1.2 (A:12-114) Insulin receptor substrate 1, 4e-07
d1w1ha_147 b.55.1.1 (A:) 3-phosphoinositide dependent protein 5e-07
d2coaa1112 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma 7e-06
d1zc3b1109 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 1e-04
d1zc3b1109 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 4e-04
d1kz7a2147 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse 2e-04
d1dbha2133 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {H 0.002
d1xcga2140 b.55.1.1 (A:942-1081) Rho guanine nucleotide excha 0.002
d1ki1b2142 b.55.1.1 (B:1439-1580) GEF of intersectin {Human ( 0.003
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: FYVE, a phosphatidylinositol-3-phosphate binding domain
domain: Zinc finger FYVE domain containing protein 19
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 75.5 bits (185), Expect = 4e-18
 Identities = 17/65 (26%), Positives = 29/65 (44%)

Query: 84  VSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLVQEF 143
            S C  C   FT+  + + C+ CG+  C  C  + A +        +VC++C+  L +  
Sbjct: 9   ESRCYGCAVKFTLFKKEYGCKNCGRAFCNGCLSFSALVPRAGNTQQKVCKQCHTILTRGS 68

Query: 144 DDEDS 148
            D  S
Sbjct: 69  SDNAS 73


>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 72 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 109 Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 109 Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Length = 147 Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.82
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.82
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.81
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.79
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.79
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.78
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 99.77
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.77
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.77
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.76
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.76
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.74
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.73
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.73
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.73
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1vfya_67 vps27p protein {Baker's yeast (Saccharomyces cerev 99.72
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.71
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.71
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 99.7
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.7
d1wfka_88 Zinc finger FYVE domain containing protein 19 {Mou 99.7
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.7
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.69
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 99.69
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.69
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.67
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.67
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.66
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.65
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 99.65
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.64
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.6
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 99.45
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 99.21
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 99.04
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 98.62
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 98.56
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 98.51
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 98.47
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 98.46
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 98.28
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 98.28
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 98.15
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 98.04
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 97.96
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 97.94
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 97.94
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 97.92
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 97.91
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 97.89
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 97.87
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 97.87
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 97.83
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 97.83
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 97.83
d1wi1a_126 Calcium-dependent activator protein for secretion, 97.8
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 97.77
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 97.77
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 97.75
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 97.74
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 97.71
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 97.69
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 97.65
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 97.61
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 97.6
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 97.58
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 97.57
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 97.56
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 97.56
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 97.53
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 97.52
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 97.5
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 97.49
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 97.46
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 97.44
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 97.44
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 97.42
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 97.39
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 97.38
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 97.33
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 97.23
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 97.21
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 97.19
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 97.17
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 97.12
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 97.05
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 96.89
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 96.8
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 95.75
d1dcqa2122 Pyk2-associated protein beta ARF-GAP domain {Mouse 95.32
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 94.96
d1foea2162 GEF of TIAM1 (T-Lymphoma invasion and metastasis i 92.72
d1wfla_74 Zinc finger A20 domain containing protein 2 {Mouse 91.39
d1wffa_85 ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus 89.3
d2zkmx3131 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 88.38
d1wfpa_74 Zinc finger A20 and AN1 domains containing protein 87.64
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 86.71
d1wfha_64 Zinc finger A20 and AN1 domains containing protein 85.82
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: FYVE, a phosphatidylinositol-3-phosphate binding domain
domain: Eea1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.82  E-value=1.1e-21  Score=132.29  Aligned_cols=63  Identities=40%  Similarity=0.867  Sum_probs=58.8

Q ss_pred             eeeecCCCcccccccccccccccccccccccceeccCccCCeecccCCCCccccccHhhHHHHH
Q psy2207          77 LWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLV  140 (305)
Q Consensus        77 ~w~~d~~~~~C~~C~~~f~~~~rrhhCr~cg~v~C~~Cs~~~~~l~~~~~~~~rvC~~C~~~~~  140 (305)
                      .|+||++++.|+.|+.+|+++.||||||+||.+||+.|+.++.++|.. ..++|||+.||..|.
T Consensus         1 rW~~d~~~~~C~~C~~~F~~~~rrHHCR~CG~v~C~~Cs~~~~~~~~~-~~~~RVC~~C~~~l~   63 (64)
T d1joca1           1 KWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSS-KKPVRVCDACFNDLQ   63 (64)
T ss_dssp             CCCCGGGCCBCTTTCCBCCSSSCCEECTTTCCEECGGGSCEEECCTTC-SSCEEECHHHHHHTT
T ss_pred             CCCCcccCCcCcCcCCcccCCccccchhhhCCeecccccCCceecCCC-CCccEehHHHHHHhc
Confidence            499999999999999999999999999999999999999999999864 578999999999875



>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1foea2 b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure