Psyllid ID: psy2207
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 305 | ||||||
| 328700485 | 862 | PREDICTED: FYVE, RhoGEF and PH domain-co | 0.967 | 0.342 | 0.517 | 8e-84 | |
| 321456107 | 1317 | hypothetical protein DAPPUDRAFT_331275 [ | 0.993 | 0.230 | 0.430 | 9e-64 | |
| 242010240 | 1001 | FYVE, RhoGEF and PH domain-containing pr | 0.865 | 0.263 | 0.428 | 1e-61 | |
| 427780591 | 1673 | hypothetical protein [Rhipicephalus pulc | 0.898 | 0.163 | 0.420 | 4e-59 | |
| 427780589 | 1700 | hypothetical protein [Rhipicephalus pulc | 0.898 | 0.161 | 0.420 | 5e-59 | |
| 427780127 | 1097 | hypothetical protein [Rhipicephalus pulc | 0.898 | 0.249 | 0.420 | 5e-59 | |
| 443695700 | 482 | hypothetical protein CAPTEDRAFT_180983 [ | 0.957 | 0.605 | 0.402 | 5e-57 | |
| 117616870 | 431 | ethanol decreased 4 [synthetic construct | 0.940 | 0.665 | 0.404 | 5e-56 | |
| 26382536 | 465 | unnamed protein product [Mus musculus] | 0.940 | 0.617 | 0.404 | 5e-56 | |
| 114325429 | 943 | Fgd6 protein [Mus musculus] | 0.940 | 0.304 | 0.401 | 6e-56 |
| >gi|328700485|ref|XP_001945183.2| PREDICTED: FYVE, RhoGEF and PH domain-containing protein 6-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 316 bits (809), Expect = 8e-84, Method: Compositional matrix adjust.
Identities = 161/311 (51%), Positives = 220/311 (70%), Gaps = 16/311 (5%)
Query: 1 MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRS 60
MKV LP T++ NEFS+I I+RSFTLRA+SA E EW++ ++ AI+E+ LSFLN +
Sbjct: 560 MKVFLPITDNCLNEFSIITITRSFTLRAKSAVELKEWVNILEKAIREHTNKQLSFLNMKF 619
Query: 61 LTQSSIPE-LNLGKVAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLA 119
++++ E L LG AP+WI D RV+MCQ C S FTVTFRRHHCRACGKVVC CS+ A
Sbjct: 620 VSKNIGREPLQLGYEAPIWIQDCRVTMCQSCASEFTVTFRRHHCRACGKVVCSSCSENKA 679
Query: 120 PLEYKKFRNFRVCEECYHYLVQEFDDEDSNMFERVKAVANVEDNHQVTNMMDIIRSNFKE 179
PL Y KF++ RVC++CY YL++EF+D+ + E ++ +N + ++ M+D ++++FK+
Sbjct: 680 PLRYMKFQSARVCDDCYDYLLKEFEDK---ILEMRQSSSN--SDLEILKMVDTVKNSFKK 734
Query: 180 MGTAGRRKPSKKYRKYVPQRLIEVTANDSGSQHSGWLHKKSGR-NWKRYWFVLKDQVMYK 238
G SKK KYVPQRL EV ANDSGSQ SGWL+++ R +WKR+WFVLK+QV+Y
Sbjct: 735 SGVWS----SKKLVKYVPQRLKEVMANDSGSQMSGWLYRREKRKSWKRFWFVLKEQVLYM 790
Query: 239 YKASEDIKALLSIPVLGYELEALNEQDNFKY-----VFQLKHQGQDPLVFGADNEQSYER 293
YKASED+ AL +IPVLGY ++ E N++ VFQL H GQ+PL+F +D EQ +R
Sbjct: 791 YKASEDVVALNTIPVLGYSVQTFPEGTNYEEFDSSCVFQLAHAGQNPLIFCSDTEQLAKR 850
Query: 294 WMKAMREATTL 304
W+ + EAT L
Sbjct: 851 WINTLNEATKL 861
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321456107|gb|EFX67223.1| hypothetical protein DAPPUDRAFT_331275 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|242010240|ref|XP_002425878.1| FYVE, RhoGEF and PH domain-containing protein, putative [Pediculus humanus corporis] gi|212509844|gb|EEB13140.1| FYVE, RhoGEF and PH domain-containing protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|427780591|gb|JAA55747.1| hypothetical protein [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427780589|gb|JAA55746.1| hypothetical protein [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427780127|gb|JAA55515.1| hypothetical protein [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|443695700|gb|ELT96558.1| hypothetical protein CAPTEDRAFT_180983 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|117616870|gb|ABK42453.1| ethanol decreased 4 [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|26382536|dbj|BAB30510.2| unnamed protein product [Mus musculus] | Back alignment and taxonomy information |
|---|
| >gi|114325429|gb|AAH26860.2| Fgd6 protein [Mus musculus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 305 | ||||||
| MGI|MGI:1261419 | 1399 | Fgd6 "FYVE, RhoGEF and PH doma | 0.947 | 0.206 | 0.384 | 8.6e-48 | |
| RGD|1565609 | 1390 | Fgd6 "FYVE, RhoGEF and PH doma | 0.947 | 0.207 | 0.384 | 1.8e-47 | |
| UNIPROTKB|D4A3Y7 | 1406 | Fgd6 "Protein Fgd6" [Rattus no | 0.947 | 0.205 | 0.384 | 1.8e-47 | |
| UNIPROTKB|Q6ZV73 | 1430 | FGD6 "FYVE, RhoGEF and PH doma | 0.947 | 0.202 | 0.373 | 8.3e-47 | |
| UNIPROTKB|F1MQ30 | 1434 | FGD6 "Uncharacterized protein" | 0.947 | 0.201 | 0.373 | 1.1e-46 | |
| UNIPROTKB|J9NYT0 | 1422 | FGD6 "Uncharacterized protein" | 0.947 | 0.203 | 0.370 | 1.7e-46 | |
| UNIPROTKB|F1Q280 | 1423 | FGD6 "Uncharacterized protein" | 0.947 | 0.203 | 0.370 | 1.7e-46 | |
| UNIPROTKB|F1SQP8 | 1431 | FGD6 "Uncharacterized protein" | 0.947 | 0.201 | 0.370 | 3.6e-46 | |
| UNIPROTKB|F1NVP2 | 1430 | FGD6 "Uncharacterized protein" | 0.947 | 0.202 | 0.363 | 1.1e-44 | |
| UNIPROTKB|E1C246 | 762 | FGD4 "Uncharacterized protein" | 0.514 | 0.206 | 0.385 | 7.3e-37 |
| MGI|MGI:1261419 Fgd6 "FYVE, RhoGEF and PH domain containing 6" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Score = 512 (185.3 bits), Expect = 8.6e-48, P = 8.6e-48
Identities = 118/307 (38%), Positives = 174/307 (56%)
Query: 1 MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRS 60
MKV P E Y NE + ++ RSF L A SA ER +W++AI ++I+E + ++F RS
Sbjct: 1108 MKVRKPTQEAYQNELKIESVERSFILSASSAAERDDWLEAISSSIEEYAKKRITFCPSRS 1167
Query: 61 LTQSSI--PELN-LGKVAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDY 117
L + S E++ LG AP+WIPD+R +MC CTS FT+T+RRHHCRACGK+VC CS
Sbjct: 1168 LDEDSERKEEVSPLGAKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSN 1227
Query: 118 LAPLEYKKFRNFRVCEECYHYLVQEFDDEDSNMFERVKAVANVEDNHQVTNMMDIIRSNF 177
L+Y K + RVCE C+ QE D + RV + N + + ++ S
Sbjct: 1228 KYGLDYLKGQLARVCEHCF----QELQKLDHQLSPRVGSPGNHKSPSSA--LSSVLHSI- 1280
Query: 178 KEMGTAGRRKPSKKYRKYVPQRLIEVTANDSGSQHSGWLHKKSGRNWKRYWFVLKDQVMY 237
+GR++ KK + + + DS + K S + WK WFV+K++V+Y
Sbjct: 1281 ----PSGRKQ--KKIPAALKE--VSANTEDSTMSGYLYRSKGSKKPWKHLWFVIKNKVLY 1332
Query: 238 KYKASEDIKALLSIPVLGYELEALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKA 297
Y ASED+ AL S P+LG+ + + ++++ VFQL H+G VF AD+ S +RW+ A
Sbjct: 1333 TYAASEDVAALESQPLLGFTVTLVKDENSESKVFQLLHKGMVFYVFKADDAHSTQRWIDA 1392
Query: 298 MREATTL 304
+E T L
Sbjct: 1393 FQEGTVL 1399
|
|
| RGD|1565609 Fgd6 "FYVE, RhoGEF and PH domain containing 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A3Y7 Fgd6 "Protein Fgd6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6ZV73 FGD6 "FYVE, RhoGEF and PH domain-containing protein 6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MQ30 FGD6 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NYT0 FGD6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q280 FGD6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SQP8 FGD6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NVP2 FGD6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C246 FGD4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 305 | |||
| cd13237 | 90 | cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain | 2e-29 | |
| cd13248 | 104 | cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate | 5e-26 | |
| pfam01363 | 68 | pfam01363, FYVE, FYVE zinc finger | 1e-23 | |
| smart00064 | 68 | smart00064, FYVE, Protein present in Fab1, YOTB, V | 5e-21 | |
| cd00065 | 57 | cd00065, FYVE, FYVE domain; Zinc-binding domain; t | 1e-16 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 4e-16 | |
| cd13389 | 125 | cd13389, PH1_FGD5_FGD6, FYVE, RhoGEF and PH domain | 9e-16 | |
| cd01260 | 114 | cd01260, PH_CNK_mammalian-like, Connector enhancer | 2e-15 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 3e-15 | |
| cd13236 | 105 | cd13236, PH2_FGD1-4, FYVE, RhoGEF and PH domain co | 3e-14 | |
| cd13263 | 114 | cd13263, PH_RhoGap25-like, Rho GTPase activating p | 7e-14 | |
| cd13316 | 95 | cd13316, PH_Boi, Boi family Pleckstrin homology do | 8e-12 | |
| cd13235 | 113 | cd13235, PH2_FARP1-like, FERM, RhoGEF and pleckstr | 2e-11 | |
| cd00821 | 92 | cd00821, PH, Pleckstrin homology (PH) domain | 9e-11 | |
| cd13281 | 139 | cd13281, PH_PLEKHD1, Pleckstrin homology (PH) doma | 2e-09 | |
| cd13326 | 90 | cd13326, PH_CNK_insect-like, Connector enhancer of | 3e-08 | |
| cd13288 | 120 | cd13288, PH_Ses, Sesquipedalian family Pleckstrin | 3e-08 | |
| cd13276 | 117 | cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin | 1e-07 | |
| cd13296 | 111 | cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P | 2e-07 | |
| cd13299 | 102 | cd13299, PH2_PH_fungal, Fungal proteins Pleckstrin | 2e-07 | |
| cd13215 | 130 | cd13215, PH-GRAM1_AGT26, Autophagy-related protein | 6e-07 | |
| cd13308 | 113 | cd13308, PH_3BP2, SH3 domain-binding protein 2 Ple | 8e-07 | |
| cd13379 | 114 | cd13379, PH_RhoGap24, Rho GTPase activating protei | 1e-06 | |
| cd13298 | 106 | cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin | 2e-06 | |
| cd13378 | 116 | cd13378, PH_RhoGAP2, Rho GTPase activating protein | 3e-06 | |
| cd01259 | 124 | cd01259, PH_APBB1IP, Amyloid beta (A4) Precursor p | 1e-05 | |
| cd01252 | 118 | cd01252, PH_GRP1-like, General Receptor for Phosph | 2e-05 | |
| cd01265 | 101 | cd01265, PH_TBC1D2A, TBC1 domain family member 2A | 4e-05 | |
| cd13306 | 107 | cd13306, PH1_AFAP, Actin filament associated prote | 7e-05 | |
| cd01253 | 113 | cd01253, PH_ARHGAP21-like, ARHGAP21 and related pr | 2e-04 | |
| cd13250 | 98 | cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin | 2e-04 | |
| cd13282 | 96 | cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology | 2e-04 | |
| cd01237 | 110 | cd01237, PH_fermitin, Fermitin family pleckstrin h | 3e-04 | |
| cd13272 | 116 | cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bis | 4e-04 | |
| cd13238 | 96 | cd13238, PH2_FGD4_insect-like, FYVE, RhoGEF and PH | 6e-04 | |
| cd01238 | 140 | cd01238, PH_Btk, Bruton's tyrosine kinase pleckstr | 7e-04 | |
| cd13267 | 125 | cd13267, PH_DOCK-D, Dedicator of cytokinesis-D sub | 0.001 | |
| cd01235 | 106 | cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als | 0.001 | |
| cd13260 | 103 | cd13260, PH_RASA1, RAS p21 protein activator (GTPa | 0.001 | |
| cd13273 | 110 | cd13273, PH_SWAP-70, Switch-associated protein-70 | 0.001 | |
| cd13255 | 110 | cd13255, PH_TAAP2-like, Tandem PH-domain-containin | 0.002 | |
| cd01218 | 123 | cd01218, PH_Phafin2-like, Phafin2 (also called EAP | 0.002 | |
| cd13297 | 123 | cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin h | 0.002 | |
| cd13301 | 108 | cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin | 0.002 | |
| cd01219 | 107 | cd01219, PH1_FGD1, FYVE, RhoGEF and PH domain cont | 0.003 | |
| cd13387 | 107 | cd13387, PH1_FGD3, FYVE, RhoGEF and PH domain cont | 0.004 |
| >gnl|CDD|241391 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins 5 and 6 pleckstrin homology (PH) domain, C-terminus | Back alignment and domain information |
|---|
Score = 107 bits (268), Expect = 2e-29
Identities = 44/89 (49%), Positives = 62/89 (69%), Gaps = 4/89 (4%)
Query: 213 SGWLH--KKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNF--K 268
SG+L+ K+ ++WKR WFVLKD+V+Y YKASED+ AL SIP+LGY + E
Sbjct: 2 SGYLYRRKRKKKSWKRLWFVLKDKVLYTYKASEDVVALESIPLLGYTVVPAKEGFEGDES 61
Query: 269 YVFQLKHQGQDPLVFGADNEQSYERWMKA 297
VFQL H+GQ P +F AD+ ++ +RW++A
Sbjct: 62 LVFQLLHKGQLPYIFRADDAETAQRWIEA 90
|
FGD5 regulates promotes angiogenesis of vascular endothelial growth factor (VEGF) in vascular endothelial cells, including network formation, permeability, directional movement, and proliferation. The specific function of FGD6 is unknown. In general, FGDs have a RhoGEF (DH) domain, followed by a PH domain, a FYVE domain and a C-terminal PH domain. All FGDs are guanine nucleotide exchange factors that activate the Rho GTPase Cdc42, an important regulator of membrane trafficking. The RhoGEF domain is responsible for GEF catalytic activity, while the PH domain is involved in intracellular targeting of the DH domain. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 90 |
| >gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|216454 pfam01363, FYVE, FYVE zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|214499 smart00064, FYVE, Protein present in Fab1, YOTB, Vac1, and EEA1 | Back alignment and domain information |
|---|
| >gnl|CDD|238022 cd00065, FYVE, FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241540 cd13389, PH1_FGD5_FGD6, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins 5 and 6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241291 cd01260, PH_CNK_mammalian-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|241390 cd13236, PH2_FGD1-4, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia proteins pleckstrin homology (PH) domain, C-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|241389 cd13235, PH2_FARP1-like, FERM, RhoGEF and pleckstrin domain-containing protein 1 and related proteins Pleckstrin Homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241435 cd13281, PH_PLEKHD1, Pleckstrin homology (PH) domain containing, family D (with coiled-coil domains) member 1 PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241480 cd13326, PH_CNK_insect-like, Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241453 cd13299, PH2_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241530 cd13379, PH_RhoGap24, Rho GTPase activating protein 24 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241290 cd01259, PH_APBB1IP, Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for Phosphoinositides-1-like Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241460 cd13306, PH1_AFAP, Actin filament associated protein family Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241284 cd01253, PH_ARHGAP21-like, ARHGAP21 and related proteins pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241270 cd01237, PH_fermitin, Fermitin family pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241426 cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bisphosphate 4-phosphatase and Type II inositol 3,4-bisphosphate 4-phosphatase Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241392 cd13238, PH2_FGD4_insect-like, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia protein 4 pleckstrin homology (PH) domain, C-terminus, in insect and related arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241421 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D subfamily Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241414 cd13260, PH_RASA1, RAS p21 protein activator (GTPase activating protein) 1 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241253 cd01218, PH_Phafin2-like, Phafin2 (also called EAPF, FLJ13187, ZFYVE18 or PLEKHF2) Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241451 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin homology (PH) domain, repeat 3 | Back alignment and domain information |
|---|
| >gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241254 cd01219, PH1_FGD1, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia protein 1 pleckstrin homology (PH), N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|241538 cd13387, PH1_FGD3, FYVE, RhoGEF and PH domain containing/faciogenital dysplasia protein 3 pleckstrin homology (PH), N-terminal domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 305 | |||
| KOG4424|consensus | 623 | 99.97 | ||
| KOG1729|consensus | 288 | 99.94 | ||
| KOG1117|consensus | 1186 | 99.87 | ||
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 99.82 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 99.8 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 99.79 | |
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 99.78 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 99.76 | |
| PF01363 | 69 | FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f | 99.76 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 99.75 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 99.75 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 99.73 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 99.72 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 99.72 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 99.71 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 99.7 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 99.68 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 99.68 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 99.67 | |
| smart00064 | 68 | FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | 99.67 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 99.66 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 99.63 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 99.61 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 99.6 | |
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 99.59 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 99.58 | |
| KOG0930|consensus | 395 | 99.57 | ||
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 99.54 | |
| KOG1818|consensus | 634 | 99.5 | ||
| PTZ00303 | 1374 | phosphatidylinositol kinase; Provisional | 99.48 | |
| KOG1819|consensus | 990 | 99.47 | ||
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 99.45 | |
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 99.44 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 99.44 | |
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 99.42 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 99.41 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 99.39 | |
| cd00065 | 57 | FYVE FYVE domain; Zinc-binding domain; targets pro | 99.37 | |
| KOG1841|consensus | 1287 | 99.37 | ||
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 99.34 | |
| cd01234 | 117 | PH_CADPS CADPS (Ca2+-dependent activator protein) | 99.33 | |
| KOG3531|consensus | 1036 | 99.33 | ||
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 99.32 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 99.31 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 99.25 | |
| KOG1090|consensus | 1732 | 99.19 | ||
| KOG1842|consensus | 505 | 99.1 | ||
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 99.08 | |
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 99.07 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 99.04 | |
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 98.76 | |
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 98.75 | |
| cd01259 | 114 | PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr | 98.74 | |
| KOG1843|consensus | 473 | 98.73 | ||
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 98.71 | |
| cd01249 | 104 | PH_oligophrenin Oligophrenin Pleckstrin homology ( | 98.57 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 98.53 | |
| cd01261 | 112 | PH_SOS Son of Sevenless (SOS) Pleckstrin homology | 98.51 | |
| KOG0690|consensus | 516 | 98.49 | ||
| cd01239 | 117 | PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom | 98.49 | |
| cd01226 | 100 | PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin | 98.47 | |
| cd01261 | 112 | PH_SOS Son of Sevenless (SOS) Pleckstrin homology | 98.46 | |
| KOG3640|consensus | 1116 | 98.43 | ||
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 98.39 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 98.32 | |
| KOG1409|consensus | 404 | 98.31 | ||
| KOG0521|consensus | 785 | 98.27 | ||
| KOG2059|consensus | 800 | 98.26 | ||
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 98.21 | |
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 98.19 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 98.17 | |
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 98.16 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 98.14 | |
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 98.13 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 98.07 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 98.03 | |
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 98.0 | |
| KOG3751|consensus | 622 | 97.96 | ||
| KOG0705|consensus | 749 | 97.96 | ||
| KOG0932|consensus | 774 | 97.95 | ||
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 97.92 | |
| KOG0521|consensus | 785 | 97.91 | ||
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 97.86 | |
| KOG3543|consensus | 1218 | 97.85 | ||
| cd01224 | 109 | PH_Collybistin Collybistin pleckstrin homology (PH | 97.85 | |
| cd01240 | 116 | PH_beta-ARK Beta adrenergic receptor kinase 1(beta | 97.84 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 97.81 | |
| cd01226 | 100 | PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin | 97.79 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 97.78 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 97.78 | |
| PLN02866 | 1068 | phospholipase D | 97.78 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 97.74 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 97.74 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 97.73 | |
| cd01225 | 111 | PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- | 97.65 | |
| cd01249 | 104 | PH_oligophrenin Oligophrenin Pleckstrin homology ( | 97.61 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 97.59 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 97.56 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 97.55 | |
| KOG0248|consensus | 936 | 97.53 | ||
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 97.5 | |
| cd01231 | 107 | PH_Lnk LNK-family Pleckstrin homology (PH) domain. | 97.42 | |
| KOG1811|consensus | 1141 | 97.39 | ||
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 97.28 | |
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 97.26 | |
| PF02318 | 118 | FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 | 97.22 | |
| cd01228 | 96 | PH_BCR-related BCR (breakpoint cluster region)-rel | 97.22 | |
| KOG0230|consensus | 1598 | 97.19 | ||
| cd01262 | 89 | PH_PDK1 3-Phosphoinositide dependent protein kinas | 97.16 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 97.15 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 97.14 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 97.14 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 97.11 | |
| cd01223 | 116 | PH_Vav Vav pleckstrin homology (PH) domain. Vav pl | 97.09 | |
| KOG1117|consensus | 1186 | 97.08 | ||
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 97.07 | |
| PF15408 | 104 | PH_7: Pleckstrin homology domain | 96.96 | |
| KOG1739|consensus | 611 | 96.93 | ||
| cd01224 | 109 | PH_Collybistin Collybistin pleckstrin homology (PH | 96.89 | |
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 96.87 | |
| cd01221 | 125 | PH_ephexin Ephexin Pleckstrin homology (PH) domain | 96.87 | |
| cd01223 | 116 | PH_Vav Vav pleckstrin homology (PH) domain. Vav pl | 96.86 | |
| PF15406 | 112 | PH_6: Pleckstrin homology domain | 96.83 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 96.75 | |
| cd01228 | 96 | PH_BCR-related BCR (breakpoint cluster region)-rel | 96.68 | |
| KOG1738|consensus | 638 | 96.64 | ||
| cd01232 | 114 | PH_TRIO Trio pleckstrin homology (PH) domain. Trio | 96.57 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 96.53 | |
| PF12814 | 123 | Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin | 96.45 | |
| cd01221 | 125 | PH_ephexin Ephexin Pleckstrin homology (PH) domain | 96.41 | |
| KOG4236|consensus | 888 | 96.4 | ||
| PF15404 | 185 | PH_4: Pleckstrin homology domain | 96.38 | |
| KOG1451|consensus | 812 | 96.3 | ||
| KOG0930|consensus | 395 | 96.29 | ||
| KOG3723|consensus | 851 | 96.2 | ||
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 96.14 | |
| KOG1841|consensus | 1287 | 95.82 | ||
| KOG3727|consensus | 664 | 95.53 | ||
| KOG0703|consensus | 287 | 95.49 | ||
| KOG3549|consensus | 505 | 95.46 | ||
| KOG0230|consensus | 1598 | 95.23 | ||
| KOG0248|consensus | 936 | 95.17 | ||
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 94.93 | |
| cd01232 | 114 | PH_TRIO Trio pleckstrin homology (PH) domain. Trio | 94.65 | |
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 94.62 | |
| cd01225 | 111 | PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- | 94.58 | |
| COG5347 | 319 | GTPase-activating protein that regulates ARFs (ADP | 94.56 | |
| KOG3551|consensus | 506 | 94.53 | ||
| cd01227 | 133 | PH_Dbs Dbs (DBL's big sister) pleckstrin homology | 94.5 | |
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 94.12 | |
| cd01248 | 115 | PH_PLC Phospholipase C (PLC) pleckstrin homology ( | 93.68 | |
| PF12814 | 123 | Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin | 93.52 | |
| KOG4424|consensus | 623 | 93.52 | ||
| PF15405 | 135 | PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. | 93.52 | |
| smart00105 | 112 | ArfGap Putative GTP-ase activating proteins for th | 93.32 | |
| PF15405 | 135 | PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. | 93.22 | |
| cd01255 | 160 | PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM | 93.15 | |
| PF01412 | 116 | ArfGap: Putative GTPase activating protein for Arf | 93.13 | |
| cd01231 | 107 | PH_Lnk LNK-family Pleckstrin homology (PH) domain. | 93.08 | |
| PF15406 | 112 | PH_6: Pleckstrin homology domain | 92.83 | |
| KOG0690|consensus | 516 | 92.82 | ||
| KOG0932|consensus | 774 | 92.76 | ||
| PLN03119 | 648 | putative ADP-ribosylation factor GTPase-activating | 92.26 | |
| KOG1737|consensus | 799 | 92.23 | ||
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 92.16 | |
| PLN03131 | 705 | hypothetical protein; Provisional | 90.65 | |
| PF08458 | 110 | PH_2: Plant pleckstrin homology-like region; Inter | 90.64 | |
| KOG2070|consensus | 661 | 90.48 | ||
| cd01262 | 89 | PH_PDK1 3-Phosphoinositide dependent protein kinas | 90.15 | |
| KOG1729|consensus | 288 | 90.02 | ||
| PLN03114 | 395 | ADP-ribosylation factor GTPase-activating protein | 88.58 | |
| KOG4407|consensus | 1973 | 88.55 | ||
| KOG4807|consensus | 593 | 87.51 | ||
| KOG0704|consensus | 386 | 87.25 | ||
| PRK00464 | 154 | nrdR transcriptional regulator NrdR; Validated | 85.64 | |
| cd01227 | 133 | PH_Dbs Dbs (DBL's big sister) pleckstrin homology | 85.58 | |
| KOG2059|consensus | 800 | 85.36 | ||
| KOG0517|consensus | 2473 | 84.96 | ||
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 83.95 | |
| PF07975 | 51 | C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al | 83.86 | |
| KOG2996|consensus | 865 | 83.66 | ||
| KOG1264|consensus | 1267 | 83.51 | ||
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 82.53 | |
| KOG0706|consensus | 454 | 80.51 |
| >KOG4424|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=2e-31 Score=245.55 Aligned_cols=255 Identities=30% Similarity=0.487 Sum_probs=205.8
Q ss_pred CeeecCCCcCCCceEEEEEeceEEEEEeCCHHHHHHHHHHHHHHHHHHHhccccccccccccc------CCCcccCcCCC
Q psy2207 1 MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRSLTQ------SSIPELNLGKV 74 (305)
Q Consensus 1 m~v~~~~~~~~~~~f~i~~~~ksf~~~a~s~~ek~~W~~~i~~ai~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~ 74 (305)
|+|+..++.++++.|.|.+++|+..|+|.|++|+++|+++|+++|+.+.+...+|........ +......++..
T Consensus 325 ~~v~~~~~~~~~~tF~~~G~~r~vel~a~t~~ek~eWv~~I~~~Id~~kq~~eTfr~~s~t~~~~~d~~s~~~~~~l~~r 404 (623)
T KOG4424|consen 325 MQVQEDDNEELPHTFILTGKKRGVELQARTEQEKKEWVQAIQDAIDKHKQCRETFRKDSRTPISDNDMKSFSSDYVLGKR 404 (623)
T ss_pred chhcccccccCCceEEEecccceEEeecCchhhHHHHHHHHHHHHHHHHHHHHHHHhccCCchhhccccccccccccccc
Confidence 789999999999999999999999999999999999999999999999999999876542211 22334444443
Q ss_pred ---CCeeeecCCCccccccccccc-ccccccccccccceeccCccCCeecccCCCCccccccHhhHHHHHhccCCCcchh
Q psy2207 75 ---APLWIPDSRVSMCQRCTSVFT-VTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLVQEFDDEDSNM 150 (305)
Q Consensus 75 ---~p~w~~d~~~~~C~~C~~~f~-~~~rrhhCr~cg~v~C~~Cs~~~~~l~~~~~~~~rvC~~C~~~~~~~~~~~~~~~ 150 (305)
+|.| +.++++|+.|..+|+ .+.|||||+.||.++|+.|+.+...+.+++++..|||..||....+....+
T Consensus 405 ~~~~~r~--~~k~~~c~~c~e~~~s~t~~R~~~k~~~~vlc~~cs~~~~~l~~~~s~ssrv~~~~~~~~~~a~~s~---- 478 (623)
T KOG4424|consen 405 KRKAPRR--DNKVTSCDSCEETFNSITFRRHRCKAKGAVLCDKCSDFMAKLSYDNSRSSRVCMDRYLTPSGAPGSP---- 478 (623)
T ss_pred cccCccc--ccccccchhhcCchhhHHHhhhhhhhccceeeccccchhhhhcccccchhhhhhhhccCCCCCCCCc----
Confidence 6777 888999999999998 688999999999999999999999999999999999999988665431111
Q ss_pred hhhhhhccccccccccccceeeecCCccccCCCCcccCCCcccccccccccccccCCCCCceeeeeeecc--CCCceEEE
Q psy2207 151 FERVKAVANVEDNHQVTNMMDIIRSNFKEMGTAGRRKPSKKYRKYVPQRLIEVTANDSGSQHSGWLHKKS--GRNWKRYW 228 (305)
Q Consensus 151 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~L~~~~--~~~wkrrw 228 (305)
+ ++. .+...+..+...++..++++|.+.. ++.|...|
T Consensus 479 ----------------------------------~--~rr-----~~~l~~~~a~~s~~~~~~s~l~~~~~~~~~g~~a~ 517 (623)
T KOG4424|consen 479 ----------------------------------P--KRR-----QSILEIELATVSKENVICSHLKYMEAAGKTGILAW 517 (623)
T ss_pred ----------------------------------h--hcc-----cccccccccccCCCceehhhHHHHhhcCccceeee
Confidence 0 111 2334455555556667888776655 78999999
Q ss_pred EEEE---CCEEEEEccCccCccceEEEecCeEEEEcccc--CCcceeEEEEeCCceeEEEEcCCHHHHHHHHHHHHHHHc
Q psy2207 229 FVLK---DQVMYKYKASEDIKALLSIPVLGYELEALNEQ--DNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREATT 303 (305)
Q Consensus 229 ~vL~---~~~L~~y~~~~d~~p~~~i~L~~~~v~~~~~~--~~~~~~F~l~~~~~~~~~f~a~s~e~~~~Wi~al~~a~~ 303 (305)
+++. +.++|.|.+++|..+...|||.|+.|.+++.. .+..++|.++ .....|+|.|+|++..++|++.|-.|+.
T Consensus 518 ~~vP~~d~~~~~~Yg~~qDv~a~~~iPl~~~~v~~pe~~~~~D~~~~~k~~-~s~~~~~~~a~~~q~qq~wl~~l~~A~~ 596 (623)
T KOG4424|consen 518 SVVPKSDPLVDYSYGSPQDVRAQATIPLPGVEVTIPEFVRREDLFHVFKLV-QSHLSWHLAADDEQLQQRWLEVLLLAVS 596 (623)
T ss_pred eeccCCCCccccccCCccccccccccccCccccCCCcccccchhcchhhhh-hhcceeeeccCCHHHHHHHHHHHHhhhc
Confidence 9984 57999999999999999999999999854422 2344778876 4555799999999999999999988763
|
|
| >KOG1729|consensus | Back alignment and domain information |
|---|
| >KOG1117|consensus | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0930|consensus | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1818|consensus | Back alignment and domain information |
|---|
| >PTZ00303 phosphatidylinositol kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1819|consensus | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; | Back alignment and domain information |
|---|
| >KOG1841|consensus | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3531|consensus | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >KOG1090|consensus | Back alignment and domain information |
|---|
| >KOG1842|consensus | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1843|consensus | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3640|consensus | Back alignment and domain information |
|---|
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1409|consensus | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
| >KOG3751|consensus | Back alignment and domain information |
|---|
| >KOG0705|consensus | Back alignment and domain information |
|---|
| >KOG0932|consensus | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3543|consensus | Back alignment and domain information |
|---|
| >cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PLN02866 phospholipase D | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >KOG0248|consensus | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1811|consensus | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >PF02318 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A | Back alignment and domain information |
|---|
| >cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0230|consensus | Back alignment and domain information |
|---|
| >cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01223 PH_Vav Vav pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1117|consensus | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PF15408 PH_7: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG1739|consensus | Back alignment and domain information |
|---|
| >cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01223 PH_Vav Vav pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15406 PH_6: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1738|consensus | Back alignment and domain information |
|---|
| >cd01232 PH_TRIO Trio pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis | Back alignment and domain information |
|---|
| >cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG4236|consensus | Back alignment and domain information |
|---|
| >PF15404 PH_4: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >KOG0930|consensus | Back alignment and domain information |
|---|
| >KOG3723|consensus | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1841|consensus | Back alignment and domain information |
|---|
| >KOG3727|consensus | Back alignment and domain information |
|---|
| >KOG0703|consensus | Back alignment and domain information |
|---|
| >KOG3549|consensus | Back alignment and domain information |
|---|
| >KOG0230|consensus | Back alignment and domain information |
|---|
| >KOG0248|consensus | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01232 PH_TRIO Trio pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3551|consensus | Back alignment and domain information |
|---|
| >cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis | Back alignment and domain information |
|---|
| >KOG4424|consensus | Back alignment and domain information |
|---|
| >PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A | Back alignment and domain information |
|---|
| >smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF | Back alignment and domain information |
|---|
| >PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A | Back alignment and domain information |
|---|
| >cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] | Back alignment and domain information |
|---|
| >cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15406 PH_6: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >KOG0932|consensus | Back alignment and domain information |
|---|
| >PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional | Back alignment and domain information |
|---|
| >KOG1737|consensus | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >PLN03131 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1729|consensus | Back alignment and domain information |
|---|
| >PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional | Back alignment and domain information |
|---|
| >KOG4407|consensus | Back alignment and domain information |
|---|
| >KOG4807|consensus | Back alignment and domain information |
|---|
| >KOG0704|consensus | Back alignment and domain information |
|---|
| >PRK00464 nrdR transcriptional regulator NrdR; Validated | Back alignment and domain information |
|---|
| >cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >KOG0517|consensus | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0706|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 305 | ||||
| 3mpx_A | 434 | Crystal Structure Of The Dh And Ph-1 Domains Of Hum | 1e-15 | ||
| 1wgq_A | 109 | Solution Structure Of The Pleckstrin Homology Domai | 2e-15 | ||
| 3t7l_A | 90 | Crystal Structure Of The Fyve Domain Of Endofin (Zf | 1e-12 | ||
| 2yry_A | 122 | Solution Structure Of The Ph Domain Of Pleckstrin H | 1e-10 | ||
| 2d9y_A | 117 | Solution Structure Of The Ph Domain Of Pepp-3 From | 1e-10 | ||
| 1z2q_A | 84 | High-Resolution Solution Structure Of The Lm5-1 Fyv | 5e-10 | ||
| 3zyq_A | 226 | Crystal Structure Of The Tandem Vhs And Fyve Domain | 5e-09 | ||
| 1dvp_A | 220 | Crystal Structure Of The Vhs And Fyve Tandem Domain | 7e-09 | ||
| 1joc_A | 125 | Eea1 Homodimer Of C-Terminal Fyve Domain Bound To I | 9e-09 | ||
| 2yqm_A | 89 | Solution Structure Of The Fyve Domain In Zinc Finge | 2e-08 | ||
| 2dkp_A | 128 | Solution Structure Of The Ph Domain Of Pleckstrin H | 5e-08 | ||
| 2yw8_A | 82 | Crystal Structure Of Human Run And Fyve Domain-Cont | 9e-08 | ||
| 1hyi_A | 65 | Solution Structure Of The Eea1 Fyve Domain Complexe | 2e-07 | ||
| 1upq_A | 123 | Crystal Structure Of The Pleckstrin Homology (Ph) D | 3e-07 | ||
| 1v89_A | 118 | Solution Structure Of The Pleckstrin Homology Domai | 7e-07 | ||
| 1vfy_A | 73 | Phosphatidylinositol-3-Phosphate Binding Fyve Domai | 9e-05 |
| >pdb|3MPX|A Chain A, Crystal Structure Of The Dh And Ph-1 Domains Of Human Fgd5 Length = 434 | Back alignment and structure |
|
| >pdb|1WGQ|A Chain A, Solution Structure Of The Pleckstrin Homology Domain Of Mouse Ethanol Decreased 4 Protein Length = 109 | Back alignment and structure |
| >pdb|3T7L|A Chain A, Crystal Structure Of The Fyve Domain Of Endofin (Zfyve16) At 1.1a Resolution Length = 90 | Back alignment and structure |
| >pdb|2YRY|A Chain A, Solution Structure Of The Ph Domain Of Pleckstrin Homology Domain-Containing Family A Member 6 From Human Length = 122 | Back alignment and structure |
| >pdb|2D9Y|A Chain A, Solution Structure Of The Ph Domain Of Pepp-3 From Human Length = 117 | Back alignment and structure |
| >pdb|1Z2Q|A Chain A, High-Resolution Solution Structure Of The Lm5-1 Fyve Domain From Leishmania Major Length = 84 | Back alignment and structure |
| >pdb|3ZYQ|A Chain A, Crystal Structure Of The Tandem Vhs And Fyve Domains Of Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) At 1.48 A Resolution Length = 226 | Back alignment and structure |
| >pdb|1DVP|A Chain A, Crystal Structure Of The Vhs And Fyve Tandem Domains Of Hrs, A Protein Involved In Membrane Trafficking And Signal Transduction Length = 220 | Back alignment and structure |
| >pdb|1JOC|A Chain A, Eea1 Homodimer Of C-Terminal Fyve Domain Bound To Inositol 1,3-Diphosphate Length = 125 | Back alignment and structure |
| >pdb|2YQM|A Chain A, Solution Structure Of The Fyve Domain In Zinc Finger Fyve Domain-Containing Protein 12 Length = 89 | Back alignment and structure |
| >pdb|2DKP|A Chain A, Solution Structure Of The Ph Domain Of Pleckstrin Homology Domain-Containing Protein Family A Member 5 From Human Length = 128 | Back alignment and structure |
| >pdb|2YW8|A Chain A, Crystal Structure Of Human Run And Fyve Domain-Containing Protein Length = 82 | Back alignment and structure |
| >pdb|1HYI|A Chain A, Solution Structure Of The Eea1 Fyve Domain Complexed With Inositol 1,3-Bisphosphate Length = 65 | Back alignment and structure |
| >pdb|1UPQ|A Chain A, Crystal Structure Of The Pleckstrin Homology (Ph) Domain Of Pepp1 Length = 123 | Back alignment and structure |
| >pdb|1V89|A Chain A, Solution Structure Of The Pleckstrin Homology Domain Of Human Kiaa0053 Protein Length = 118 | Back alignment and structure |
| >pdb|1VFY|A Chain A, Phosphatidylinositol-3-Phosphate Binding Fyve Domain Of Vps27p Protein From Saccharomyces Cerevisiae Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 305 | |||
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 5e-37 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 3e-33 | |
| 3t7l_A | 90 | Zinc finger FYVE domain-containing protein 16; str | 2e-30 | |
| 2yw8_A | 82 | RUN and FYVE domain-containing protein 1; structur | 1e-28 | |
| 1z2q_A | 84 | LM5-1; membrane protein, FYVE domain, zinc-finger; | 2e-27 | |
| 1joc_A | 125 | EEA1, early endosomal autoantigen 1; FYVE domain, | 2e-26 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 2e-26 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 3e-26 | |
| 1wfk_A | 88 | Zinc finger, FYVE domain containing 19; riken stru | 9e-26 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 3e-25 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 3e-25 | |
| 1x4u_A | 84 | Zinc finger, FYVE domain containing 27 isoform B; | 1e-24 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 2e-24 | |
| 1vfy_A | 73 | Phosphatidylinositol-3-phosphate binding FYVE doma | 7e-23 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 9e-23 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 1e-22 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 1e-20 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 1e-20 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 2e-20 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 8e-20 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 1e-19 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 5e-19 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 4e-18 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 2e-17 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 7e-04 | |
| 3zyq_A | 226 | Hepatocyte growth factor-regulated tyrosine kinas | 3e-17 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 4e-17 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 3e-04 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 5e-17 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 4e-05 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 7e-17 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 1e-05 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 7e-17 | |
| 1dvp_A | 220 | HRS, hepatocyte growth factor-regulated tyrosine k | 1e-16 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 1e-16 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 3e-06 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 1e-16 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 2e-05 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 1e-16 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 3e-05 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 2e-16 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 8e-16 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 8e-06 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 8e-16 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 1e-05 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 3e-15 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 3e-15 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 2e-06 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 4e-15 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 2e-05 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 9e-15 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 1e-14 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 4e-04 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 1e-14 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 2e-14 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 8e-04 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 4e-14 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 5e-14 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 5e-14 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 5e-14 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 7e-14 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 1e-13 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 8e-06 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 2e-13 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 2e-13 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 2e-13 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 4e-13 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 1e-04 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 4e-13 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 9e-13 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 1e-12 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 7e-12 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 7e-12 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 8e-12 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 1e-04 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 1e-11 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 2e-11 | |
| 1y02_A | 120 | CARP2, FYVE-ring finger protein sakura; zinc-bindi | 2e-11 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 3e-11 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 8e-06 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 6e-09 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 7e-09 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 2e-08 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 4e-08 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 3e-04 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 1e-07 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 9e-04 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 2e-07 | |
| 2zet_C | 153 | Melanophilin; complex, GTP-binding protein, GTPase | 2e-07 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 3e-07 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 4e-07 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 4e-07 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 2e-06 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 4e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 6e-06 | |
| 1kz7_A | 353 | Guanine nucleotide exchange factor DBS; guanine nu | 7e-05 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 8e-05 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 9e-05 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 1e-04 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 1e-04 |
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 | Back alignment and structure |
|---|
Score = 135 bits (342), Expect = 5e-37
Identities = 47/142 (33%), Positives = 66/142 (46%)
Query: 1 MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRS 60
MKV P E + L A S ER EW + A+ E+ + S
Sbjct: 292 MKVSRPVMEKVPYALKIETSESCLMLSASSCAERDEWYGCLSRALPEDYKAQALAAFHHS 351
Query: 61 LTQSSIPELNLGKVAPLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAP 120
+ ++LG+ P +P + V MC C F++T RRHHC ACGK+VC CS P
Sbjct: 352 VEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLRRHHCHACGKIVCRNCSRNKYP 411
Query: 121 LEYKKFRNFRVCEECYHYLVQE 142
L+Y K R +VC+ C+ L +
Sbjct: 412 LKYLKDRMAKVCDGCFGELKKR 433
|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Length = 82 | Back alignment and structure |
|---|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Length = 84 | Back alignment and structure |
|---|
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Length = 125 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Length = 88 | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Length = 73 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Length = 226 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 | Back alignment and structure |
|---|
| >1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Length = 220 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Length = 173 | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 | Back alignment and structure |
|---|
| >1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Length = 120 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 132 | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 132 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Length = 124 | Back alignment and structure |
|---|
| >2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} Length = 153 | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Length = 113 | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Length = 256 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Length = 353 | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Length = 117 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 305 | |||
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 99.94 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 99.88 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 99.88 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 99.87 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 99.86 | |
| 1z2q_A | 84 | LM5-1; membrane protein, FYVE domain, zinc-finger; | 99.84 | |
| 1x4u_A | 84 | Zinc finger, FYVE domain containing 27 isoform B; | 99.84 | |
| 3t7l_A | 90 | Zinc finger FYVE domain-containing protein 16; str | 99.84 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 99.83 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.83 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 99.83 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 99.82 | |
| 2yw8_A | 82 | RUN and FYVE domain-containing protein 1; structur | 99.82 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 99.82 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 99.82 | |
| 1joc_A | 125 | EEA1, early endosomal autoantigen 1; FYVE domain, | 99.81 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 99.81 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 99.81 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 99.8 | |
| 1vfy_A | 73 | Phosphatidylinositol-3-phosphate binding FYVE doma | 99.8 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 99.8 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 99.8 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 99.8 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 99.8 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.8 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 99.79 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 99.79 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 99.79 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 99.78 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 99.78 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 99.78 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 99.78 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 99.78 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 99.77 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.77 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 99.77 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 99.77 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 99.77 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 99.77 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 99.77 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 99.77 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 99.77 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 99.76 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 99.76 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 99.75 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 99.75 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 99.75 | |
| 3zyq_A | 226 | Hepatocyte growth factor-regulated tyrosine kinas | 99.75 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 99.74 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 99.74 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 99.74 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 99.74 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 99.74 | |
| 1dvp_A | 220 | HRS, hepatocyte growth factor-regulated tyrosine k | 99.74 | |
| 1wfk_A | 88 | Zinc finger, FYVE domain containing 19; riken stru | 99.74 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 99.73 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 99.73 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 99.72 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 99.72 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 99.72 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 99.71 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 99.7 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 99.7 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 99.68 | |
| 1y02_A | 120 | CARP2, FYVE-ring finger protein sakura; zinc-bindi | 99.67 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 99.66 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 99.66 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 99.65 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 99.64 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 99.63 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 99.62 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.58 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 99.57 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 99.53 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 99.49 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 99.48 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 99.35 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 99.33 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 99.31 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.23 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 99.19 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 99.12 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 98.92 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 98.83 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 98.54 | |
| 1v5m_A | 136 | SH2 and PH domain-containing adapter protein APS; | 98.42 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 98.4 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 98.36 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 98.35 | |
| 3qwm_A | 140 | Iqsec1, IQ motif and SEC7 domain-containing protei | 98.33 | |
| 3ml4_A | 224 | Protein DOK-7; tyrosine phosphorylation, adapter p | 98.32 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 98.32 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 98.27 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 98.2 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 98.2 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 98.16 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 98.14 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 98.12 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 98.11 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 98.11 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 98.1 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 98.09 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 98.06 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 98.05 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 98.04 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 98.03 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 98.02 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 98.02 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 98.02 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 98.01 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 98.01 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 97.99 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 97.98 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 97.96 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 97.93 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 97.93 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 97.93 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 97.92 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 97.9 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 97.9 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 97.89 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 97.89 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 97.88 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 97.87 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 97.85 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 97.83 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 97.81 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 97.78 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 97.77 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 97.76 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 97.75 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 97.75 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 97.73 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 97.69 | |
| 3qwm_A | 140 | Iqsec1, IQ motif and SEC7 domain-containing protei | 97.69 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 97.68 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 97.68 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 97.64 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 97.62 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 97.62 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 97.61 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 97.52 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 97.44 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 97.37 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 97.37 | |
| 2lg1_A | 185 | A-kinase anchor protein 13; metal binding protein; | 97.36 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 97.34 | |
| 1mai_A | 131 | Phospholipase C delta-1; pleckstrin, inositol tris | 97.29 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 97.1 | |
| 3t06_A | 418 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 97.08 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 97.06 | |
| 1zbd_B | 134 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 97.06 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 97.05 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 97.05 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 97.02 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 96.91 | |
| 1xcg_A | 368 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 96.88 | |
| 3odw_A | 536 | RHO guanine nucleotide exchange factor 1; regulati | 96.74 | |
| 3p6a_A | 377 | RHO guanine nucleotide exchange factor 1; regulati | 96.67 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 96.63 | |
| 1txd_A | 385 | RHO guanine nucleotide exchange factor 12; helical | 96.61 | |
| 2z0q_A | 346 | XPLN, RHO guanine nucleotide exchange factor 3; DH | 96.51 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 96.51 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 96.47 | |
| 1kz7_A | 353 | Guanine nucleotide exchange factor DBS; guanine nu | 96.47 | |
| 2zet_C | 153 | Melanophilin; complex, GTP-binding protein, GTPase | 96.46 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 96.45 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 96.35 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 96.2 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 96.03 | |
| 2rgn_B | 354 | RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p | 96.01 | |
| 1txd_A | 385 | RHO guanine nucleotide exchange factor 12; helical | 95.97 | |
| 1nty_A | 311 | Triple functional domain protein; DBL, pleckstrin, | 95.93 | |
| 1v5m_A | 136 | SH2 and PH domain-containing adapter protein APS; | 95.78 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 95.72 | |
| 2rgn_B | 354 | RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p | 95.62 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 95.61 | |
| 1kz7_A | 353 | Guanine nucleotide exchange factor DBS; guanine nu | 95.57 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 95.43 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 95.43 | |
| 1foe_A | 377 | T-lymphoma invasion and metastasis inducing protei | 94.57 | |
| 2owa_A | 138 | Arfgap-like finger domain containing protein; zinc | 94.34 | |
| 2olm_A | 140 | Nucleoporin-like protein RIP; arfgap, GTPase-activ | 94.3 | |
| 2iqj_A | 134 | Stromal membrane-associated protein 1-like; zinc, | 94.25 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 94.21 | |
| 2crw_A | 149 | ARF GAP 3, ADP-ribosylation factor GTPase-activati | 93.9 | |
| 3sub_A | 163 | ADP-ribosylation factor GTPase-activating protein; | 93.77 | |
| 2crr_A | 141 | Stromal membrane-associated protein SMAP1B; arfgap | 93.7 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 93.51 | |
| 2csz_A | 76 | Synaptotagmin-like protein 4; exophilin 2, granuph | 93.06 | |
| 3dwd_A | 147 | ADP-ribosylation factor GTPase-activating protein; | 92.93 | |
| 2p57_A | 144 | GTPase-activating protein ZNF289; zinc finger, GAP | 92.88 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 92.73 | |
| 2adz_A | 178 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 91.79 | |
| 1mai_A | 131 | Phospholipase C delta-1; pleckstrin, inositol tris | 90.46 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 90.05 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 89.75 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 89.37 | |
| 1wff_A | 85 | Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc | 89.14 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 88.74 | |
| 1wfh_A | 64 | Zinc finger (AN1-like) family protein; ZF-AN1 doma | 88.66 | |
| 1wfl_A | 74 | Zinc finger protein 216; ZF-AN1 domain, zinc bindi | 88.51 | |
| 1wfp_A | 74 | Zinc finger (AN1-like) family protein; ZF-AN1 doma | 87.45 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 86.95 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 86.43 | |
| 1fho_A | 119 | UNC-89; pleckstrin homology domain, electrostatics | 86.34 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 84.66 | |
| 1wg2_A | 64 | Zinc finger (AN1-like) family protein; riken struc | 84.35 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 84.11 | |
| 2a20_A | 62 | Regulating synaptic membrane exocytosis protein 2; | 83.65 | |
| 3a98_B | 203 | Engulfment and cell motility protein 1; protein-pr | 82.94 | |
| 1fho_A | 119 | UNC-89; pleckstrin homology domain, electrostatics | 82.54 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 82.4 |
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.94 E-value=9.1e-28 Score=226.36 Aligned_cols=139 Identities=35% Similarity=0.637 Sum_probs=39.1
Q ss_pred CeeecCCCcCCCceEEEEEeceEEEEEeCCHHHHHHHHHHHHHHHHHHHhc--ccccccccccccCCCcccCcCCCCCee
Q psy2207 1 MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQH--LLSFLNRRSLTQSSIPELNLGKVAPLW 78 (305)
Q Consensus 1 m~v~~~~~~~~~~~f~i~~~~ksf~~~a~s~~ek~~W~~~i~~ai~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~p~w 78 (305)
|.|..+++++.+|.|.|.++.++|.|+|.|++||++|+++|+++|.+.... ..+|... .+.++......+..+|.|
T Consensus 292 l~v~~~~~~~~~~~f~i~~~~~~~~l~a~s~~ek~~W~~~i~~ai~e~~~~~~~~~f~~~--~e~~~~~~~~~~~~~p~w 369 (434)
T 3mpx_A 292 MKVSRPVMEKVPYALKIETSESCLMLSASSCAERDEWYGCLSRALPEDYKAQALAAFHHS--VEIRERLGVSLGERPPTL 369 (434)
T ss_dssp ---CCCCCTTSCSEEEEECSSCEEEEECSSHHHHHHHHHHHHHC------------------------------------
T ss_pred cEEEecCCCCCCeeEEEecCCeEEEEecCCHHHHHHHHHHHHHHHHHHHhhhcccccCCc--cchhhcccCccccCCCcC
Confidence 456677778899999999999999999999999999999999999875332 2233221 122233455677889999
Q ss_pred eecCCCcccccccccccccccccccccccceeccCccCCeecccCCCCccccccHhhHHHHHh
Q psy2207 79 IPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLVQ 141 (305)
Q Consensus 79 ~~d~~~~~C~~C~~~f~~~~rrhhCr~cg~v~C~~Cs~~~~~l~~~~~~~~rvC~~C~~~~~~ 141 (305)
+||..+..|+.|+.+|+++.|+||||+||.+||..||++++++++.+.+++|||+.||..+..
T Consensus 370 ~~~~~~~~c~~c~~~f~~~~r~h~Cr~Cg~~~C~~Cs~~~~~~~~~~~~~~rvC~~C~~~l~~ 432 (434)
T 3mpx_A 370 VPVTHVMMCMNCGCDFSLTLRRHHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCFGELKK 432 (434)
T ss_dssp ---------------------------------------------------------------
T ss_pred CCcccCCcCCCcCCCCCCcchhhhcccCcCEeehhhCCCeeeCCCCCCCcCEecHHHHHHHHh
Confidence 999999999999999999999999999999999999999999998888999999999998754
|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} | Back alignment and structure |
|---|
| >1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 | Back alignment and structure |
|---|
| >1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} | Back alignment and structure |
|---|
| >3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A | Back alignment and structure |
|---|
| >2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A | Back alignment and structure |
|---|
| >2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A | Back alignment and structure |
|---|
| >2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A | Back alignment and structure |
|---|
| >1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A | Back alignment and structure |
|---|
| >2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >2csz_A Synaptotagmin-like protein 4; exophilin 2, granuphilin, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* | Back alignment and structure |
|---|
| >2a20_A Regulating synaptic membrane exocytosis protein 2; zinc-finger domain, metal binding protein; NMR {Rattus norvegicus} PDB: 2cjs_C | Back alignment and structure |
|---|
| >3a98_B Engulfment and cell motility protein 1; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} PDB: 2vsz_A | Back alignment and structure |
|---|
| >1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 305 | ||||
| d1wfka_ | 88 | g.50.1.1 (A:) Zinc finger FYVE domain containing p | 4e-18 | |
| d1joca1 | 64 | g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) | 7e-18 | |
| d1dvpa2 | 72 | g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila me | 7e-17 | |
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 2e-15 | |
| d1upqa_ | 107 | b.55.1.1 (A:) Phosphoinositol 3-phosphate binding | 7e-15 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 2e-14 | |
| d1plsa_ | 113 | b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta | 4e-14 | |
| d1v88a_ | 130 | b.55.1.1 (A:) Oxysterol binding protein-related pr | 5e-14 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 8e-14 | |
| d1vfya_ | 67 | g.50.1.1 (A:) vps27p protein {Baker's yeast (Sacch | 1e-13 | |
| d1wgqa_ | 109 | b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin | 1e-13 | |
| d2cofa1 | 95 | b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) | 2e-13 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 5e-13 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 9e-05 | |
| d1y02a2 | 51 | g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger pro | 1e-12 | |
| d1faoa_ | 100 | b.55.1.1 (A:) Dual adaptor of phosphotyrosine and | 1e-12 | |
| d1faoa_ | 100 | b.55.1.1 (A:) Dual adaptor of phosphotyrosine and | 0.001 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 2e-12 | |
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 7e-12 | |
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 0.001 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 1e-11 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 0.002 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 3e-11 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 0.001 | |
| d1zbdb_ | 124 | g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat | 5e-11 | |
| d2coca1 | 99 | b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont | 7e-11 | |
| d2coda1 | 102 | b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo | 1e-10 | |
| d2coda1 | 102 | b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo | 0.001 | |
| d1v5pa_ | 126 | b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: | 1e-10 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 1e-10 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 0.001 | |
| d1u5fa1 | 111 | b.55.1.1 (A:109-219) Src-associated adaptor protei | 2e-10 | |
| d2dyna_ | 111 | b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId | 2e-10 | |
| d2elba2 | 101 | b.55.1.1 (A:274-374) DCC-interacting protein 13-al | 3e-10 | |
| d1v5ma_ | 136 | b.55.1.1 (A:) SH2 and PH domain-containing adapter | 3e-10 | |
| d1wjma_ | 123 | b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), | 5e-10 | |
| d1wg7a_ | 150 | b.55.1.1 (A:) Dedicator of cytokinesis protein 9, | 5e-10 | |
| d1wi1a_ | 126 | b.55.1.1 (A:) Calcium-dependent activator protein | 1e-09 | |
| d1x1fa1 | 136 | b.55.1.1 (A:8-143) Signal-transducing adaptor prot | 2e-09 | |
| d2j59m1 | 133 | b.55.1.1 (M:931-1063) Rho GTPase-activating protei | 5e-09 | |
| d2fjla1 | 101 | b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph | 2e-08 | |
| d1btna_ | 106 | b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), | 2e-08 | |
| d1unqa_ | 118 | b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H | 4e-08 | |
| d1omwa2 | 119 | b.55.1.1 (A:550-668) G-protein coupled receptor ki | 7e-08 | |
| d1btka_ | 169 | b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom | 2e-07 | |
| d1btka_ | 169 | b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom | 3e-05 | |
| d1qqga1 | 103 | b.55.1.2 (A:12-114) Insulin receptor substrate 1, | 4e-07 | |
| d1w1ha_ | 147 | b.55.1.1 (A:) 3-phosphoinositide dependent protein | 5e-07 | |
| d2coaa1 | 112 | b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma | 7e-06 | |
| d1zc3b1 | 109 | b.55.1.1 (B:171-279) Exocyst complex protein EXO84 | 1e-04 | |
| d1zc3b1 | 109 | b.55.1.1 (B:171-279) Exocyst complex protein EXO84 | 4e-04 | |
| d1kz7a2 | 147 | b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse | 2e-04 | |
| d1dbha2 | 133 | b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {H | 0.002 | |
| d1xcga2 | 140 | b.55.1.1 (A:942-1081) Rho guanine nucleotide excha | 0.002 | |
| d1ki1b2 | 142 | b.55.1.1 (B:1439-1580) GEF of intersectin {Human ( | 0.003 |
| >d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: FYVE, a phosphatidylinositol-3-phosphate binding domain domain: Zinc finger FYVE domain containing protein 19 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 75.5 bits (185), Expect = 4e-18
Identities = 17/65 (26%), Positives = 29/65 (44%)
Query: 84 VSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLVQEF 143
S C C FT+ + + C+ CG+ C C + A + +VC++C+ L +
Sbjct: 9 ESRCYGCAVKFTLFKKEYGCKNCGRAFCNGCLSFSALVPRAGNTQQKVCKQCHTILTRGS 68
Query: 144 DDEDS 148
D S
Sbjct: 69 SDNAS 73
|
| >d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
| >d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 72 | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 109 | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 109 | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Length = 147 | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 305 | |||
| d1joca1 | 64 | Eea1 {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 99.82 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 99.82 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 99.81 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 99.79 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 99.79 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 99.79 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 99.78 | |
| d1dvpa2 | 72 | Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 | 99.77 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.77 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.77 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 99.77 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 99.77 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 99.76 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 99.76 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 99.74 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.73 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.73 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 99.73 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.72 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 99.72 | |
| d1vfya_ | 67 | vps27p protein {Baker's yeast (Saccharomyces cerev | 99.72 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 99.71 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 99.71 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 99.7 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 99.7 | |
| d1wfka_ | 88 | Zinc finger FYVE domain containing protein 19 {Mou | 99.7 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 99.7 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 99.69 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 99.69 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 99.69 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.67 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.67 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 99.67 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.66 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 99.65 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 99.65 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 99.64 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 99.6 | |
| d1y02a2 | 51 | Rififylin (FYVE-RING finger protein Sakura) {Human | 99.45 | |
| d1zbdb_ | 124 | Effector domain of rabphilin-3a {Rat (Rattus norve | 99.21 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 99.04 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 98.62 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 98.56 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 98.51 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 98.47 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 98.46 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 98.28 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 98.28 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 98.15 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 98.04 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 97.96 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 97.94 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 97.94 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 97.93 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 97.92 | |
| d1xcga2 | 140 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 97.91 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 97.89 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 97.87 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 97.87 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 97.83 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 97.83 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 97.83 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 97.8 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 97.77 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 97.77 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 97.75 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 97.74 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 97.71 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 97.69 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 97.65 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 97.61 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 97.6 | |
| d1xcga2 | 140 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 97.58 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 97.57 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 97.56 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 97.56 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 97.53 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 97.52 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 97.5 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 97.49 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 97.46 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 97.44 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 97.44 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 97.42 | |
| d1kz7a2 | 147 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 97.39 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 97.38 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 97.33 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 97.23 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 97.21 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 97.19 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 97.17 | |
| d1fhoa_ | 119 | UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: | 97.12 | |
| d2adza1 | 105 | Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 | 97.05 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 96.89 | |
| d1kz7a2 | 147 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 96.8 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 95.75 | |
| d1dcqa2 | 122 | Pyk2-associated protein beta ARF-GAP domain {Mouse | 95.32 | |
| d1fhoa_ | 119 | UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: | 94.96 | |
| d1foea2 | 162 | GEF of TIAM1 (T-Lymphoma invasion and metastasis i | 92.72 | |
| d1wfla_ | 74 | Zinc finger A20 domain containing protein 2 {Mouse | 91.39 | |
| d1wffa_ | 85 | ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus | 89.3 | |
| d2zkmx3 | 131 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 88.38 | |
| d1wfpa_ | 74 | Zinc finger A20 and AN1 domains containing protein | 87.64 | |
| d2adza1 | 105 | Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 | 86.71 | |
| d1wfha_ | 64 | Zinc finger A20 and AN1 domains containing protein | 85.82 |
| >d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: FYVE, a phosphatidylinositol-3-phosphate binding domain domain: Eea1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.82 E-value=1.1e-21 Score=132.29 Aligned_cols=63 Identities=40% Similarity=0.867 Sum_probs=58.8
Q ss_pred eeeecCCCcccccccccccccccccccccccceeccCccCCeecccCCCCccccccHhhHHHHH
Q psy2207 77 LWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLV 140 (305)
Q Consensus 77 ~w~~d~~~~~C~~C~~~f~~~~rrhhCr~cg~v~C~~Cs~~~~~l~~~~~~~~rvC~~C~~~~~ 140 (305)
.|+||++++.|+.|+.+|+++.||||||+||.+||+.|+.++.++|.. ..++|||+.||..|.
T Consensus 1 rW~~d~~~~~C~~C~~~F~~~~rrHHCR~CG~v~C~~Cs~~~~~~~~~-~~~~RVC~~C~~~l~ 63 (64)
T d1joca1 1 KWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSS-KKPVRVCDACFNDLQ 63 (64)
T ss_dssp CCCCGGGCCBCTTTCCBCCSSSCCEECTTTCCEECGGGSCEEECCTTC-SSCEEECHHHHHHTT
T ss_pred CCCCcccCCcCcCcCCcccCCccccchhhhCCeecccccCCceecCCC-CCccEehHHHHHHhc
Confidence 499999999999999999999999999999999999999999999864 578999999999875
|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1foea2 b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|