Psyllid ID: psy2211

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
GYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCTERSKESVKQSGCALCSPSGEI
ccccccccHHHHHHHHHHcccccccccccccccccEEEEEEccccccccEEEEcccEEEEEEccccccccccccccHHHHHHHHHHHHHccccccccccc
ccccccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEEccccccEEEEcccEEEEEEcccHHHHHccccccccHHHHHHHHHHHccccccccccc
GYPDLYEKFVLFYSRYVYRRIVDcfnrpvtsvpgaiitikdretpdygwtfkytgtestclnlasynylgfgentglcterskesvkqsgcalcspsgei
GYPDLYEKFVLFYSRYVYRRIVDCfnrpvtsvpgaiitikdretpdyGWTFKYTGTESTCLNLASYNYLGFGENTGLCTerskesvkqsgcalcspsgei
GYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCTERSKESVKQSGCALCSPSGEI
****LYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCT*********************
GYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCTERSKESVKQSGCALCSPSG**
GYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLC**********************
GYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCTERSKESVKQSGCALC******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCTERSKESVKQSGCALCSPSGEI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query100 2.2.26 [Sep-21-2011]
P97363 560 Serine palmitoyltransfera yes N/A 0.99 0.176 0.48 6e-22
O54694 560 Serine palmitoyltransfera yes N/A 0.99 0.176 0.48 2e-21
O15270 562 Serine palmitoyltransfera yes N/A 0.99 0.176 0.46 1e-20
Q9XVI6 512 Serine palmitoyltransfera yes N/A 0.78 0.152 0.512 3e-20
Q09925 603 Serine palmitoyltransfera yes N/A 0.95 0.157 0.442 6e-18
Q20375 558 Serine palmitoyltransfera no N/A 0.95 0.170 0.410 6e-18
Q9M304 489 Long chain base biosynthe yes N/A 0.84 0.171 0.488 2e-15
Q5JK39 489 Long chain base biosynthe yes N/A 0.84 0.171 0.452 6e-15
P48241 562 Serine palmitoyltransfera yes N/A 1.0 0.177 0.42 1e-14
Q9LSZ9 489 Long chain base biosynthe no N/A 0.84 0.171 0.476 1e-14
>sp|P97363|SPTC2_MOUSE Serine palmitoyltransferase 2 OS=Mus musculus GN=Sptlc2 PE=2 SV=2 Back     alignment and function desciption
 Score =  102 bits (255), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 2   YPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGT-ESTC 60
           +  LY+ F  FY+R +Y RI D +NRP+ SVPGA + I +R++ DY W+FKYTG      
Sbjct: 109 FVSLYQDFENFYTRNLYMRIRDNWNRPICSVPGAKVDIMERKSHDYNWSFKYTGNIIKGV 168

Query: 61  LNLASYNYLGFGENTGLCTERSKESVKQSGCALCSPSGEI 100
           +N+ SYNYLGF  NTG C E + E +K+ G  +CS   EI
Sbjct: 169 INMGSYNYLGFARNTGSCQEAAAEVLKEYGAGVCSTRQEI 208
Serine palmitoyltransferase (SPT). The heterodimer formed with LCB1/SPTLC1 constitutes the catalytic core. The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC2-SSSPTA complex shows a strong preference for C16-CoA substrate, while the SPTLC1-SPTLC2-SSSPTB complex displays a preference for C18-CoA substrate.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 5EC: 0
>sp|O54694|SPTC2_CRIGR Serine palmitoyltransferase 2 OS=Cricetulus griseus GN=SPTLC2 PE=2 SV=1 Back     alignment and function description
>sp|O15270|SPTC2_HUMAN Serine palmitoyltransferase 2 OS=Homo sapiens GN=SPTLC2 PE=1 SV=1 Back     alignment and function description
>sp|Q9XVI6|SPTC3_CAEEL Serine palmitoyltransferase 3 OS=Caenorhabditis elegans GN=sptl-3 PE=3 SV=2 Back     alignment and function description
>sp|Q09925|LCB2_SCHPO Serine palmitoyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcb2 PE=3 SV=1 Back     alignment and function description
>sp|Q20375|SPTC2_CAEEL Serine palmitoyltransferase 2 OS=Caenorhabditis elegans GN=sptl-2 PE=2 SV=1 Back     alignment and function description
>sp|Q9M304|LCB2B_ARATH Long chain base biosynthesis protein 2b OS=Arabidopsis thaliana GN=LCB2b PE=1 SV=1 Back     alignment and function description
>sp|Q5JK39|LCB2D_ORYSJ Long chain base biosynthesis protein 2d OS=Oryza sativa subsp. japonica GN=Os01g0928800 PE=2 SV=1 Back     alignment and function description
>sp|P48241|LCB2_KLULA Serine palmitoyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LCB2 PE=3 SV=2 Back     alignment and function description
>sp|Q9LSZ9|LCB2A_ARATH Long chain base biosynthesis protein 2a OS=Arabidopsis thaliana GN=LCB2a PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
328781094 551 PREDICTED: serine palmitoyltransferase 2 1.0 0.181 0.61 3e-30
380012527 551 PREDICTED: serine palmitoyltransferase 2 1.0 0.181 0.61 3e-30
350410144 551 PREDICTED: serine palmitoyltransferase 2 1.0 0.181 0.61 5e-30
340718879 551 PREDICTED: serine palmitoyltransferase 2 1.0 0.181 0.61 6e-30
242010917 566 serine palmitoyltransferase, putative [P 0.99 0.174 0.606 6e-30
195338605 597 GM16091 [Drosophila sechellia] gi|194129 1.0 0.167 0.63 9e-30
307188896 548 Serine palmitoyltransferase 2 [Camponotu 1.0 0.182 0.6 1e-29
195475518 599 GE21012 [Drosophila yakuba] gi|194176132 1.0 0.166 0.62 3e-29
195579404 597 GD24010 [Drosophila simulans] gi|1941915 1.0 0.167 0.62 3e-29
17136286 597 lace [Drosophila melanogaster] gi|729823 1.0 0.167 0.62 3e-29
>gi|328781094|ref|XP_394921.3| PREDICTED: serine palmitoyltransferase 2-like [Apis mellifera] Back     alignment and taxonomy information
 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 75/100 (75%)

Query: 1   GYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTC 60
           GY  LYE F  FY RYVYRR+ DC+NRP+ SVPGA +T+KDR T DYGWTF++TGT S C
Sbjct: 104 GYASLYEHFEEFYLRYVYRRVRDCWNRPICSVPGATVTLKDRITKDYGWTFQFTGTTSEC 163

Query: 61  LNLASYNYLGFGENTGLCTERSKESVKQSGCALCSPSGEI 100
           +NL SYNYLGF E  G C ++S E++K+ GCA CS   E+
Sbjct: 164 INLGSYNYLGFAEANGKCADQSIETLKKFGCASCSSRLEL 203

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380012527|ref|XP_003690331.1| PREDICTED: serine palmitoyltransferase 2-like [Apis florea] Back     alignment and taxonomy information
>gi|350410144|ref|XP_003488961.1| PREDICTED: serine palmitoyltransferase 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340718879|ref|XP_003397890.1| PREDICTED: serine palmitoyltransferase 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|242010917|ref|XP_002426204.1| serine palmitoyltransferase, putative [Pediculus humanus corporis] gi|212510255|gb|EEB13466.1| serine palmitoyltransferase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195338605|ref|XP_002035915.1| GM16091 [Drosophila sechellia] gi|194129795|gb|EDW51838.1| GM16091 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|307188896|gb|EFN73445.1| Serine palmitoyltransferase 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|195475518|ref|XP_002090031.1| GE21012 [Drosophila yakuba] gi|194176132|gb|EDW89743.1| GE21012 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195579404|ref|XP_002079552.1| GD24010 [Drosophila simulans] gi|194191561|gb|EDX05137.1| GD24010 [Drosophila simulans] Back     alignment and taxonomy information
>gi|17136286|ref|NP_476614.1| lace [Drosophila melanogaster] gi|7298232|gb|AAF53465.1| lace [Drosophila melanogaster] gi|20177045|gb|AAM12284.1| LD36009p [Drosophila melanogaster] gi|220946962|gb|ACL86024.1| lace-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
FB|FBgn0002524 597 lace "lace" [Drosophila melano 1.0 0.167 0.62 2.2e-30
MGI|MGI:108074 560 Sptlc2 "serine palmitoyltransf 0.99 0.176 0.48 9.5e-21
UNIPROTKB|F1LSV4 521 Sptlc2 "Protein Sptlc2" [Rattu 0.99 0.190 0.48 1.3e-20
RGD|1305447 560 Sptlc2 "serine palmitoyltransf 0.99 0.176 0.48 1.6e-20
UNIPROTKB|H0YJV2 407 SPTLC2 "Serine palmitoyltransf 0.99 0.243 0.46 1.8e-20
UNIPROTKB|E2RSR1 562 SPTLC2 "Uncharacterized protei 0.99 0.176 0.46 4.3e-20
UNIPROTKB|A5PKM3 562 SPTLC2 "SPTLC2 protein" [Bos t 0.99 0.176 0.46 5.5e-20
UNIPROTKB|O15270 562 SPTLC2 "Serine palmitoyltransf 0.99 0.176 0.46 5.5e-20
UNIPROTKB|G4N522 654 MGG_05197 "Serine palmitoyltra 0.96 0.146 0.479 6.1e-20
WB|WBGene00011932 512 sptl-3 [Caenorhabditis elegans 0.89 0.173 0.471 3.2e-19
FB|FBgn0002524 lace "lace" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 341 (125.1 bits), Expect = 2.2e-30, P = 2.2e-30
 Identities = 62/100 (62%), Positives = 74/100 (74%)

Query:     1 GYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTC 60
             GY  LY+ F  FYSRYVYRRI DC+NRP+ SVPG  +T+KDR T DYGW+FK+TGTE+ C
Sbjct:   156 GYVALYDAFESFYSRYVYRRIKDCWNRPICSVPGDELTLKDRVTDDYGWSFKFTGTETRC 215

Query:    61 LNLASYNYLGFGENTGLCTERSKESVKQSGCALCSPSGEI 100
             LNL SYNYLGF   TG C + S+ES + SG A CS   E+
Sbjct:   216 LNLGSYNYLGFAAATGQCADDSEESARSSGLAYCSSRCEL 255
GO:0004758 "serine C-palmitoyltransferase activity" evidence=ISS;NAS;IDA
GO:0007444 "imaginal disc development" evidence=IMP
GO:0030148 "sphingolipid biosynthetic process" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
MGI|MGI:108074 Sptlc2 "serine palmitoyltransferase, long chain base subunit 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LSV4 Sptlc2 "Protein Sptlc2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1305447 Sptlc2 "serine palmitoyltransferase, long chain base subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H0YJV2 SPTLC2 "Serine palmitoyltransferase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSR1 SPTLC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A5PKM3 SPTLC2 "SPTLC2 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O15270 SPTLC2 "Serine palmitoyltransferase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G4N522 MGG_05197 "Serine palmitoyltransferase 2" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
WB|WBGene00011932 sptl-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9XVI6SPTC3_CAEEL2, ., 3, ., 1, ., 5, 00.51280.780.1523yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
PLN02483 489 PLN02483, PLN02483, serine palmitoyltransferase 1e-24
cd06454 349 cd06454, KBL_like, KBL_like; this family belongs t 9e-04
>gnl|CDD|178101 PLN02483, PLN02483, serine palmitoyltransferase Back     alignment and domain information 
 Score = 95.6 bits (238), Expect = 1e-24
 Identities = 41/96 (42%), Positives = 50/96 (52%)

Query: 1   GYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTC 60
           GY  +      FY R +Y RI DCFNRP+ S P A   + +R + D   T K T     C
Sbjct: 43  GYAPICLGLEDFYIRRLYLRIQDCFNRPIASAPDAWFDVVERVSNDNNKTLKRTTKTRRC 102

Query: 61  LNLASYNYLGFGENTGLCTERSKESVKQSGCALCSP 96
           LNL SYNYLGF      CT R  ES+K+   + CS 
Sbjct: 103 LNLGSYNYLGFAAADEYCTPRVIESLKKYSASTCSS 138

Length = 489
>gnl|CDD|99747 cd06454, KBL_like, KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 100
KOG1357|consensus 519 100.0
PLN02483 489 serine palmitoyltransferase 100.0
COG0156 388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.56
KOG1359|consensus 417 99.38
PLN02955 476 8-amino-7-oxononanoate synthase 99.36
PRK13393 406 5-aminolevulinate synthase; Provisional 99.27
TIGR01821 402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.26
KOG1358|consensus 467 99.21
PRK09064 407 5-aminolevulinate synthase; Validated 99.19
PLN03227 392 serine palmitoyltransferase-like protein; Provisio 99.15
PRK07505 402 hypothetical protein; Provisional 99.03
TIGR01822 393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 98.99
PLN02822 481 serine palmitoyltransferase 98.96
PRK13392 410 5-aminolevulinate synthase; Provisional 98.93
PRK05937 370 8-amino-7-oxononanoate synthase; Provisional 98.92
KOG1360|consensus 570 98.89
PRK07179 407 hypothetical protein; Provisional 98.78
cd06454 349 KBL_like KBL_like; this family belongs to the pyri 98.38
TIGR00858 360 bioF 8-amino-7-oxononanoate synthase. This model r 98.26
PRK05958 385 8-amino-7-oxononanoate synthase; Reviewed 97.72
TIGR01825 385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 97.62
TIGR03576 346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 97.61
PRK06939 397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 97.56
TIGR00707 379 argD acetylornithine and succinylornithine aminotr 97.04
TIGR03246 397 arg_catab_astC succinylornithine transaminase fami 96.77
PRK02936 377 argD acetylornithine aminotransferase; Provisional 96.6
PRK13034 416 serine hydroxymethyltransferase; Reviewed 96.49
TIGR01885 401 Orn_aminotrans ornithine aminotransferase. This mo 96.43
PRK12381 406 bifunctional succinylornithine transaminase/acetyl 96.41
PRK00854 401 rocD ornithine--oxo-acid transaminase; Reviewed 96.25
PRK03244 398 argD acetylornithine aminotransferase; Provisional 95.95
PRK05093 403 argD bifunctional N-succinyldiaminopimelate-aminot 95.91
cd00610 413 OAT_like Acetyl ornithine aminotransferase family. 95.87
PRK04260 375 acetylornithine aminotransferase; Provisional 95.64
PRK03715 395 argD acetylornithine transaminase protein; Provisi 95.6
PRK01278 389 argD acetylornithine transaminase protein; Provisi 95.58
PTZ00125 400 ornithine aminotransferase-like protein; Provision 95.52
PLN02760 504 4-aminobutyrate:pyruvate transaminase 94.74
PRK06082 459 4-aminobutyrate aminotransferase; Provisional 94.36
PRK08117 433 4-aminobutyrate aminotransferase; Provisional 93.79
PLN02624 474 ornithine-delta-aminotransferase 93.45
TIGR00508 427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 93.2
PRK00062 426 glutamate-1-semialdehyde aminotransferase; Provisi 93.05
PRK12403 460 putative aminotransferase; Provisional 90.26
PRK02627 396 acetylornithine aminotransferase; Provisional 90.24
TIGR02539 370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 86.91
PF00155 363 Aminotran_1_2: Aminotransferase class I and II 1-a 84.05
PRK06149 972 hypothetical protein; Provisional 80.58
>KOG1357|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.8e-36  Score=242.58  Aligned_cols=100  Identities=56%  Similarity=1.044  Sum_probs=98.1

Q ss_pred             CCCchhhhHHHHHHHHHHhhhhcccCCcccCCCCCeEEEeecccCCCCceeeecCCcccEEEeccccccCCCCCChHHHH
Q psy2211           1 GYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCTE   80 (100)
Q Consensus         1 ~~~pl~~~f~~f~~r~~~~r~~d~~~r~i~~~~g~~i~~~~r~~~~~~~~~~~~G~~~~~lnf~SnnYLGla~~~~~v~~   80 (100)
                      ||+|||++||+||.|++|+||+|||+||++++||++|++++|.++|+||||++||+..+||||+|||||||+++...|.+
T Consensus        79 g~~ply~~Fe~FY~Rriy~ri~Dc~~RPi~~VPG~~v~l~dR~S~D~n~tfk~tG~~~~~lNlgSYNYLGFa~~~g~ca~  158 (519)
T KOG1357|consen   79 GYAPLYSSFESFYSRRIYRRIRDCFERPICSVPGAWVDLMDRVSDDYNWTFKYTGTRSRCLNLGSYNYLGFAQSVGPCAE  158 (519)
T ss_pred             CccchhhhHHHHHHHHHHHHHhHhhcCCCcCCCCceEEeeeeeccCCCceEEeccceeeeeeecccccccccccCCcCCh
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999989999


Q ss_pred             HHHHHHHhhCCCCCcCCCCC
Q psy2211          81 RSKESVKQSGCALCSPSGEI  100 (100)
Q Consensus        81 a~~~ai~~yG~gs~~srl~~  100 (100)
                      ++.+++++||.+.|+||.|+
T Consensus       159 ~~~~~~~kygl~~css~~e~  178 (519)
T KOG1357|consen  159 ASLKSFDKYGLSRCSSRHEA  178 (519)
T ss_pred             HHHHHHHHhcccccccchhc
Confidence            99999999999999999885

>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>KOG1359|consensus Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>KOG1358|consensus Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>KOG1360|consensus Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
2w8t_A 427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 98.18
3kki_A 409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 98.06
3tqx_A 399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 98.05
1fc4_A 401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 97.82
1bs0_A 384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 97.19
2bwn_A 401 5-aminolevulinate synthase; tetrapyrrole biosynthe 97.16
3a2b_A 398 Serine palmitoyltransferase; vitamin B6-dependent 97.11
3lws_A 357 Aromatic amino acid beta-eliminating lyase/threoni 96.18
2ord_A 397 Acoat, acetylornithine aminotransferase; TM1785, a 95.14
3n5m_A 452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 95.14
2e7u_A 424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 95.05
3dxv_A 439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 95.01
3hmu_A 472 Aminotransferase, class III; structural genomics, 94.92
3i5t_A 476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 94.82
3nx3_A 395 Acoat, acetylornithine aminotransferase; csgid, st 94.81
3gju_A 460 Putative aminotransferase; pyridoxal phosphate, PL 94.69
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 94.67
3tfu_A 457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 94.49
3i4j_A 430 Aminotransferase, class III; structural GENOMICS,N 94.47
3nra_A 407 Aspartate aminotransferase; structural genomics, j 94.41
4adb_A 406 Succinylornithine transaminase; transferase, PLP e 94.36
4a6r_A 459 Omega transaminase; transferase, PLP-binding enzym 94.31
2epj_A 434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 94.06
2pb2_A 420 Acetylornithine/succinyldiaminopimelate aminotran; 94.05
3ei9_A 432 LL-diaminopimelate aminotransferase; lysine biosyn 94.02
2oat_A 439 Ornithine aminotransferase; 5-fluoromethylornithin 93.47
3dod_A 448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 93.36
1ohv_A 472 4-aminobutyrate aminotransferase; PLP-dependent en 93.34
3k28_A 429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 93.3
2cy8_A 453 D-phgat, D-phenylglycine aminotransferase; structu 93.02
3l44_A 434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 92.93
2eo5_A 419 419AA long hypothetical aminotransferase; PLP enzy 92.22
1z7d_A 433 Ornithine aminotransferase; structural genomics co 92.17
4ffc_A 453 4-aminobutyrate aminotransferase (GABT); structura 91.66
2yky_A 465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 90.71
1vef_A 395 Acetylornithine/acetyl-lysine aminotransferase; PL 90.94
3fq8_A 427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 90.65
1sff_A 426 4-aminobutyrate aminotransferase; enzyme complexes 90.48
1s0a_A 429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 90.3
3ruy_A 392 Ornithine aminotransferase; structural genomics, c 89.7
3a8u_X 449 Omega-amino acid--pyruvate aminotransferase; large 87.94
4e77_A 429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 87.94
3oks_A 451 4-aminobutyrate transaminase; ssgcid, transferase, 86.84
1zod_A 433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 85.86
4a0g_A 831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 84.51
3qgu_A 449 LL-diaminopimelate aminotransferase; L-lysine, pyr 82.65
2eh6_A 375 Acoat, acetylornithine aminotransferase; ARGD, str 82.53
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
Probab=98.18  E-value=3e-06  Score=64.69  Aligned_cols=59  Identities=22%  Similarity=0.372  Sum_probs=47.1

Q ss_pred             cccCCccc-CCCCCeEEEeecccCCCCceeeecCCcccEEEeccccccCCCCCChHHHHHHHHHHHhhCCCCCcCCC
Q psy2211          23 DCFNRPVT-SVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCTERSKESVKQSGCALCSPSG   98 (100)
Q Consensus        23 d~~~r~i~-~~~g~~i~~~~r~~~~~~~~~~~~G~~~~~lnf~SnnYLGla~~~~~v~~a~~~ai~~yG~gs~~srl   98 (100)
                      .++.+.+. +..|+++.. +             |  +++|+|+|||||||..+|+ +++++.+++++||.+.+++|.
T Consensus        44 ~r~~~~~~~~~~g~~~~~-~-------------g--~~~id~~~~~~lg~~~~~~-v~~a~~~~~~~~~~~~~~~~~  103 (427)
T 2w8t_A           44 DPFAIVMEQVKSPTEAVI-R-------------G--KDTILLGTYNYMGMTFDPD-VIAAGKEALEKFGSGTCGSRM  103 (427)
T ss_dssp             CTTCCCCSEEEETTEEEE-T-------------T--EEEEECSCCCTTCGGGCHH-HHHHHHHHHHHHCSCCCSCTT
T ss_pred             ceeeeeccccCCCceEee-C-------------C--ceEEEEECcccccCCCCHH-HHHHHHHHHHHhCCCCccccc
Confidence            33444555 667777764 3             4  8999999999999999997 999999999999988777654
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 100
d1bs0a_ 383 c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-a 2e-07
d1fc4a_ 401 c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {E 2e-05
d2bwna1 396 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rho 1e-04
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Length = 383 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS)
species: Escherichia coli [TaxId: 562]

 Score = 44.5 bits (104), Expect = 2e-07
 Identities = 15/79 (18%), Positives = 24/79 (30%), Gaps = 22/79 (27%)

Query: 18 YRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGL 77
           RR       PV    G  +   DR+                 LN +S +YLG   +  +
Sbjct: 19 LRRR-----YPVAQGAGRWLVADDRQ----------------YLNFSSNDYLGLSHHPQI 57

Query: 78 CTERSKESVKQSGCALCSP 96
               ++  +Q G      
Sbjct: 58 -IRAWQQGAEQFGIGSGGS 75
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Length = 401 Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Length = 396 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
d1bs0a_ 383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.63
d2bwna1 396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.62
d1fc4a_ 401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.61
d1v72a1 345 Phenylserine aldolase PSALD {Pseudomonas putida [T 97.05
d2gsaa_ 427 Glutamate-1-semialdehyde aminomutase (aminotransfe 89.92
d1svva_ 340 Low-specificity threonine aldolase {Leishmania maj 84.45
d1sffa_ 425 4-aminobutyrate aminotransferase, GABA-aminotransf 83.42
d1vefa1 387 Acetylornithine/acetyl-lysine aminotransferase Arg 83.13
d1z7da1 404 Ornithine aminotransferase {Plasmodium yoelii yoel 82.6
d1s0aa_ 429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 82.25
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS)
species: Escherichia coli [TaxId: 562]

Probab=99.63  E-value=1.2e-16  Score=121.93  Aligned_cols=73  Identities=15%  Similarity=0.135  Sum_probs=58.3

Q ss_pred             HHHHHHHHH---HhhhhcccCCcccCCCCCeEEEeecccCCCCceeeecCCcccEEEeccccccCCCCCChHHHHHHHHH
Q psy2211           9 FVLFYSRYV---YRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCTERSKES   85 (100)
Q Consensus         9 f~~f~~r~~---~~r~~d~~~r~i~~~~g~~i~~~~r~~~~~~~~~~~~G~~~~~lnf~SnnYLGla~~~~~v~~a~~~a   85 (100)
                      |++.+.+.+   +........+++.+.+|++|++.              |  |++|||+|||||||++||+ ++++++++
T Consensus         2 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~g~~i~~~--------------g--~~~l~f~s~dYLGl~~~p~-v~~a~~~a   64 (383)
T d1bs0a_           2 WQEKINAALDARRAADALRRRYPVAQGAGRWLVAD--------------D--RQYLNFSSNDYLGLSHHPQ-IIRAWQQG   64 (383)
T ss_dssp             HHHHHHHHHHHCCGGGCCCCCCCCSBCSSSEEEET--------------T--EEEEECSCCCTTSGGGCHH-HHHHHHHH
T ss_pred             hHHHHHHHHHHHHHhCCCccccccCCCCCCeEEEC--------------C--eEEEEEEcccccccCCCHH-HHHHHHHH
Confidence            344444444   22233333557899999999863              4  8999999999999999997 99999999


Q ss_pred             HHhhCCCCCcCCC
Q psy2211          86 VKQSGCALCSPSG   98 (100)
Q Consensus        86 i~~yG~gs~~srl   98 (100)
                      +++||+|+||||+
T Consensus        65 ~~~~G~~~~~sr~   77 (383)
T d1bs0a_          65 AEQFGIGSGGSGH   77 (383)
T ss_dssp             HHHHCSCCCSBTT
T ss_pred             HHHhCCCCCcccc
Confidence            9999999999996
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure