Psyllid ID: psy2274
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 244 | ||||||
| 122103773 | 188 | RecName: Full=60S ribosomal protein L18 | 0.405 | 0.526 | 0.989 | 8e-50 | |
| 328780603 | 394 | PREDICTED: hypothetical protein LOC55248 | 0.409 | 0.253 | 0.74 | 2e-37 | |
| 350398682 | 400 | PREDICTED: hypothetical protein LOC10074 | 0.409 | 0.25 | 0.72 | 5e-37 | |
| 340709984 | 409 | PREDICTED: hypothetical protein LOC10064 | 0.409 | 0.244 | 0.73 | 5e-37 | |
| 70909737 | 188 | ribosomal protein L18e [Hister sp. APV-2 | 0.405 | 0.526 | 0.717 | 8e-37 | |
| 380014771 | 188 | PREDICTED: 60S ribosomal protein L18-lik | 0.405 | 0.526 | 0.747 | 9e-37 | |
| 345485528 | 410 | PREDICTED: hypothetical protein LOC10012 | 0.495 | 0.295 | 0.611 | 1e-36 | |
| 332019851 | 232 | 60S ribosomal protein L18 [Acromyrmex ec | 0.405 | 0.426 | 0.757 | 2e-36 | |
| 91079322 | 188 | PREDICTED: similar to ribosomal protein | 0.491 | 0.638 | 0.616 | 2e-36 | |
| 322791128 | 187 | hypothetical protein SINV_04174 [Solenop | 0.405 | 0.529 | 0.737 | 5e-36 |
| >gi|122103773|sp|Q0PXY6.1|RL18_DIACI RecName: Full=60S ribosomal protein L18 gi|110671444|gb|ABG81973.1| putative ribosomal protein L18e [Diaphorina citri] | Back alignment and taxonomy information |
|---|
Score = 202 bits (515), Expect = 8e-50, Method: Compositional matrix adjust.
Identities = 98/99 (98%), Positives = 99/99 (100%)
Query: 36 GVDICHKYDRRVRRTKPKSKDVYLELLVKLYRFLTRRTNSKFNKIILKRLFMSKINRPPM 95
GVDICHKYDRRVRRTKPKSKDVYLELLVKLYRFLTRRTNSKFNKIILKRLFMSKINRPPM
Sbjct: 2 GVDICHKYDRRVRRTKPKSKDVYLELLVKLYRFLTRRTNSKFNKIILKRLFMSKINRPPM 61
Query: 96 AISKIVRFMKKPTREGRVAVIVGTIVDDPRMWTIPKLTI 134
AISKIVRFMKKPTREGRVAVIVGTIVDDPRMWTIPKLT+
Sbjct: 62 AISKIVRFMKKPTREGRVAVIVGTIVDDPRMWTIPKLTV 100
|
Source: Diaphorina citri Species: Diaphorina citri Genus: Diaphorina Family: Psyllidae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328780603|ref|XP_624859.2| PREDICTED: hypothetical protein LOC552483 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350398682|ref|XP_003485273.1| PREDICTED: hypothetical protein LOC100746406 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340709984|ref|XP_003393579.1| PREDICTED: hypothetical protein LOC100643724 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|70909737|emb|CAJ17294.1| ribosomal protein L18e [Hister sp. APV-2005] | Back alignment and taxonomy information |
|---|
| >gi|380014771|ref|XP_003691391.1| PREDICTED: 60S ribosomal protein L18-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|345485528|ref|XP_001606789.2| PREDICTED: hypothetical protein LOC100123180 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|332019851|gb|EGI60312.1| 60S ribosomal protein L18 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|91079322|ref|XP_968042.1| PREDICTED: similar to ribosomal protein L18e [Tribolium castaneum] gi|270004338|gb|EFA00786.1| hypothetical protein TcasGA2_TC003672 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|322791128|gb|EFZ15690.1| hypothetical protein SINV_04174 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 244 | ||||||
| FB|FBgn0035753 | 188 | RpL18 "Ribosomal protein L18" | 0.491 | 0.638 | 0.566 | 1.1e-32 | |
| UNIPROTKB|Q2M0G4 | 189 | RpL18 "60S ribosomal protein L | 0.491 | 0.634 | 0.566 | 1.1e-32 | |
| UNIPROTKB|Q5E973 | 188 | RPL18 "60S ribosomal protein L | 0.491 | 0.638 | 0.55 | 1.3e-31 | |
| UNIPROTKB|I3L6F1 | 188 | RPL18 "60S ribosomal protein L | 0.491 | 0.638 | 0.55 | 1.3e-31 | |
| UNIPROTKB|I3LFL4 | 169 | RPL18 "60S ribosomal protein L | 0.491 | 0.710 | 0.55 | 1.3e-31 | |
| UNIPROTKB|D0VWQ3 | 188 | RPL18 "Ribosomal protein L18" | 0.491 | 0.638 | 0.541 | 5.4e-31 | |
| RGD|621182 | 188 | Rpl18 "ribosomal protein L18" | 0.491 | 0.638 | 0.541 | 5.4e-31 | |
| MGI|MGI:98003 | 188 | Rpl18 "ribosomal protein L18" | 0.491 | 0.638 | 0.533 | 6.9e-31 | |
| UNIPROTKB|G3V203 | 164 | RPL18 "60S ribosomal protein L | 0.491 | 0.731 | 0.541 | 8.8e-31 | |
| UNIPROTKB|J3QQ67 | 190 | RPL18 "60S ribosomal protein L | 0.491 | 0.631 | 0.541 | 8.8e-31 |
| FB|FBgn0035753 RpL18 "Ribosomal protein L18" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 357 (130.7 bits), Expect = 1.1e-32, P = 1.1e-32
Identities = 68/120 (56%), Positives = 86/120 (71%)
Query: 36 GVDICHKYDRRVRRTKPKSKDVYLELLVKLYRFLTRRTNSKFNKIILKRLFMSKINRPPM 95
G+DI HKYDR+VRRT+PKS+DVYL LLVKLYRFL RRTN KFN+IILKRLFMSKINRPP+
Sbjct: 2 GIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPPL 61
Query: 96 AISKIVRFMKKPTREGRVAVIVGTIVDDPRMWTIPKLTIVRFMKKPTREGRVAVIVGTIV 155
++ +I RF K + V+VGT+ DD R+ +PKLT+ T R+ G ++
Sbjct: 62 SLQRIARFFKAANQPESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEVL 121
|
|
| UNIPROTKB|Q2M0G4 RpL18 "60S ribosomal protein L18" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5E973 RPL18 "60S ribosomal protein L18" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L6F1 RPL18 "60S ribosomal protein L18" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LFL4 RPL18 "60S ribosomal protein L18" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D0VWQ3 RPL18 "Ribosomal protein L18" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|621182 Rpl18 "ribosomal protein L18" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98003 Rpl18 "ribosomal protein L18" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V203 RPL18 "60S ribosomal protein L18" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QQ67 RPL18 "60S ribosomal protein L18" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 244 | |||
| PTZ00469 | 187 | PTZ00469, PTZ00469, 60S ribosomal subunit protein | 2e-18 | |
| pfam00828 | 122 | pfam00828, Ribosomal_L18e, Ribosomal protein L18e/ | 2e-18 | |
| PTZ00195 | 198 | PTZ00195, PTZ00195, 60S ribosomal protein L18; Pro | 2e-18 | |
| COG1727 | 122 | COG1727, RPL18A, Ribosomal protein L18E [Translati | 6e-17 | |
| PTZ00469 | 187 | PTZ00469, PTZ00469, 60S ribosomal subunit protein | 7e-04 |
| >gnl|CDD|185648 PTZ00469, PTZ00469, 60S ribosomal subunit protein L18; Provisional | Back alignment and domain information |
|---|
Score = 80.1 bits (197), Expect = 2e-18
Identities = 47/94 (50%), Positives = 60/94 (63%), Gaps = 2/94 (2%)
Query: 54 SKDVYLELLVKLYRFLTRRTNSKFNKIILKRLFMSKINRPPMAISKIVRFMKKPTREGRV 113
SK+ YL LLVKLYRFL RRTN+ FNKII KRL M K RPP+++SK+ R M + V
Sbjct: 21 SKNPYLRLLVKLYRFLARRTNANFNKIIAKRLIMPKRFRPPLSLSKLHRHMA--SYPDDV 78
Query: 114 AVIVGTIVDDPRMWTIPKLTIVRFMKKPTREGRV 147
AV+VG+I DD R++ KL + T R+
Sbjct: 79 AVVVGSITDDKRLYDCKKLKVCALRFTETARKRI 112
|
Length = 187 |
| >gnl|CDD|216140 pfam00828, Ribosomal_L18e, Ribosomal protein L18e/L15 | Back alignment and domain information |
|---|
| >gnl|CDD|140222 PTZ00195, PTZ00195, 60S ribosomal protein L18; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224641 COG1727, RPL18A, Ribosomal protein L18E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|185648 PTZ00469, PTZ00469, 60S ribosomal subunit protein L18; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 244 | |||
| PTZ00195 | 198 | 60S ribosomal protein L18; Provisional | 100.0 | |
| PTZ00469 | 187 | 60S ribosomal subunit protein L18; Provisional | 100.0 | |
| KOG1714|consensus | 188 | 100.0 | ||
| COG1727 | 122 | RPL18A Ribosomal protein L18E [Translation, riboso | 100.0 | |
| PRK04005 | 111 | 50S ribosomal protein L18e; Provisional | 99.94 | |
| KOG1714|consensus | 188 | 99.52 | ||
| PF00828 | 129 | Ribosomal_L18e: Ribosomal protein L18e/L15; InterP | 99.42 | |
| PTZ00195 | 198 | 60S ribosomal protein L18; Provisional | 99.35 | |
| PTZ00469 | 187 | 60S ribosomal subunit protein L18; Provisional | 99.16 | |
| PRK05592 | 146 | rplO 50S ribosomal protein L15; Reviewed | 98.58 | |
| PRK06419 | 148 | rpl15p 50S ribosomal protein L15P; Reviewed | 98.53 | |
| TIGR01071 | 145 | rplO_bact ribosomal protein L15, bacterial/organel | 98.35 | |
| PTZ00160 | 147 | 60S ribosomal protein L27a; Provisional | 97.98 | |
| COG1727 | 122 | RPL18A Ribosomal protein L18E [Translation, riboso | 97.78 | |
| COG0200 | 152 | RplO Ribosomal protein L15 [Translation, ribosomal | 97.58 | |
| PRK04005 | 111 | 50S ribosomal protein L18e; Provisional | 96.23 | |
| KOG1742|consensus | 147 | 89.34 | ||
| KOG0846|consensus | 274 | 83.44 |
| >PTZ00195 60S ribosomal protein L18; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.6e-53 Score=367.15 Aligned_cols=131 Identities=33% Similarity=0.559 Sum_probs=127.6
Q ss_pred ceeecc-CcccccccccCCCCcCHHHHHHHHHHHHHhhhcCchHHHHHHHHHhccccCCCcccHHHHHHHhc------CC
Q psy2274 35 NGVDIC-HKYDRRVRRTKPKSKDVYLELLVKLYRFLTRRTNSKFNKIILKRLFMSKINRPPMAISKIVRFMK------KP 107 (244)
Q Consensus 35 MGiD~~-~~~~kk~~Rk~~kStN~yL~lLIklyr~laRrt~a~fwk~VakRL~msrrnR~pVnLSKI~R~~k------~~ 107 (244)
|||||+ ++++++++|+.|+|+||||++||++|+|+||+|+|+||++||+||+||++||||||||||++||+ ++
T Consensus 1 mgid~~~~~~~~~~~r~~pkstN~yL~lLVklyrflaRrt~a~fnk~VakRL~~sr~nRppVsLSrI~r~~k~~d~~~~~ 80 (198)
T PTZ00195 1 MGVDLTGISKKSRVVRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAK 80 (198)
T ss_pred CceecccccccccccccCCCCCCHHHHHHHHHHHHHHHhhCCHHHHHHHHHHhcccccCCceeHHHHHHHHhcccccccc
Confidence 999998 67899999999999999999999999999999999999999999999999999999999999997 36
Q ss_pred CCCCCEEEEEeeeecCCcccccCceeEEEeeeccchhhhhhhcCcEEeehhhhhc-CCC
Q psy2274 108 TREGRVAVIVGTIVDDPRMWTIPKLTIVRFMKKPTREGRVAVIVGTIVDDPRMWT-IPK 165 (244)
Q Consensus 108 ~~egkivVVvGKVldDgrL~eVPKltV~AL~fS~sAr~KI~kAGGki~TidrL~e-NPK 165 (244)
+++|+|||||||||||++|.+||||+||||+||++|++||++|||+|+|||||++ +|+
T Consensus 81 ~~~~k~~VVvGkVtdd~rl~~vPkvtVaALrfS~tAr~rI~kAGGe~lT~dQLa~~~Pk 139 (198)
T PTZ00195 81 GKKAPIAVVVGDVLDDVRMARIPAMRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPT 139 (198)
T ss_pred CCCCcEEEEEeeEcCCccccccCceEEEEEecCHHHHHHHHHhCCEEEeHHHHHHHCCC
Confidence 7899999999999999999999999999999999999999999999999999998 998
|
|
| >PTZ00469 60S ribosomal subunit protein L18; Provisional | Back alignment and domain information |
|---|
| >KOG1714|consensus | Back alignment and domain information |
|---|
| >COG1727 RPL18A Ribosomal protein L18E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK04005 50S ribosomal protein L18e; Provisional | Back alignment and domain information |
|---|
| >KOG1714|consensus | Back alignment and domain information |
|---|
| >PF00828 Ribosomal_L18e: Ribosomal protein L18e/L15; InterPro: IPR021131 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PTZ00195 60S ribosomal protein L18; Provisional | Back alignment and domain information |
|---|
| >PTZ00469 60S ribosomal subunit protein L18; Provisional | Back alignment and domain information |
|---|
| >PRK05592 rplO 50S ribosomal protein L15; Reviewed | Back alignment and domain information |
|---|
| >PRK06419 rpl15p 50S ribosomal protein L15P; Reviewed | Back alignment and domain information |
|---|
| >TIGR01071 rplO_bact ribosomal protein L15, bacterial/organelle | Back alignment and domain information |
|---|
| >PTZ00160 60S ribosomal protein L27a; Provisional | Back alignment and domain information |
|---|
| >COG1727 RPL18A Ribosomal protein L18E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0200 RplO Ribosomal protein L15 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK04005 50S ribosomal protein L18e; Provisional | Back alignment and domain information |
|---|
| >KOG1742|consensus | Back alignment and domain information |
|---|
| >KOG0846|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 244 | ||||
| 2zkr_o | 188 | Structure Of A Mammalian Ribosomal 60s Subunit With | 1e-26 | ||
| 2zkr_o | 188 | Structure Of A Mammalian Ribosomal 60s Subunit With | 8e-06 | ||
| 3izr_R | 188 | Localization Of The Large Subunit Ribosomal Protein | 5e-25 | ||
| 3izr_R | 188 | Localization Of The Large Subunit Ribosomal Protein | 6e-06 | ||
| 3izs_R | 186 | Localization Of The Large Subunit Ribosomal Protein | 2e-20 | ||
| 3izs_R | 186 | Localization Of The Large Subunit Ribosomal Protein | 2e-04 | ||
| 4a17_N | 181 | T.Thermophila 60s Ribosomal Subunit In Complex With | 1e-17 | ||
| 3jyw_O | 121 | Structure Of The 60s Proteins For Eukaryotic Riboso | 3e-17 | ||
| 3jyw_O | 121 | Structure Of The 60s Proteins For Eukaryotic Riboso | 2e-04 | ||
| 1s1i_O | 120 | Structure Of The Ribosomal 80s-Eef2-Sordarin Comple | 7e-17 | ||
| 1s1i_O | 120 | Structure Of The Ribosomal 80s-Eef2-Sordarin Comple | 2e-04 | ||
| 3zf7_I | 193 | High-resolution Cryo-electron Microscopy Structure | 6e-16 |
| >pdb|2ZKR|OO Chain o, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 188 | Back alignment and structure |
|
| >pdb|2ZKR|OO Chain o, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 188 | Back alignment and structure |
| >pdb|3IZR|R Chain R, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 188 | Back alignment and structure |
| >pdb|3IZR|R Chain R, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 188 | Back alignment and structure |
| >pdb|3IZS|R Chain R, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 186 | Back alignment and structure |
| >pdb|3IZS|R Chain R, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 186 | Back alignment and structure |
| >pdb|4A17|N Chain N, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 5s Rrna, 5.8s Rrna And Proteins Of Molecule 2. Length = 181 | Back alignment and structure |
| >pdb|3JYW|O Chain O, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 121 | Back alignment and structure |
| >pdb|3JYW|O Chain O, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 121 | Back alignment and structure |
| >pdb|1S1I|O Chain O, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 120 | Back alignment and structure |
| >pdb|1S1I|O Chain O, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 120 | Back alignment and structure |
| >pdb|3ZF7|I Chain I, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 193 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 244 | |||
| 2zkr_o | 188 | 60S ribosomal protein L18; protein-RNA complex, 60 | 6e-38 | |
| 2zkr_o | 188 | 60S ribosomal protein L18; protein-RNA complex, 60 | 3e-05 | |
| 3izc_R | 186 | 60S ribosomal protein RPL18 (L18E); eukaryotic rib | 5e-34 | |
| 3izc_R | 186 | 60S ribosomal protein RPL18 (L18E); eukaryotic rib | 9e-05 | |
| 3iz5_R | 188 | 60S ribosomal protein L18 (L18E); eukaryotic ribos | 1e-33 | |
| 3iz5_R | 188 | 60S ribosomal protein L18 (L18E); eukaryotic ribos | 8e-06 | |
| 4a17_N | 181 | RPL18, 60S ribosomal protein L5; eukaryotic riboso | 4e-30 | |
| 4a17_N | 181 | RPL18, 60S ribosomal protein L5; eukaryotic riboso | 8e-05 | |
| 3jyw_O | 121 | 60S ribosomal protein L18(A); eukaryotic ribosome, | 2e-28 | |
| 3jyw_O | 121 | 60S ribosomal protein L18(A); eukaryotic ribosome, | 5e-05 | |
| 1vq8_O | 116 | 50S ribosomal protein L18E; ribosome 50S, protein- | 2e-21 | |
| 1vq8_O | 116 | 50S ribosomal protein L18E; ribosome 50S, protein- | 4e-06 |
| >2zkr_o 60S ribosomal protein L18; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 188 | Back alignment and structure |
|---|
Score = 130 bits (327), Expect = 6e-38
Identities = 61/102 (59%), Positives = 81/102 (79%)
Query: 36 GVDICHKYDRRVRRTKPKSKDVYLELLVKLYRFLTRRTNSKFNKIILKRLFMSKINRPPM 95
GVDI H DR+VRR +PKS+D+YL LLVKLYRFL RRTNS FN+++LKRLFMS+ NRPP+
Sbjct: 2 GVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPL 61
Query: 96 AISKIVRFMKKPTREGRVAVIVGTIVDDPRMWTIPKLTIVRF 137
++S+++R MK P RE + AV+VGT+ DD R+ +PKL +
Sbjct: 62 SLSRMIRKMKLPGRENKTAVVVGTVTDDVRILEVPKLKVCAL 103
|
| >2zkr_o 60S ribosomal protein L18; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 188 | Back alignment and structure |
|---|
| >4a17_N RPL18, 60S ribosomal protein L5; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_N 4a1c_N 4a1e_N Length = 181 | Back alignment and structure |
|---|
| >4a17_N RPL18, 60S ribosomal protein L5; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_N 4a1c_N 4a1e_N Length = 181 | Back alignment and structure |
|---|
| >3jyw_O 60S ribosomal protein L18(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_O Length = 121 | Back alignment and structure |
|---|
| >3jyw_O 60S ribosomal protein L18(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_O Length = 121 | Back alignment and structure |
|---|
| >1vq8_O 50S ribosomal protein L18E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.12.1.1 PDB: 1vq4_O* 1vq5_O* 1vq6_O* 1vq7_O* 1s72_O* 1vq9_O* 1vqk_O* 1vql_O* 1vqm_O* 1vqn_O* 1vqo_O* 1vqp_O* 1yhq_O* 1yi2_O* 1yij_O* 1yit_O* 1yj9_O* 1yjn_O* 1yjw_O* 2otj_O* ... Length = 116 | Back alignment and structure |
|---|
| >1vq8_O 50S ribosomal protein L18E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.12.1.1 PDB: 1vq4_O* 1vq5_O* 1vq6_O* 1vq7_O* 1s72_O* 1vq9_O* 1vqk_O* 1vql_O* 1vqm_O* 1vqn_O* 1vqo_O* 1vqp_O* 1yhq_O* 1yi2_O* 1yij_O* 1yit_O* 1yj9_O* 1yjn_O* 1yjw_O* 2otj_O* ... Length = 116 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 244 | |||
| 3izc_R | 186 | 60S ribosomal protein RPL18 (L18E); eukaryotic rib | 100.0 | |
| 3iz5_R | 188 | 60S ribosomal protein L18 (L18E); eukaryotic ribos | 100.0 | |
| 4a17_N | 181 | RPL18, 60S ribosomal protein L5; eukaryotic riboso | 100.0 | |
| 2zkr_o | 188 | 60S ribosomal protein L18; protein-RNA complex, 60 | 100.0 | |
| 3jyw_O | 121 | 60S ribosomal protein L18(A); eukaryotic ribosome, | 100.0 | |
| 3j21_P | 120 | 50S ribosomal protein L18E; archaea, archaeal, KIN | 100.0 | |
| 1vq8_O | 116 | 50S ribosomal protein L18E; ribosome 50S, protein- | 99.95 | |
| 3izc_R | 186 | 60S ribosomal protein RPL18 (L18E); eukaryotic rib | 98.85 | |
| 3iz5_R | 188 | 60S ribosomal protein L18 (L18E); eukaryotic ribos | 98.82 | |
| 4a17_N | 181 | RPL18, 60S ribosomal protein L5; eukaryotic riboso | 98.77 | |
| 3jyw_O | 121 | 60S ribosomal protein L18(A); eukaryotic ribosome, | 98.76 | |
| 3j21_L | 147 | 50S ribosomal protein L15P; archaea, archaeal, KIN | 98.71 | |
| 1vq8_L | 165 | 50S ribosomal protein L15P; ribosome 50S, protein- | 98.41 | |
| 3r8s_L | 143 | 50S ribosomal protein L15; protein biosynthesis, R | 98.36 | |
| 2zkr_o | 188 | 60S ribosomal protein L18; protein-RNA complex, 60 | 98.3 | |
| 4a17_K | 149 | L29, RPL27A, 60S ribosomal protein L27A; eukaryoti | 98.12 | |
| 3o58_Y | 149 | 60S ribosomal protein L28; ribosomal RNA and prote | 98.09 | |
| 3v2d_P | 150 | 50S ribosomal protein L15; ribosome associated inh | 98.09 | |
| 2zjr_I | 156 | 50S ribosomal protein L15; ribosome, large ribosom | 98.01 | |
| 3iz5_O | 144 | 60S ribosomal protein L27A (L15P); eukaryotic ribo | 98.0 | |
| 2zkr_l | 148 | 60S ribosomal protein L27A; protein-RNA complex, 6 | 97.99 | |
| 3bbo_N | 257 | Ribosomal protein L15; large ribosomal subunit, sp | 97.74 | |
| 3j21_P | 120 | 50S ribosomal protein L18E; archaea, archaeal, KIN | 97.72 | |
| 1vq8_O | 116 | 50S ribosomal protein L18E; ribosome 50S, protein- | 96.41 |
| >4a17_N RPL18, 60S ribosomal protein L5; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_N 4a1c_N 4a1e_N | Back alignment and structure |
|---|
| >2zkr_o 60S ribosomal protein L18; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} | Back alignment and structure |
|---|
| >3jyw_O 60S ribosomal protein L18(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_O | Back alignment and structure |
|---|
| >3j21_P 50S ribosomal protein L18E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1vq8_O 50S ribosomal protein L18E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.12.1.1 PDB: 1vq4_O* 1vq5_O* 1vq6_O* 1vq7_O* 1s72_O* 1vq9_O* 1vqk_O* 1vql_O* 1vqm_O* 1vqn_O* 1vqo_O* 1vqp_O* 1yhq_O* 1yi2_O* 1yij_O* 1yit_O* 1yj9_O* 1yjn_O* 1yjw_O* 2otj_O* ... | Back alignment and structure |
|---|
| >4a17_N RPL18, 60S ribosomal protein L5; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_N 4a1c_N 4a1e_N | Back alignment and structure |
|---|
| >3jyw_O 60S ribosomal protein L18(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_O | Back alignment and structure |
|---|
| >3j21_L 50S ribosomal protein L15P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1vq8_L 50S ribosomal protein L15P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.12.1.1 PDB: 1vq4_L* 1vq5_L* 1vq6_L* 1vq7_L* 1s72_L* 1vq9_L* 1vqk_L* 1vql_L* 1vqm_L* 1vqn_L* 1vqo_L* 1vqp_L* 1yhq_L* 1yi2_L* 1yij_L* 1yit_L* 1yj9_L* 1yjn_L* 1yjw_L* 2otj_L* ... | Back alignment and structure |
|---|
| >3r8s_L 50S ribosomal protein L15; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 3fik_L 3j19_L 2wwq_L 3oat_L* 3oas_L* 3ofd_L 3ofc_L 3ofr_L* 3ofz_L* 3og0_L 3ofq_L 3r8t_L 3i1n_L 1p85_J 1p86_J 1vs8_L 1vs6_L 2aw4_L 2awb_L 1vt2_L ... | Back alignment and structure |
|---|
| >2zkr_o 60S ribosomal protein L18; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} | Back alignment and structure |
|---|
| >4a17_K L29, RPL27A, 60S ribosomal protein L27A; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_K 4a1c_K 4a1e_K | Back alignment and structure |
|---|
| >3o58_Y 60S ribosomal protein L28; ribosomal RNA and proteins, ribosome; 4.00A {Saccharomyces cerevisiae} PDB: 3o5h_Y 3izc_O 3izs_O 3u5e_a 3u5i_a 4b6a_a 1s1i_V 3jyw_V | Back alignment and structure |
|---|
| >3v2d_P 50S ribosomal protein L15; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 1vsp_J 2hgj_O 2hgq_O 2hgu_O 1vsa_J 2j03_P 2jl6_P 2jl8_P 2v47_P 2v49_P 2wdi_P 2wdj_P 2wdl_P 2wdn_P 2wh2_P 2wh4_P 2wrj_P 2wrl_P 2wro_P 2wrr_P ... | Back alignment and structure |
|---|
| >2zjr_I 50S ribosomal protein L15; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: c.12.1.1 PDB: 1nwx_J* 1nwy_J* 1sm1_J* 1xbp_J* 2zjp_I* 2zjq_I 1nkw_J 3cf5_I* 3dll_I* 3pio_I* 3pip_I* 1pnu_J 1pny_J 1vor_M 1vou_M 1vow_M 1voy_M 1vp0_M | Back alignment and structure |
|---|
| >2zkr_l 60S ribosomal protein L27A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} | Back alignment and structure |
|---|
| >3bbo_N Ribosomal protein L15; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} | Back alignment and structure |
|---|
| >3j21_P 50S ribosomal protein L18E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1vq8_O 50S ribosomal protein L18E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.12.1.1 PDB: 1vq4_O* 1vq5_O* 1vq6_O* 1vq7_O* 1s72_O* 1vq9_O* 1vqk_O* 1vql_O* 1vqm_O* 1vqn_O* 1vqo_O* 1vqp_O* 1yhq_O* 1yi2_O* 1yij_O* 1yit_O* 1yj9_O* 1yjn_O* 1yjw_O* 2otj_O* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 244 | ||||
| d1vqoo1 | 115 | c.12.1.1 (O:1-115) Ribosomal protein L18e {Archaeo | 3e-16 | |
| d1vqoo1 | 115 | c.12.1.1 (O:1-115) Ribosomal protein L18e {Archaeo | 7e-05 |
| >d1vqoo1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 115 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribosomal proteins L15p and L18e superfamily: Ribosomal proteins L15p and L18e family: Ribosomal proteins L15p and L18e domain: Ribosomal protein L18e species: Archaeon Haloarcula marismortui [TaxId: 2238]
Score = 70.1 bits (172), Expect = 3e-16
Identities = 12/85 (14%), Positives = 29/85 (34%), Gaps = 4/85 (4%)
Query: 56 DVYLELLVKLYRFLTRRTNSKFNKIILKRLFMSKINRPPMAISKIVRFMKKPTREGRVAV 115
+ L L+ + R + + +RL + + + +I R+ + E V
Sbjct: 4 NPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQ----EDETVV 59
Query: 116 IVGTIVDDPRMWTIPKLTIVRFMKK 140
+ G ++ + + V F
Sbjct: 60 VPGKVLGSGVLQKDVTVAAVDFSGT 84
|
| >d1vqoo1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 115 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 244 | |||
| d1vqoo1 | 115 | Ribosomal protein L18e {Archaeon Haloarcula marism | 100.0 | |
| d1vqoo1 | 115 | Ribosomal protein L18e {Archaeon Haloarcula marism | 98.41 | |
| d1vqol1 | 150 | Ribosomal protein L15 (L15p) {Archaeon Haloarcula | 97.84 | |
| d2j01p1 | 146 | Ribosomal protein L15 (L15p) {Thermus thermophilus | 96.61 | |
| d2zjri1 | 141 | Ribosomal protein L15 (L15p) {Deinococcus radiodur | 96.52 | |
| d2gycj1 | 140 | Ribosomal protein L15 (L15p) {Escherichia coli [Ta | 96.43 |
| >d1vqoo1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribosomal proteins L15p and L18e superfamily: Ribosomal proteins L15p and L18e family: Ribosomal proteins L15p and L18e domain: Ribosomal protein L18e species: Archaeon Haloarcula marismortui [TaxId: 2238]
Probab=100.00 E-value=8.6e-39 Score=256.00 Aligned_cols=105 Identities=14% Similarity=0.181 Sum_probs=101.4
Q ss_pred CcCHHHHHHHHHHHHHhhhcCchHHHHHHHHHhccccCCCcccHHHHHHHhcCCCCCCCEEEEEeeeecCCcccccCcee
Q psy2274 54 SKDVYLELLVKLYRFLTRRTNSKFNKIILKRLFMSKINRPPMAISKIVRFMKKPTREGRVAVIVGTIVDDPRMWTIPKLT 133 (244)
Q Consensus 54 StN~yL~lLIklyr~laRrt~a~fwk~VakRL~msrrnR~pVnLSKI~R~~k~~~~egkivVVvGKVldDgrL~eVPKlt 133 (244)
+|||||++||++|+++||+++|+||++||+||+|||++|+|||||||+++++ +|+++||||||||||+|. ++++
T Consensus 2 kTNp~l~~lI~~lk~~sr~~~a~iwk~va~rL~~~rr~r~~VnLski~~~~k----~~~~vvvpgKVLg~G~l~--~k~~ 75 (115)
T d1vqoo1 2 KTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQ----EDETVVVPGKVLGSGVLQ--KDVT 75 (115)
T ss_dssp CCCHHHHHHHHHHHHHHHHSSCSHHHHHHHHHHSCGGGSEEEEHHHHHHHCC----TTSEEEEEEEEECCSCCC--SCCE
T ss_pred CCCHHHHHHHHHHHHHHhhhcCHHHHHHHHHHhcccccCCCccHHHHHHhcc----CCCEEEEeeEEecccEEc--CCEE
Confidence 6899999999999999999999999999999999999999999999999998 899999999999999998 5999
Q ss_pred EEEeeeccchhhhhhhcCcEEeehhhhhc-CCC
Q psy2274 134 IVRFMKKPTREGRVAVIVGTIVDDPRMWT-IPK 165 (244)
Q Consensus 134 V~AL~fS~sAr~KI~kAGGki~TidrL~e-NPK 165 (244)
|||++||++|++||+.+|| +++++||++ ||+
T Consensus 76 V~A~~fS~sA~~kI~~aGg-~iti~el~~~nP~ 107 (115)
T d1vqoo1 76 VAAVDFSGTAETKIDQVGE-AVSLEQAIENNPE 107 (115)
T ss_dssp EEEEEECHHHHHHHHHHSE-EEEHHHHHHHCTT
T ss_pred EEEeecCHHHHHHHHHcCC-EEEHHHHHHHCCC
Confidence 9999999999999998865 899999998 998
|
| >d1vqoo1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1vqol1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2j01p1 c.12.1.1 (P:5-150) Ribosomal protein L15 (L15p) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2zjri1 c.12.1.1 (I:4-144) Ribosomal protein L15 (L15p) {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2gycj1 c.12.1.1 (J:4-143) Ribosomal protein L15 (L15p) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|