Psyllid ID: psy2279

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830
MPICSKEDFEHEYGQASSDNRQLVLEALQRSQEAVTKLPEPCFKELDDYKHLDSISRPTAYIRFIEKNADELDEEVEYDMDEEDASWLNIMNEQRKISNLPPLAIDTFELLMDRLEKECQFQMSHTQSQDIIDDEAVCCICNDGECQNSNVILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLHTPSRAVDCVLCPNNGGAFKLTDRGAWAHVVCALWIPEVRFANTVFLEPIDSIEAIPAARWKLTCYVCKQRGVGACIQCHKTNCYAAFHVTCAQQAGLYMNMDTIRDHSGVEPVVVQKLAYCDAHTPPDVQHRPRLPAPSDEKLKNARLVLAKKRVSVPTVSIPTIPPERVQDIAQLISVPKKSQLMNRLIAYWTIKRQLRNGVPLLRRLQSSHQARRDEHCKIMSNTPENGNITELYHELKYWQCLRQDLERARLLCELVRKREKMKRELIKVTEACTMIKLNPLNSLLLQLIDLIKARDTGDIFLEPVDVIEVPDYADVIKQPMDLTTMTNKVKANQYLSLEDFENDFNLMVENCLTYNEKDTIFYKAGIKMKQVGGALINQAAKTLNDAGFDQIGSILPGTSAKGVNSSDVVHMEETSKAENNKQEEKKNSTDVVMGMSSKDTKNFKSPEITTRKRHGNKKKGAQEELSVPESDSFKVYRSGGELKGEAFDSAEEGGEDGEENSSCSECSSSCDSSDSESGSSVSGSHTFEQLQLVWAKCRGYPWYPALIINPQMPLGYIHNGVPIPSPPEDVLALANNYTEPVYLVLFFDTKRTWQWLPRNKLEPLGITDELDQIKLMESRKPADRKAVKKAYQEALVHKTPS
cccccccccccccccccccccHHHHHHHHcccccccccccccEEEccccccccccccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccccccccEEEEcccccccccccEEEEccccccccccccccccccccccccccccccccccccEEEcccccccccccccccEEEEEEccccccEEEccccccccccccccccHHcccccccccccccccEEEEcccccccccccHHHHHHccccEEEcccccccccccccccEEcccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccccccccccHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHccccHHHHHHccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccEEEEcccccccccccccccccccHHHHHHHccccccEEEEEEEccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccc
cccccHHHHHHHHHcccccccHHHcccccccccccccccccEEEEEccccccccccccHHHEEEccccHHHHHcHEEccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccccccccEEEEEccccEEEEHHHccccccccccHHHHHHcccccccccEEEcccccccEEEcccccEEEEEEEEEEcccEccccEEEccccccccccHHHHEEEEHHHHHccccEEEEEcccccEEEEEHHHHHHcccEEEEEEcccccccccEEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHcccccEEcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcHHHHHHHHHHHHHccccccccccccccccccccccHccccccccccccccccHccccccccccccccHHHHcccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccEEEEccccccccccccccccccHHHHHHHccccccEEEEEEEEccccccEEcccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccc
mpicskedfeheygqassdNRQLVLEALQRSQEAVtklpepcfkelddykhldsisrpTAYIRFIEKNADeldeeveydmdeedASWLNIMNEqrkisnlpplaiDTFELLMDRLEKECQFQmshtqsqdiiddeavccicndgecqnsnVILFCDMcnlavhqdcygvpyipegqwlcrrclhtpsravdcvlcpnnggafkltdrgaWAHVVCALwipevrfantvflepidsieaipAARWKLTCYVCkqrgvgaciqchktncyaaFHVTCAQQaglymnmdtirdhsgvepVVVQKLaycdahtppdvqhrprlpapsdekLKNARLVLAKKrvsvptvsiptippervQDIAQLISVPKKSQLMNRLIAYWTIKRQLRNGVPLLRRLQSSHQARRDEHckimsntpengniTELYHELKYWQCLRQDLERARLLCELVRKREKMKRELIKVTEACTMIKLNPLNSLLLQLIDLIKardtgdiflepvdvievpdyadvikqpmdlttmtnkvkanqylsleDFENDFNLMVENCLTYNEKDTIFYKAGIKMKQVGGALINQAAKTLndagfdqigsilpgtsakgvnssdvvHMEETskaennkqeekknsTDVVMGmsskdtknfkspeittrkrhgnkkkgaqeelsvpesdsfkvyrsggelkgeafdsaeeggedgeensscsecssscdssdsesgssvsgshtFEQLQLVWAKcrgypwypaliinpqmplgyihngvpipsppeDVLALANNYTEPVYLVLFFDtkrtwqwlprnkleplgitdeldQIKLMESRKPADRKAVKKAYQEALVHKTPS
mpicskedfeheygqassdNRQLVLEALQRSQEAVTKLPEPCFKELDDYKHLDSISRPTAYIRFIEKNADELDEEVEYDMDEEDASWLNIMNEqrkisnlppLAIDTFELLMDRLEKECQFQMSHTQSQDIIDDEAVCCICNDGECQNSNVILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLHTPSRAVDCVLCPNNGGAFKLTDRGAWAHVVCALWIPEVRFANTVFLEPIDSIEAIPAARWKLTCYVCKQRGVGACIQCHKTNCYAAFHVTCAQQAGLYMNMDTIRDHSGVEPVVVQKLAYCDAhtppdvqhrprlpapsdekLKNARLVLakkrvsvptvsiptippervqDIAQLisvpkksqlMNRLIAYWTIKRQLRNGVPLLRRLQSshqarrdehckimsntpengNITELYHELKYWQCLRQDLERARLLCELVRKREKMKRELIKVTeactmiklnpLNSLLLQLIDLIKARDTGDIFLepvdvievpdyADVIKQPMDLTTMTNKVKANQYLSLEDFENDFNLMVENCLTYNEKDTIFYKAGIKMKQVGGALINQAAKTLNDAGFDQIGSILPGTSAKGVNSSDVVHMEEtskaennkqeekknstdvvmgmsskdtknfkspeittrkrhgnkkkgaqeelsvpesdsfkvYRSGGELKGEAFDSAEEGGEDGEENSSCSECSSSCDSSDSESGSSVSGSHTFEQLQLVWAKCRGYPWYPALIINPQMPLGYIHNGVPIPSPPEDVLALANNYTEPVYLVLFFDTKrtwqwlprnkleplgitdeldQIKLMesrkpadrkaVKKAYQealvhktps
MPICSKEDFEHEYGQASSDNRQLVLEALQRSQEAVTKLPEPCFKELDDYKHLDSISRPTAYIRFIEKNAdeldeeveydmdeedASWLNIMNEQRKISNLPPLAIDTFELLMDRLEKECQFQMSHTQSQDIIDDEAVCCICNDGECQNSNVILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLHTPSRAVDCVLCPNNGGAFKLTDRGAWAHVVCALWIPEVRFANTVFLEPIDSIEAIPAARWKLTCYVCKQRGVGACIQCHKTNCYAAFHVTCAQQAGLYMNMDTIRDHSGVEPVVVQKLAYCDAHTPPDVQHRPRLPAPSDEKLKNARLVLAKKRVSVPTVSIPTIPPERVQDIAQLISVPKKSQLMNRLIAYWTIKRQLRNGVPLLRRLQSSHQARRDEHCKIMSNTPENGNITELYHELKYWQCLRQDLERARLLCELVRKREKMKRELIKVTEACTMIKlnplnslllqlidliKARDTGDIFLEPVDVIEVPDYADVIKQPMDLTTMTNKVKANQYLSLEDFENDFNLMVENCLTYNEKDTIFYKAGIKMKQVGGALINQAAKTLNDAGFDQIGSILPGTSAKGVNSSDVVHMEETSKAennkqeekknSTDVVMGMSSKDTKNFKSPEITTRKRHGNKKKGAQEELSVPESDSFKVYRSGGELKGEAFdsaeeggedgeensscsecssscdssdsesgssvsgsHTFEQLQLVWAKCRGYPWYPALIINPQMPLGYIHNGVPIPSPPEDVLALANNYTEPVYLVLFFDTKRTWQWLPRNKLEPLGITDELDQIKLMESRKPADRKAVKKAYQEALVHKTPS
***************************************EPCFKELDDYKHLDSISRPTAYIRFIEKNADEL***V*Y*****DASWLNIMNEQRKISNLPPLAIDTFELLMDRLEKECQFQMSHTQSQDIIDDEAVCCICNDGECQNSNVILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLHTPSRAVDCVLCPNNGGAFKLTDRGAWAHVVCALWIPEVRFANTVFLEPIDSIEAIPAARWKLTCYVCKQRGVGACIQCHKTNCYAAFHVTCAQQAGLYMNMDTIRDHSGVEPVVVQKLAYCDAH***********************LVLAKKRVSVPTVSIPTIPPERVQDIAQLISVPKKSQLMNRLIAYWTIKRQLRNGVPLLRR*********************NGNITELYHELKYWQCLRQDLERARLLCELVRKREKMKRELIKVTEACTMIKLNPLNSLLLQLIDLIKARDTGDIFLEPVDVIEVPDYADVIKQPMDLTTMTNKVKANQYLSLEDFENDFNLMVENCLTYNEKDTIFYKAGIKMKQVGGALINQAAKTLNDAGFDQIGSIL***********************************************************************************************************************************FEQLQLVWAKCRGYPWYPALIINPQMPLGYIHNGVPIPSPPEDVLALANNYTEPVYLVLFFDTKRTWQWLPRNKLEPLGITDEL*******************************
*P***************************************CFKELDDYKHLDSISRPTAYIRFIEKNADELDEEVEYDMDEEDASWLNIMNEQRKISNLPPLAIDTFELLMDRLEKE*****************AVCCICNDGECQNSNVILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLHTPSRAVDCVLCPNNGGAFKLTDRGAWAHVVCALWIPEVRFANTVFLEPIDSIEAIPAARWKLTCYVCKQRGVGACIQCHKTNCYAAFHVTCAQQAGLYMNMDTIRDHSGVEPVVVQKLAYCDAHTPP************************************TIPPERVQDIAQLISVPKKSQLMNRLIAYWTIKRQLRNGVPLL*********************************LKYWQCLRQDLERARL************RELIKVTEACTMIKLNPLNSLLLQLIDLIKARDTGDIFLEPVDVIEVPDYADVIKQPMDLTTMTNKVKANQYLSLEDFENDFNLMVENCLTYNEKDTIFYKAGIKM******************************************************************************************************************************************************************QLVWAKCRGYPWYPALIINPQMPLGYIHNGVPIPSPPEDVLA**NNYTEPVYLVLFFDTKRTWQWLPRNKLEPLGITDELD*****************KAYQEALVH****
MPICSKEDFEHEYGQASSDNRQLVLEALQRSQEAVTKLPEPCFKELDDYKHLDSISRPTAYIRFIEKNADELDEEVEYDMDEEDASWLNIMNEQRKISNLPPLAIDTFELLMDRLEKEC********SQDIIDDEAVCCICNDGECQNSNVILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLHTPSRAVDCVLCPNNGGAFKLTDRGAWAHVVCALWIPEVRFANTVFLEPIDSIEAIPAARWKLTCYVCKQRGVGACIQCHKTNCYAAFHVTCAQQAGLYMNMDTIRDHSGVEPVVVQKLAYCDAHTPPDVQHRPRLPAPSDEKLKNARLVLAKKRVSVPTVSIPTIPPERVQDIAQLISVPKKSQLMNRLIAYWTIKRQLRNGVPLLRRLQ********EHCKIMSNTPENGNITELYHELKYWQCLRQDLERARLLCELVRKREKMKRELIKVTEACTMIKLNPLNSLLLQLIDLIKARDTGDIFLEPVDVIEVPDYADVIKQPMDLTTMTNKVKANQYLSLEDFENDFNLMVENCLTYNEKDTIFYKAGIKMKQVGGALINQAAKTLNDAGFDQIGSILPGTSAK*******************************MGMSSKDTKNFKSPEI**********************DSFKVYRSGGELKGE****************************************TFEQLQLVWAKCRGYPWYPALIINPQMPLGYIHNGVPIPSPPEDVLALANNYTEPVYLVLFFDTKRTWQWLPRNKLEPLGITDELDQIKLMES***********************
MPICSKEDFEHEYGQAS**NR************AVTKLPEPCFKELDDYKHLDSISRPTAYIRFIEKNADELDEEVEYDMDEEDASWLNIMNEQRKISNLPPLAIDTFELLMDRLEKECQFQMSH**SQDIIDDEAVCCICNDGECQNSNVILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLHTPSRAVDCVLCPNNGGAFKLTDRGAWAHVVCALWIPEVRFANTVFLEPIDSIEAIPAARWKLTCYVCKQRGVGACIQCHKTNCYAAFHVTCAQQAGLYMNMDTIRDHSGVEPVVVQKLAYCDAHTP****************************VSVPTVSIPTIPPERVQDIAQLISVPKKSQLMNRLIAYWTIKRQLRNGVPLLRRLQSS*****************NGNITELYHELKYWQCLRQDLERARLLCELVRKREKMKRELIKVTEACTMIKLNPLNSLLLQLIDLIKARDTGDIFLEPVDVIEVPDYADVIKQPMDLTTMTNKVKANQYLSLEDFENDFNLMVENCLTYNEKDTIFYKAGIKMKQVGGALINQAAKTLNDAG*****************************************************************************************************************************************HTFEQLQLVWAKCRGYPWYPALIINPQMPLGYIHNGVPIPSPPEDVLALANNYTEPVYLVLFFDTKRTWQWLPRNKLEPLGITDELDQIKLMESRKPADRKAVKKAYQEALV*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPICSKEDFEHEYGQASSDNRQLVLEALQRSQEAVTKLPEPCFKELDDYKHLDSISRPTAYIRFIEKNADELDEEVEYDMDEEDASWLNIMNEQRKISNLPPLAIDTFELLMDRLEKECQFQMSHTQSQDIIDDEAVCCICNDGECQNSNVILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLHTPSRAVDCVLCPNNGGAFKLTDRGAWAHVVCALWIPEVRFANTVFLEPIDSIEAIPAARWKLTCYVCKQRGVGACIQCHKTNCYAAFHVTCAQQAGLYMNMDTIRDHSGVEPVVVQKLAYCDAHTPPDVQHRPRLPAPSDEKLKNARLVLAKKRVSVPTVSIPTIPPERVQDIAQLISVPKKSQLMNRLIAYWTIKRQLRNGVPLLRRLQSSHQARRDEHCKIMSNTPENGNITELYHELKYWQCLRQDLERARLLCELVRKREKMKRELIKVTEACTMIKLNPLNSLLLQLIDLIKARDTGDIFLEPVDVIEVPDYADVIKQPMDLTTMTNKVKANQYLSLEDFENDFNLMVENCLTYNEKDTIFYKAGIKMKQVGGALINQAAKTLNDAGFDQIGSILPGTSAKGVNSSDVVHMEETSKAENNKQEEKKNSTDVVMGMSSKDTKNFKSPEITTRKRHGNKKKGAQEELSVPESDSFKVYRSGGELKGEAFDSAEEGGEDGEENSSCSECSSSCDSSDSESGSSVSGSHTFEQLQLVWAKCRGYPWYPALIINPQMPLGYIHNGVPIPSPPEDVLALANNYTEPVYLVLFFDTKRTWQWLPRNKLEPLGITDELDQIKLMESRKPADRKAVKKAYQEALVHKTPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query830 2.2.26 [Sep-21-2011]
P55201 1214 Peregrin OS=Homo sapiens yes N/A 0.665 0.454 0.564 0.0
O95696 1058 Bromodomain-containing pr no N/A 0.687 0.539 0.489 1e-164
Q9ULD4 1205 Bromodomain and PHD finge no N/A 0.659 0.453 0.462 1e-152
Q20318 1042 Protein lin-49 OS=Caenorh yes N/A 0.543 0.432 0.333 1e-78
Q12311748 NuA3 HAT complex componen yes N/A 0.481 0.534 0.291 3e-57
O74759767 Mst2 complex subunit nto1 yes N/A 0.5 0.541 0.311 6e-57
Q803A0829 Protein Jade-1 OS=Danio r no N/A 0.428 0.429 0.335 1e-56
Q6IE81842 Protein Jade-1 OS=Homo sa no N/A 0.469 0.463 0.327 5e-56
Q6ZPI0834 Protein Jade-1 OS=Mus mus no N/A 0.471 0.468 0.321 3e-55
Q6GQJ2827 Protein Jade-1 OS=Xenopus N/A N/A 0.480 0.482 0.311 1e-54
>sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 Back     alignment and function desciption
 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/593 (56%), Positives = 413/593 (69%), Gaps = 41/593 (6%)

Query: 31  SQEAVTKLPEPCFKELDDYKHLDSISRPTAYIRFIEKNADELDEEVEYDMDEEDASWLNI 90
           S     KLPE  ++EL+     D+  RPT+Y R+IEK+A+ELDEEVEYDMDEED  WL+I
Sbjct: 169 SASTTPKLPEVVYRELEQ-DTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDI 227

Query: 91  MNEQRKISNLPPLAIDTFELLMDRLEKECQFQMSHTQS--QDIIDDEAVCCICNDGECQN 148
           MNE+RK   + P+  + FE LMDRLEKE  F+ SH +     ++D++AVCCICNDGECQN
Sbjct: 228 MNERRKTEGVSPIPQEIFEYLMDRLEKESYFE-SHNKGDPNALVDEDAVCCICNDGECQN 286

Query: 149 SNVILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLHTPSRAVDCVLCPNNGGAFKLTDRG 208
           SNVILFCDMCNLAVHQ+CYGVPYIPEGQWLCRRCL +PSRAVDC LCPN GGAFK TD G
Sbjct: 287 SNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDG 346

Query: 209 AWAHVVCALWIPEVRFANTVFLEPIDSIEAIPAARWKLTCYVCKQRGVGACIQCHKTNCY 268
            WAHVVCALWIPEV FANTVFLEPIDSIE IP ARWKLTCY+CKQRG GACIQCHK NCY
Sbjct: 347 RWAHVVCALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCY 406

Query: 269 AAFHVTCAQQAGLYMNMDTIRD-HSGVEPVVVQKLAYCDAHTPPDVQHRPRLPAPSDE-- 325
            AFHVTCAQQAGLYM M+ +R+  +      V+K AYCD HTPP      RLPA S    
Sbjct: 407 TAFHVTCAQQAGLYMKMEPVRETGANGTSFSVRKTAYCDIHTPPGSAR--RLPALSHSEG 464

Query: 326 ----------------------------KLKNARLVLAKKRVSVPTVSIPTIPPERVQDI 357
                                       K+K AR +LA+KR + P VS+P IPP R+  I
Sbjct: 465 EEDEDEEEDEGKGWSSEKVKKAKAKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKI 524

Query: 358 AQLISVPKKSQLMNRLIAYWTIKRQLRNGVPLLRRLQSSHQARRDEHCKIMSNTPENGNI 417
              +++ +KSQ M RL +YWT+KRQ RNGVPLLRRLQ+  Q++R+  C  +    E+ N 
Sbjct: 525 TNRLTIQRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRN--CDQVGRDSEDKNW 582

Query: 418 TELYHELKYWQCLRQDLERARLLCELVRKREKMKRELIKVTEACTMIKLNPLNSLLLQLI 477
             L  +LK WQ LR DLERARLL EL+RKREK+KRE IKV +    ++L P   LL + +
Sbjct: 583 A-LKEQLKSWQRLRHDLERARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTL 641

Query: 478 DLIKARDTGDIFLEPVDVIEVPDYADVIKQPMDLTTMTNKVKANQYLSLEDFENDFNLMV 537
           + ++ +DTG+IF EPV + EVPDY D IK+PMD  TM   ++A +YL+ +DFE DFNL+V
Sbjct: 642 EQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIV 701

Query: 538 ENCLTYNEKDTIFYKAGIKMKQVGGALINQAAKTLNDAGFD-QIGSILPGTSA 589
            NCL YN KDTIFY+A +++++ GGA++ QA +     G D + G  +P + A
Sbjct: 702 SNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGIDFETGMHIPHSLA 754
Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. Positively regulates the transcription of RUNX1 and RUNX2.
Homo sapiens (taxid: 9606)
>sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 Back     alignment and function description
>sp|Q20318|LIN49_CAEEL Protein lin-49 OS=Caenorhabditis elegans GN=lin-49 PE=1 SV=1 Back     alignment and function description
>sp|Q12311|NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTO1 PE=1 SV=1 Back     alignment and function description
>sp|O74759|NTO1_SCHPO Mst2 complex subunit nto1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nto1 PE=1 SV=1 Back     alignment and function description
>sp|Q803A0|JADE1_DANRE Protein Jade-1 OS=Danio rerio GN=phf17 PE=2 SV=1 Back     alignment and function description
>sp|Q6IE81|JADE1_HUMAN Protein Jade-1 OS=Homo sapiens GN=PHF17 PE=1 SV=1 Back     alignment and function description
>sp|Q6ZPI0|JADE1_MOUSE Protein Jade-1 OS=Mus musculus GN=Phf17 PE=1 SV=2 Back     alignment and function description
>sp|Q6GQJ2|JADE1_XENLA Protein Jade-1 OS=Xenopus laevis GN=phf17 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query830
307185016898 Peregrin [Camponotus floridanus] 0.930 0.859 0.566 0.0
383854062896 PREDICTED: peregrin-like [Megachile rotu 0.910 0.843 0.569 0.0
91087827 1031 PREDICTED: similar to AGAP007617-PA [Tri 0.962 0.774 0.519 0.0
380017223894 PREDICTED: LOW QUALITY PROTEIN: peregrin 0.910 0.845 0.568 0.0
66513632895 PREDICTED: peregrin-like [Apis mellifera 0.913 0.846 0.568 0.0
345493074 951 PREDICTED: peregrin-like [Nasonia vitrip 0.983 0.858 0.534 0.0
340729726898 PREDICTED: LOW QUALITY PROTEIN: peregrin 0.959 0.886 0.545 0.0
350411600898 PREDICTED: peregrin-like [Bombus impatie 0.959 0.886 0.545 0.0
307192025891 Peregrin [Harpegnathos saltator] 0.921 0.858 0.554 0.0
242022015 1244 Bromodomain and PHD finger-containing pr 0.726 0.484 0.600 0.0
>gi|307185016|gb|EFN71245.1| Peregrin [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/836 (56%), Positives = 569/836 (68%), Gaps = 64/836 (7%)

Query: 24  VLEALQRSQEAVTKLPEPCFKELDDYKHLDSISR----PTAYIRFIEKNADELDEEVEYD 79
           +LE  +  +  ++ LP    KE++ Y+  D + +    P +YIRF+E++ +ELD EVEYD
Sbjct: 81  LLEKEKEDKNILSTLPVATVKEIEGYE--DQLGKAEPLPNSYIRFMERSGEELDGEVEYD 138

Query: 80  MDEEDASWLNIMNEQRKISNL-PPLAIDTFELLMDRLEKECQFQMSHTQSQDIIDDE-AV 137
           +DEED +WL+I+NE+R  S L P L  D FELLMDRLEKE  FQ        I  DE AV
Sbjct: 139 LDEEDTAWLSIVNERRLASGLTPALEPDIFELLMDRLEKESYFQQQSNGGGGIAADEDAV 198

Query: 138 CCICNDGECQNSNVILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLHTPSRAVDCVLCPN 197
           CCIC DGECQNSN ILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCL +PSRAVDCVLCPN
Sbjct: 199 CCICMDGECQNSNAILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLQSPSRAVDCVLCPN 258

Query: 198 NGGAFKLTDR-GAWAHVVCALWIPEVRFANTVFLEPIDSIEAIPAARWKLTCYVCKQRGV 256
            GGAFK TDR  AWAHVVCALWIPEVRFANTVFLEPIDSIE+IP ARWKLTC VCK+RG 
Sbjct: 259 RGGAFKQTDRPAAWAHVVCALWIPEVRFANTVFLEPIDSIESIPQARWKLTCCVCKRRGA 318

Query: 257 GACIQCHKTNCYAAFHVTCAQQAGLYMNMDTIRDHSGVEPVVVQKLAYCDAHTPPDVQHR 316
           GACIQCHK+NCYAAFHVTCAQQAGL M M T++  +G EP++VQK AYC+AHTP D Q  
Sbjct: 319 GACIQCHKSNCYAAFHVTCAQQAGLCMRMRTVQPANG-EPMLVQKTAYCEAHTPVDYQ-- 375

Query: 317 PRLPAPSDEKLKNARLVLA-KKRVSVPTVSIPTIPPERVQDIAQLI-SVPKKSQLMNRLI 374
                PS   +   R  +A KK  S P +SIPTIPPER+++IA L   VPK+SQL+ RLI
Sbjct: 376 -----PSTNPVDARRRAIANKKSSSAPVISIPTIPPERIREIASLAEGVPKRSQLIQRLI 430

Query: 375 AYWTIKRQLRNGVPLLRRLQSSHQARRDEHCKIMSNTPENGN--ITELYHELKYWQCLRQ 432
           AYWT+KRQ RNGVPLLRRLQSSH   R       S++P + +    ELY +LKYWQCLRQ
Sbjct: 431 AYWTLKRQYRNGVPLLRRLQSSHPQSRPPPLGEHSSSPTHDSELREELYRQLKYWQCLRQ 490

Query: 433 DLERARLLCELVRKREKMKRELIKVTEACTMIKLNPLNSLLLQLIDLIKARDTGDIFLEP 492
           DLERARLLCELVRKREK+K+EL KV E C   +L PL S+L  L++ IKA+D  D+F +P
Sbjct: 491 DLERARLLCELVRKREKLKKELFKVKEKCLWFELRPLESVLRTLLEAIKAKDVNDVFGQP 550

Query: 493 VDVIEVPDYADVIKQPMDLTTMTNKVKANQYLSLEDFENDFNLMVENCLTYNEKDTIFYK 552
           V+  EVPDY +++  PMDL+TM  K++  +Y S+  FE DFNLMV NCL YN KDT+FY+
Sbjct: 551 VNTKEVPDYLEIVSHPMDLSTMQAKLEKQEYDSITAFETDFNLMVNNCLAYNRKDTMFYR 610

Query: 553 AGIKMKQVGGALINQAAKTLNDAGFDQIGSILPGTSAKGVNSSDVVHMEETSKAENNKQE 612
           AG+KMK+ GGALI+QA K   +        + P    + V S       E S   + + E
Sbjct: 611 AGVKMKEQGGALIDQARKDYPE--------LDPVIEPEQVGSKS--RKRERSNRSSTRLE 660

Query: 613 EKKNSTDVVMGMSSKDTKNFKSPEITTRKRHGNKKKGAQEELS----VPESDSFKVYRSG 668
            +  S +  +G       N ++  + TRK      K  Q  LS      +SDSFKVYRSG
Sbjct: 661 TESQSNEKEIGGGG---VNRRTAVLFTRKARARNAKSGQMFLSEDDKKKQSDSFKVYRSG 717

Query: 669 GELKGEAFDSAEEGGE-----------------DGEENSSCSECSSSCDSSDSESGSSVS 711
                   DS    GE                 D EE     E +   D+        ++
Sbjct: 718 ------TMDSDIGEGESQSSSCSSCPTSRSTTPDPEEEKQRQEIA---DTKKENESKQIN 768

Query: 712 GSHTFEQLQLVWAKCRGYPWYPALIINPQMPLGYIHNGVPIPSPPEDVLALANNYTEPVY 771
            S   E LQLVWAKCRGYPWYPALII+P  P G IH GVPIP+PP+DVLALA+NY EPV+
Sbjct: 769 TSTGLEALQLVWAKCRGYPWYPALIIDPNTPRGTIHKGVPIPAPPDDVLALADNYKEPVF 828

Query: 772 LVLFFDTKRTWQWLPRNKLEPLGITDELDQIKLMESRKPADRKAVKKAYQEALVHK 827
           LVLFFDTKRTWQWLP  KLE LG++ E+D+ KL+ESRKPADRKAVKKAYQEAL ++
Sbjct: 829 LVLFFDTKRTWQWLPGEKLEKLGVSQEVDEAKLIESRKPADRKAVKKAYQEALHYR 884

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383854062|ref|XP_003702541.1| PREDICTED: peregrin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|91087827|ref|XP_967270.1| PREDICTED: similar to AGAP007617-PA [Tribolium castaneum] gi|270011999|gb|EFA08447.1| hypothetical protein TcasGA2_TC006094 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380017223|ref|XP_003692559.1| PREDICTED: LOW QUALITY PROTEIN: peregrin-like [Apis florea] Back     alignment and taxonomy information
>gi|66513632|ref|XP_395348.2| PREDICTED: peregrin-like [Apis mellifera] Back     alignment and taxonomy information
>gi|345493074|ref|XP_001599557.2| PREDICTED: peregrin-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340729726|ref|XP_003403147.1| PREDICTED: LOW QUALITY PROTEIN: peregrin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350411600|ref|XP_003489398.1| PREDICTED: peregrin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307192025|gb|EFN75409.1| Peregrin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242022015|ref|XP_002431437.1| Bromodomain and PHD finger-containing protein, putative [Pediculus humanus corporis] gi|212516725|gb|EEB18699.1| Bromodomain and PHD finger-containing protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query830
FB|FBgn0033155 1430 Br140 [Drosophila melanogaster 0.649 0.376 0.582 8.2e-217
UNIPROTKB|F1P2H3 1138 BRPF1 "Uncharacterized protein 0.346 0.253 0.646 4.8e-203
RGD|1584828 1246 Brpf1 "bromodomain and PHD fin 0.343 0.228 0.653 2.4e-202
UNIPROTKB|P55201 1214 BRPF1 "Peregrin" [Homo sapiens 0.346 0.237 0.643 8e-202
UNIPROTKB|F1SQG0 1214 BRPF1 "Uncharacterized protein 0.346 0.237 0.643 8e-202
UNIPROTKB|I3LMI5 1248 BRPF1 "Uncharacterized protein 0.346 0.230 0.643 8e-202
UNIPROTKB|E1BPS1 1213 BRPF1 "Uncharacterized protein 0.346 0.237 0.643 1e-201
UNIPROTKB|E2RH23 1220 BRPF1 "Uncharacterized protein 0.346 0.236 0.643 8.1e-200
ZFIN|ZDB-GENE-040426-731 1258 brpf1 "bromodomain and PHD fin 0.337 0.222 0.645 1.9e-194
RGD|1311855 1189 Brd1 "bromodomain containing 1 0.402 0.280 0.531 6.9e-184
FB|FBgn0033155 Br140 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1664 (590.8 bits), Expect = 8.2e-217, Sum P(3) = 8.2e-217
 Identities = 319/548 (58%), Positives = 386/548 (70%)

Query:    34 AVTKLPEPCFKELDDYKHLDSISRPTAYIRFIEKNAXXXXXXXXXXXXXXXASWLNIMNE 93
             A  ++P     E+ DY+  D+  RP AY RFIEK+                ++WL  MNE
Sbjct:   180 ARVQVPVARVAEIPDYRVSDAPPRPLAYYRFIEKSLEELDGEVEYDVDEEDSAWLEHMNE 239

Query:    94 QRKISNLPPLAIDTFELLMDRLEKECQFQMSH--TQSQDIIDDEAVCCICNDGECQNSNV 151
             +R+   L  + IDT ELLMDRLEKE  FQ +   T +   +DD+AVCCIC DGECQN+NV
Sbjct:   240 ERQRLGLNAVGIDTMELLMDRLEKESHFQAAANGTPTGVEVDDDAVCCICLDGECQNTNV 299

Query:   152 ILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLHTPSRAVDCVLCPNNGGAFKLTDRGAWA 211
             ILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCL +PS+ V+CVLCPN GGAFK TD G WA
Sbjct:   300 ILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLQSPSKPVNCVLCPNAGGAFKQTDHGQWA 359

Query:   212 HVVCALWIPEVRFANTVFLEPIDSIEAIPAARWKLTCYVCKQRGVGACIQCHKTNCYAAF 271
             HVVCALWIPEVRFANTVFLEPIDSIE IP ARW+LTCYVCK++G+GACIQCH+ +CYAAF
Sbjct:   360 HVVCALWIPEVRFANTVFLEPIDSIETIPPARWRLTCYVCKEKGLGACIQCHRNSCYAAF 419

Query:   272 HVTCAQQAGLYMNMDTIRDHSGVEPVVVQKLAYCDAHTPPDVQHRPRLPAPSD--EKLKN 329
             HVTCAQQAGLYM MDT++D      + VQK AYC AHTP D + +  +P   D   K+K 
Sbjct:   420 HVTCAQQAGLYMTMDTVKDGHNDSSMHVQKFAYCHAHTPADAKLKMNVPDFEDTRHKMKE 479

Query:   330 ARLVLAKKRVSVPTVSIPTIPPERVQDIAQLISVPKKSQLMNRLIAYWTIKRQLRNGVPL 389
             AR  LAKKR + P V IPTIPP+RVQ+IA ++++ +K + ++R+IAYWT+KR  RNGVPL
Sbjct:   480 ARKALAKKRSTAPVVLIPTIPPDRVQEIATMVTMQRKKEFLDRIIAYWTLKRHYRNGVPL 539

Query:   390 LRRLQSSHQARRDEHCKIMSNTPENGNIT-ELYHELKYWQCLRQDLERARLLCELVRKRE 448
             LRRLQS    + + H  I  N  E    T ELY +LKYWQCLRQDLERARLLCELVRKRE
Sbjct:   540 LRRLQS----QGNNHGVIQRNGIEGSPDTGELYRQLKYWQCLRQDLERARLLCELVRKRE 595

Query:   449 KMKRELIKVTEACTMIKXXXXXXXXXXXXXXXKARDTGDIFLEPVDVIEVPDYADVIKQP 508
             K+K   ++++E   M++               +ARD+  IF EPVD  EVPDY D++KQP
Sbjct:   596 KLKVAFVRISEEVVMLQLNPLEAALNKLLDALEARDSMQIFREPVDTSEVPDYTDIVKQP 655

Query:   509 MDLTTMTNKVKANQYLSLEDFENDFNLMVENCLTYNEKDTIFYKAGIKMKQVGGALINQA 568
             MDL TM  K+K  QY SLE  E DF+LM++NCL YN KDT+FY+AGI+M+     L  Q 
Sbjct:   656 MDLGTMRAKLKECQYNSLEQLEADFDLMIQNCLAYNNKDTVFYRAGIRMRDQAAPLFVQV 715

Query:   569 AKTLNDAG 576
              K L   G
Sbjct:   716 RKELQRDG 723
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0033563 "dorsal/ventral axon guidance" evidence=IMP
UNIPROTKB|F1P2H3 BRPF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1584828 Brpf1 "bromodomain and PHD finger containing, 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P55201 BRPF1 "Peregrin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQG0 BRPF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LMI5 BRPF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPS1 BRPF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RH23 BRPF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-731 brpf1 "bromodomain and PHD finger containing, 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1311855 Brd1 "bromodomain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P55201BRPF1_HUMANNo assigned EC number0.56490.66500.4546yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query830
COG5141669 COG5141, COG5141, PHD zinc finger-containing prote 2e-78
pfam13832109 pfam13832, zf-HC5HC2H_2, PHD-zinc-finger like doma 1e-49
cd05839111 cd05839, BR140_related, The PWWP domain is found i 4e-49
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 3e-44
smart00297107 smart00297, BROMO, bromo domain 4e-33
pfam1377189 pfam13771, zf-HC5HC2H, PHD-like zinc-binding domai 2e-31
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 5e-30
cd0436999 cd04369, Bromodomain, Bromodomain 3e-29
pfam10513145 pfam10513, EPL1, Enhancer of polycomb-like 2e-28
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 1e-25
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 7e-22
pfam0043984 pfam00439, Bromodomain, Bromodomain 3e-21
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 5e-21
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 4e-20
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 4e-19
cd0516287 cd05162, PWWP, The PWWP domain, named for a conser 7e-19
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 9e-19
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 2e-18
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 5e-18
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 2e-17
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 7e-17
COG5076371 COG5076, COG5076, Transcription factor involved in 2e-16
pfam1383133 pfam13831, PHD_2, PHD-finger 6e-15
smart0029363 smart00293, PWWP, domain with conserved PWWP motif 5e-14
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 6e-14
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 2e-13
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 7e-13
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 8e-13
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 2e-12
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 4e-12
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 8e-12
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 1e-11
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 1e-11
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 1e-10
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 2e-10
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 5e-10
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 6e-10
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 9e-10
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 2e-09
smart0024947 smart00249, PHD, PHD zinc finger 7e-09
cd0584093 cd05840, SPBC215_ISWI_like, The PWWP domain is a c 9e-09
pfam0062851 pfam00628, PHD, PHD-finger 4e-08
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 4e-07
pfam0085574 pfam00855, PWWP, PWWP domain 2e-06
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 1e-05
cd05501102 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li 4e-05
cd0583895 cd05838, WHSC1_related, The PWWP domain was first 5e-05
cd05837110 cd05837, MSH6_like, The PWWP domain is present in 7e-05
COG5076371 COG5076, COG5076, Transcription factor involved in 0.001
cd0608080 cd06080, MUM1_like, Mutated melanoma-associated an 0.003
>gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information 
 Score =  266 bits (682), Expect = 2e-78
 Identities = 140/457 (30%), Positives = 211/457 (46%), Gaps = 48/457 (10%)

Query: 49  YKHLDSIS-RPTAYIRFI-EKNADELDEEVEYDMDEEDASWLNIMNEQRKISNLPPLAID 106
            KH            +FI  +    L   V YD+DE D  WL  +NE   I     ++ +
Sbjct: 102 SKHAPMSEESHDEGKKFIDIEPPRGLFFSVIYDLDEYDTMWLRYLNE-SAIDE--NVSEE 158

Query: 107 TFELLMDRLEKECQFQMSHTQSQDI----IDDE--AVCCICNDGECQNSNVILFCDMCNL 160
            FE+++ RLEKE  F       + +      DE   +C  C     +NSN I+FCD C +
Sbjct: 159 AFEIIVTRLEKEWFFFEHGLPDKHVEPIEPSDEFDDICTKCTSTHNENSNAIVFCDGCEI 218

Query: 161 AVHQDCYGVPYIPEGQWLCRRCLHTPSRAVDCVLCPNNGGAFKLTDRGAWAHVVCALWIP 220
            VHQ CYG+ ++PEG WLCR+C++   +   C  CP++ GAFK T  G W HV+CA++ P
Sbjct: 219 CVHQSCYGIQFLPEGFWLCRKCIYGEYQIRCCSFCPSSDGAFKQTSDGRWGHVICAMFNP 278

Query: 221 EVRFANTVFLEPIDSIEAIPAARWKLTCYVCKQRGVGACIQCHKTNCYAAFHVTCAQQAG 280
           E+ F + +  +PID+I ++ ++RWKL C +CK+ G G CIQC   NC  A+HVTCA++AG
Sbjct: 279 ELSFGHLLSKDPIDNIASVSSSRWKLGCLICKEFG-GTCIQCSYFNCTRAYHVTCARRAG 337

Query: 281 LYMNMDTIRDHSGVEPVVVQKLAYCDAHTPPDVQHRPRLPAPSDEKLKNARLVLA---KK 337
            +     I  H+G+   +  +   C  H P        L     EKL+      A   K 
Sbjct: 338 YFDL--NIYSHNGISYCIDHE-PLCRKHYPLGYGRMNGLRYFGYEKLRYKNPPTAIPRKV 394

Query: 338 RVSVPTVSI--------PTIPPERVQDIAQLISVPKKSQLMNRLI----AYWTIKRQLRN 385
           R + P  ++        P   P  +  +       K  Q +   I     YW +KR+   
Sbjct: 395 RAARPRATLFMKLCWKQPPATPSVLSRVEACDLKEKDRQDLPVNIFDICKYWEMKRKSEI 454

Query: 386 GVPLLRR--LQSSHQARRDEHCKIMSNTPENGNITELYHELKYWQCLRQDLERARLLCEL 443
           G PL+    +  S +   D     MS       + E+   L       QD  +   L E 
Sbjct: 455 GGPLVILPDIVYSLKTLEDW----MSKR----RMREVAKAL-------QDQYQLLTLVES 499

Query: 444 VRKREKMKRELIKVTEACTMIKLNPLNSLL-LQLIDL 479
             KR+ +K +L  + +    +   P   LL +++IDL
Sbjct: 500 TAKRQLLKCQLSNLRKKFLNLNYFPAQRLLQVKIIDL 536

Length = 669
>gnl|CDD|206003 pfam13832, zf-HC5HC2H_2, PHD-zinc-finger like domain Back     alignment and domain information
>gnl|CDD|99900 cd05839, BR140_related, The PWWP domain is found in the BR140 family, which includes peregrin and BR140-like proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|222368 pfam13771, zf-HC5HC2H, PHD-like zinc-binding domain Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|220792 pfam10513, EPL1, Enhancer of polycomb-like Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99894 cd05162, PWWP, The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|222406 pfam13831, PHD_2, PHD-finger Back     alignment and domain information
>gnl|CDD|214603 smart00293, PWWP, domain with conserved PWWP motif Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|99901 cd05840, SPBC215_ISWI_like, The PWWP domain is a component of the S Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|216154 pfam00855, PWWP, PWWP domain Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily Back     alignment and domain information
>gnl|CDD|99899 cd05838, WHSC1_related, The PWWP domain was first identified in the WHSC1 (Wolf-Hirschhorn syndrome candidate 1) protein, a protein implicated in Wolf-Hirschhorn syndrome (WHS) Back     alignment and domain information
>gnl|CDD|99898 cd05837, MSH6_like, The PWWP domain is present in MSH6, a mismatch repair protein homologous to bacterial MutS Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99903 cd06080, MUM1_like, Mutated melanoma-associated antigen 1 (MUM-1) is a melanoma-associated antigen (MAA) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 830
KOG0955|consensus1051 100.0
KOG0954|consensus893 100.0
COG5141669 PHD zinc finger-containing protein [General functi 100.0
KOG0956|consensus 900 100.0
cd05839111 BR140_related The PWWP domain is found in the BR14 100.0
KOG0957|consensus707 99.97
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 99.92
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.89
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.89
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.88
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.88
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.88
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.88
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.87
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.87
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.87
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.86
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.86
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.86
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.86
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.85
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.84
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.84
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.83
cd05837110 MSH6_like The PWWP domain is present in MSH6, a mi 99.83
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.83
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.83
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.82
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.82
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.82
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.81
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.81
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.81
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.8
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.8
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.8
smart00297107 BROMO bromo domain. 99.8
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.79
PF10513160 EPL1: Enhancer of polycomb-like; InterPro: IPR0195 99.79
KOG1474|consensus640 99.79
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.79
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.78
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.76
cd0584093 SPBC215_ISWI_like The PWWP domain is a component o 99.75
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.75
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.73
cd0516287 PWWP The PWWP domain, named for a conserved Pro-Tr 99.71
KOG1245|consensus1404 99.7
PF1377190 zf-HC5HC2H: PHD-like zinc-binding domain 99.62
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.61
smart0029363 PWWP domain with conserved PWWP motif. conservatio 99.61
cd0583483 HDGF_related The PWWP domain is an essential part 99.59
PF0085586 PWWP: PWWP domain; InterPro: IPR000313 Upon charac 99.58
cd0583895 WHSC1_related The PWWP domain was first identified 99.58
cd0583587 Dnmt3b_related The PWWP domain is an essential com 99.57
cd0584183 BS69_related The PWWP domain is part of BS69 prote 99.56
cd0583686 N_Pac_NP60 The PWWP domain is an essential part of 99.56
COG5076371 Transcription factor involved in chromatin remodel 99.47
KOG1080|consensus1005 99.31
cd0608080 MUM1_like Mutated melanoma-associated antigen 1 (M 99.25
KOG1472|consensus720 99.25
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 99.11
KOG0008|consensus1563 98.81
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 98.78
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 98.74
KOG1827|consensus 629 98.6
KOG1828|consensus418 98.49
KOG0008|consensus1563 98.49
KOG0386|consensus1157 98.45
KOG1904|consensus 496 98.35
KOG1828|consensus418 98.3
KOG1472|consensus720 98.11
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.07
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 97.97
KOG1244|consensus336 97.96
KOG4323|consensus464 97.87
KOG1512|consensus381 97.84
KOG4323|consensus464 97.59
KOG4299|consensus613 97.21
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 97.21
KOG0825|consensus 1134 97.1
KOG1084|consensus375 97.1
KOG1474|consensus 640 97.03
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 96.43
KOG1973|consensus274 96.1
KOG4443|consensus694 95.57
KOG0383|consensus696 95.37
COG5076371 Transcription factor involved in chromatin remodel 95.16
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 94.64
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 93.44
KOG1473|consensus 1414 92.78
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 92.48
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 92.29
KOG1081|consensus 463 89.24
KOG0957|consensus707 89.12
KOG4443|consensus694 88.93
KOG1044|consensus670 87.79
PF0816996 RBB1NT: RBB1NT (NUC162) domain; InterPro: IPR01260 86.49
KOG1512|consensus381 85.55
KOG4299|consensus613 84.95
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 84.18
PF02318118 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 83.76
KOG0644|consensus1113 83.65
KOG0732|consensus 1080 82.8
KOG1244|consensus336 82.77
KOG1973|consensus274 82.03
PF0013053 C1_1: Phorbol esters/diacylglycerol binding domain 80.4
>KOG0955|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.3e-123  Score=1102.33  Aligned_cols=780  Identities=46%  Similarity=0.792  Sum_probs=622.5

Q ss_pred             CCCCCceEEEcCCCCCCCCCCCCcCceecccCChhhcccccccCCChhhHHHHHHHHHhhhcCCCCCCCHHHHHHHHHHH
Q psy2279          36 TKLPEPCFKELDDYKHLDSISRPTAYIRFIEKNADELDEEVEYDMDEEDASWLNIMNEQRKISNLPPLAIDTFELLMDRL  115 (830)
Q Consensus        36 ~~lP~p~~~~~~~~~~~~~~~~p~~Yir~~e~~~ee~~~~~eYDmDe~D~~wL~~~N~~r~~~~~~~~s~~~fE~~md~L  115 (830)
                      ..+|++.++.++.+....++.+|..|+++++...++++..++|||||+|..||..+|+.|...+...++.++||.+||++
T Consensus       118 ~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~e~~y~~de~d~~wl~~~n~~~~~~~~~~v~~~~~~~~~dr~  197 (1051)
T KOG0955|consen  118 PRSPQHKVREFELLRPMDAPPRPNFYYDEIEKSKETLDEEVEYDLDEEDYSWLDIMNELRTRNGVFDVSIDTFELLVDRL  197 (1051)
T ss_pred             ccChhhhheeccccccccCCCCCCcchhhhccchhhhccccccchHHHHHHHHhhhhHHHhhcCCccccccchhhhhhhH
Confidence            35788999999877778889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhhhhhccCCCC--CCCCCCcccccccCCCcCCCCceEEecCcCcccccccccccccCCCceeeeccCCCCCCCcccc
Q psy2279         116 EKECQFQMSHTQSQ--DIIDDEAVCCICNDGECQNSNVILFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLHTPSRAVDCV  193 (830)
Q Consensus       116 EkE~~~~~~~~~~~--~~~~~d~~C~VC~~~e~~~~n~iv~Cd~C~~~vHq~CyGi~~ipeg~W~C~~C~~~~~~~~~C~  193 (830)
                      |||++|.....+.+  ..+++|.+|+||.++++.|.|.|||||+|+++|||+|||+++||||+|+|++|.+++.+.+.|+
T Consensus       198 eke~~f~~~e~~~~~~~~~~~D~~C~iC~~~~~~n~n~ivfCD~Cnl~VHq~Cygi~~ipeg~WlCr~Cl~s~~~~v~c~  277 (1051)
T KOG0955|consen  198 EKESYFKNYELGDPKDALLEEDAVCCICLDGECQNSNVIVFCDGCNLAVHQECYGIPFIPEGQWLCRRCLQSPQRPVRCL  277 (1051)
T ss_pred             HHHHHhhhhhccCCCccccCCCccceeecccccCCCceEEEcCCCcchhhhhccCCCCCCCCcEeehhhccCcCcccceE
Confidence            99999988776554  6788999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCcccccCCCcccccccccCCceeeccCcccCCccccccccccccCcccccccCCCCcceeeecCCCCCcccch
Q psy2279         194 LCPNNGGAFKLTDRGAWAHVVCALWIPEVRFANTVFLEPIDSIEAIPAARWKLTCYVCKQRGVGACIQCHKTNCYAAFHV  273 (830)
Q Consensus       194 lC~~~gGa~k~t~~~~W~Hv~Calw~pev~f~n~~~~~pi~~i~~i~~~r~~l~C~iC~~~g~GacIqC~~~~C~~~fHv  273 (830)
                      +||..|||||+|++|+|+|++||+|+|||.|+|+.+++||++|++|+..||+|.|++|++++.||||||+..+|++||||
T Consensus       278 ~cp~~~gAFkqt~dgrw~Hv~caiwipev~F~nt~~~E~I~~i~~i~~aRwkL~cy~cK~~~~gaciqcs~~~c~~a~hv  357 (1051)
T KOG0955|consen  278 LCPSKGGAFKQTDDGRWAHVVCAIWIPEVSFANTVFLEPIDSIENIPPARWKLTCYICKQKGLGACIQCSKANCYTAFHV  357 (1051)
T ss_pred             eccCCCCcceeccCCceeeeehhhcccccccccchhhccccchhcCcHhhhhceeeeeccCCCCcceecchhhhhhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999997799999999999999999


Q ss_pred             hhhhhcCcccccccccCCC-CCCceeeeEEEeCCCCCCCCCCCC-CCC-------------CCCchHHHHHHHH-HHhhh
Q psy2279         274 TCAQQAGLYMNMDTIRDHS-GVEPVVVQKLAYCDAHTPPDVQHR-PRL-------------PAPSDEKLKNARL-VLAKK  337 (830)
Q Consensus       274 tCA~~aG~~~~~~~~~~~~-~~~~~~v~~~~~C~~H~~~~~~~~-~~~-------------~~~~~~k~~~~~~-~~~~~  337 (830)
                      |||+++|++|+++.+.+.+ ++....|.+.+||++|+|++.... .+.             ....+.+.+++++ +..++
T Consensus       358 tca~~agl~m~~~~~~~~s~~~~s~~v~~~syC~~H~pp~~~~g~~d~~~~~~el~~~~~~~~~~r~k~~~~~~~~~~~~  437 (1051)
T KOG0955|consen  358 TCARRAGLYMKSNTVKELSKNGTSQSVNKISYCDKHTPPGDAEGLKDGDLKLLELTKVDTTEAFKRNKAKKARKFALAPK  437 (1051)
T ss_pred             hhHhhcCceEeecccccccccccccccceeeeccCCCCchhhhhhhhcchhhhhhhhhhhhhHHHhhHhhhccccccccc
Confidence            9999999999988888764 556667889999999999963221 000             1123334445555 55667


Q ss_pred             ccCCCccccCCCChhhHHHHhhhccCchhhHHHHHHHHHHHHhhhccCCCCcccccccchhccccccccccCCCCCCCch
Q psy2279         338 RVSVPTVSIPTIPPERVQDIAQLISVPKKSQLMNRLIAYWTIKRQLRNGVPLLRRLQSSHQARRDEHCKIMSNTPENGNI  417 (830)
Q Consensus       338 ~~~~p~~~~p~~~~~~~~~i~~~~~i~~~~~~v~~i~~YW~LKR~~r~g~PLlrRLq~~~~~~~~~~~~~~~~~~~~~~~  417 (830)
                      .+..|++.+|++|.+++++|+..+.++.+.+|+++||.||.+||+.|+|+||++|||....++++.+++  ...+ +.+.
T Consensus       438 ~~~~p~~~~p~vp~~rls~i~~~~~~~~~~~~~~~i~~~w~~kR~~r~g~pLl~~lq~~~~s~rn~~~~--~~~~-D~~~  514 (1051)
T KOG0955|consen  438 CTPNPTSKVPTVPPHRLSKIVDRLTLQRKPQFMDRICKYWYLKRLSRNGAPLLGRLQSLSKSSRNKEQV--GREG-DLKN  514 (1051)
T ss_pred             cCCCcccccccchHHHHHhhcccccccCcchhhhhhhhhHHHHHHhhCCcchhhhhhhhhhccccchhc--cccc-Cccc
Confidence            888999999999999999999999999999999999999999999999999999999999888886643  2334 5677


Q ss_pred             HHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhccccchhhHHHHHHHHHhhcccCCcccccCCCCC
Q psy2279         418 TELYHELKYWQCLRQDLERARLLCELVRKREKMKRELIKVTEACTMIKLNPLNSLLLQLIDLIKARDTGDIFLEPVDVIE  497 (830)
Q Consensus       418 ~~l~~rl~~~~~LR~DLEr~R~L~elVrKREKlKre~~k~~eei~e~~l~pl~~~l~~il~~L~~~d~~~~F~~PV~~~~  497 (830)
                      .++.+.+++|+.|++||++++.|++++++|+++++.+...+...+...+.|+..+++.+++.++..|...+|..||+..+
T Consensus       515 ~~~~d~~k~~~~L~~~~~s~~~l~e~~r~r~~lk~~~~~~~~~~~~~~l~p~~kLl~~~l~~lq~kD~~gif~~pvd~~e  594 (1051)
T KOG0955|consen  515 KARVDSLKYWQALRLDLESAQLLVELTRKREKLKRILVKSQKEALELGLNPFKKLLQKSLDKLQKKDSYGIFAEPVDPSE  594 (1051)
T ss_pred             hhhhHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHhchhhhhhcccCchHHHHHHHHHHHhhcccccCceeeccChhh
Confidence            88999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccccCCCCCHHhHHHHHhcCCCCCHHHHHHHHHHhHHHHhhhCCCCcHHHHHHHHHHHHHHHHHHHHHHHhhhhc-
Q psy2279         498 VPDYADVIKQPMDLTTMTNKVKANQYLSLEDFENDFNLMVENCLTYNEKDTIFYKAGIKMKQVGGALINQAAKTLNDAG-  576 (830)
Q Consensus       498 ~PdY~~iIk~PMdL~tI~~kl~~~~Y~s~~eF~~Dv~LI~~Na~~YN~~~s~i~~~A~~L~~~~~~~~~~~~~~~e~~~-  576 (830)
                      +|||.++|++||||.+|+.+++.+.|.++++|++|+.||+.||+.||..++.+|++|.+++++....+.+++++.+... 
T Consensus       595 ~pdy~~iik~pmd~~t~~~kl~s~~y~tle~ieed~~l~~~nc~~yn~~dtv~~r~av~~~e~~~~~~~~arke~e~~~~  674 (1051)
T KOG0955|consen  595 LPDYIDIIKKPMDFFTMRLKLESGAYSTLEPIEEDVNLIVSNCMEYNAKDTVYYRAAVRLRELIKKDFRNARKEPESEGL  674 (1051)
T ss_pred             cccHHHHhcCccchhhhhhhccccchhhhhHHHHhHhHhHhHHHHhhccCeehHhhhHHHHhhhhhHHHhcccchhhhcc
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999985 


Q ss_pred             -CCCCCCCCCCCCCCCC------CCCcc-cccchhh------------------------------------hhhhhhhh
Q psy2279         577 -FDQIGSILPGTSAKGV------NSSDV-VHMEETS------------------------------------KAENNKQE  612 (830)
Q Consensus       577 -~~~~~~~~~~~~~~~~------~~~d~-~~~~~~~------------------------------------~~~~~~~~  612 (830)
                       +.+.+++.+.......      +|++. .....+.                                    +++++..+
T Consensus       675 ~d~~~~~~~~~~~~~~~~~~~~~~~~~e~~~v~~e~~~~~~~e~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~s~~r  754 (1051)
T KOG0955|consen  675 LDRESLSHHDHLVKKLERPYRPNLWAPEEPQVDLETFINLSKEHDLKIPLDKNEKKKATKLSIPRNRDSRIIRKEKSRLR  754 (1051)
T ss_pred             cchhhhcccchhhhhhccCCccccccccccccccccccccChhhhhccccccchhhhhhhcccccccccccchhhHHHHh
Confidence             3344454444433211      23221 0001110                                    01111111


Q ss_pred             hccC-------CcccccCC------------CCCCCCC--CCCCCcccc--c-------------------cCCC-----
Q psy2279         613 EKKN-------STDVVMGM------------SSKDTKN--FKSPEITTR--K-------------------RHGN-----  645 (830)
Q Consensus       613 ~~~~-------~~~~~~~~------------~rrts~~--~~~p~~~~~--~-------------------~~~~-----  645 (830)
                      ....       +.+...|+            +++++..  .++|.....  +                   .+.+     
T Consensus       755 ~~~~~~~e~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~s~p~~~~~~sp~~~~~~~~~p~~l~~~s~~~~sn~~l~~  834 (1051)
T KOG0955|consen  755 KCGIVDTETSGSPSIPSGGEKTVKKDGLNSKNLKMSSDQALSSPPSEPLGSPYNDSVKGVKPSVLLEKSGLLRSNANLSQ  834 (1051)
T ss_pred             hccCcCccccCCCCCCCccccchhcccccccccccccchhhcCCCCCCCCCCccccccccCchhhHhhcccccccccccc
Confidence            1000       00000100            1111100  011111000  0                   0000     


Q ss_pred             -CCCCCcccCCC------CCCCccccccCCCCccCCCCCCCCCCCCCCCCCCCCCCCC--C-CCCCC--------CC---
Q psy2279         646 -KKKGAQEELSV------PESDSFKVYRSGGELKGEAFDSAEEGGEDGEENSSCSECS--S-SCDSS--------DS---  704 (830)
Q Consensus       646 -~~~~~~~~~s~------~~~~~~~~~r~~~~~~~~~s~s~s~~~~~s~~~~~~s~~~--~-~~~~~--------~~---  704 (830)
                       +...+.+..+.      .....+-+++ +...+.+.+++.++.++.+.++.+++.|.  + -.+++        .+   
T Consensus       835 n~t~~~~~~~~~~~~~~~~~~~~~g~g~-~~~tP~~~~e~~~~~ss~~p~~~s~~~~p~~~~~~~s~~r~~ta~~~sa~~  913 (1051)
T KOG0955|consen  835 NPTASANNLASTSCSVTKATFTGNGVGG-DVKTPKRPSEPSSIISSLSPSSKSTSICPKHGVCKPSGERMPTASVTSADI  913 (1051)
T ss_pred             CCCcccccccccccccccCCccCCCCCc-cccCCCCcCCccccccccCCcCCccccCCccccCCcccccCCccccccccc
Confidence             00000000000      0000011111 11122222222222222222222222222  0 00010        00   


Q ss_pred             --CCC-----------CCCCCC-----CCCCccchhhhhccCCCCCceEeeCCCCCC-CcccCCCCCCCCcHHHHhhhcC
Q psy2279         705 --ESG-----------SSVSGS-----HTFEQLQLVWAKCRGYPWYPALIINPQMPL-GYIHNGVPIPSPPEDVLALANN  765 (830)
Q Consensus       705 --~~~-----------~~~~~~-----~~~~~~~~v~ak~~g~p~~p~~i~~~~~p~-g~~h~~~~~~~pp~~~~~~~~~  765 (830)
                        ..|           +.+..+     ..|+++++|||||+||||||++|++|+||+ |.+||| |||+||.+|++++++
T Consensus       914 ~~~~~g~~ak~~~~~~~~l~~~~~~~~~~l~~~~~~~akc~g~~s~~~l~l~p~~~~~~~~~~g-~~~~p~~dv~~l~eq  992 (1051)
T KOG0955|consen  914 SNINGGGYAKCSKSPYSVLFPEKGLSVGKLEELKLVWAKCRGYPSYPALILDPKMPREGNFHNG-PDPAPPTDVLALPEQ  992 (1051)
T ss_pred             cccccceeeeecCCchhhhcccccCCccceeehhceeehhcCCccchhhhcccccccccCccCC-CCCCCCcccccchHH
Confidence              001           012111     338899999999999999999999999999 999999 999999999999753


Q ss_pred             ----CCCCeEEEEEcCCCCCcccccCCCcccCCCChhhhhhhhcccCChhHHHHHHHHH
Q psy2279         766 ----YTEPVYLVLFFDTKRTWQWLPRNKLEPLGITDELDQIKLMESRKPADRKAVKKAY  820 (830)
Q Consensus       766 ----~~~~~~~v~ffd~~~~~~w~~~~~~~~l~~~~~~d~~~~~~~~~~~~rk~~~~a~  820 (830)
                          ..+.+++|+|||++++|||+|++++.+||+|.+.|+.+|.+|++..+||+|+.||
T Consensus       993 ~~~~~~~~l~~~L~~~n~~~~~~~~~s~~~~l~~~~~~d~~~~~~~~~~~~r~~~~~~~ 1051 (1051)
T KOG0955|consen  993 RTNKAPETLFLVLFFDNKRCWQWLPRSKVLELGVDSTSDKIKMLEGRNIEIRKSVQIAY 1051 (1051)
T ss_pred             HhcccChhheEEEeecccccccccCCCCcccccchhhhhhhhhccCCChhhhccccccC
Confidence                7899999999999999999999999999999999999999999999999999986

>KOG0954|consensus Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0956|consensus Back     alignment and domain information
>cd05839 BR140_related The PWWP domain is found in the BR140 family, which includes peregrin and BR140-like proteins 1 and 2 Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05837 MSH6_like The PWWP domain is present in MSH6, a mismatch repair protein homologous to bacterial MutS Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>PF10513 EPL1: Enhancer of polycomb-like; InterPro: IPR019542 This domain is found at the N-terminal of EPL1 (Enhancer of polycomb-like) proteins Back     alignment and domain information
>KOG1474|consensus Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05840 SPBC215_ISWI_like The PWWP domain is a component of the S Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>cd05162 PWWP The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>smart00293 PWWP domain with conserved PWWP motif Back     alignment and domain information
>cd05834 HDGF_related The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF Back     alignment and domain information
>PF00855 PWWP: PWWP domain; InterPro: IPR000313 Upon characterisation of WHSC1, a gene mapping to the Wolf-Hirschhornsyndrome critical region and at its C terminus similar to the Drosophila melanogaster ASH1/trithorax group proteins, a novel protein domain designated PWWP domain was identified [] Back     alignment and domain information
>cd05838 WHSC1_related The PWWP domain was first identified in the WHSC1 (Wolf-Hirschhorn syndrome candidate 1) protein, a protein implicated in Wolf-Hirschhorn syndrome (WHS) Back     alignment and domain information
>cd05835 Dnmt3b_related The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis Back     alignment and domain information
>cd05841 BS69_related The PWWP domain is part of BS69 protein, a nuclear protein that specifically binds adenoviral E1A and Epstein-Barr viral EBNA2 proteins, suppressing their transactivation functions Back     alignment and domain information
>cd05836 N_Pac_NP60 The PWWP domain is an essential part of the cytokine-like nuclear factor n-pac protein, or NP60, which enhances the activity of MAP2K4 and MAP2K6 kinases to phosphorylate p38-alpha Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1080|consensus Back     alignment and domain information
>cd06080 MUM1_like Mutated melanoma-associated antigen 1 (MUM-1) is a melanoma-associated antigen (MAA) Back     alignment and domain information
>KOG1472|consensus Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG0008|consensus Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>KOG1827|consensus Back     alignment and domain information
>KOG1828|consensus Back     alignment and domain information
>KOG0008|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG1904|consensus Back     alignment and domain information
>KOG1828|consensus Back     alignment and domain information
>KOG1472|consensus Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1244|consensus Back     alignment and domain information
>KOG4323|consensus Back     alignment and domain information
>KOG1512|consensus Back     alignment and domain information
>KOG4323|consensus Back     alignment and domain information
>KOG4299|consensus Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG1084|consensus Back     alignment and domain information
>KOG1474|consensus Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>KOG1973|consensus Back     alignment and domain information
>KOG4443|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG1473|consensus Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1081|consensus Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>KOG4443|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>PF08169 RBB1NT: RBB1NT (NUC162) domain; InterPro: IPR012603 This domain is found N-terminal to the ARID/BRIGHT domain in DNA-binding proteins of the Retinoblastoma-binding protein 1 family [] Back     alignment and domain information
>KOG1512|consensus Back     alignment and domain information
>KOG4299|consensus Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF02318 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>KOG1244|consensus Back     alignment and domain information
>KOG1973|consensus Back     alignment and domain information
>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query830
3pfs_A158 Pwwp Domain Of Human Bromodomain And Phd Finger-Con 4e-36
3l42_A130 Pwwp Domain Of Human Bromodomain And Phd Finger Con 3e-33
2x35_A132 Molecular Basis Of Histone H3k36me3 Recognition By 4e-33
3lyi_A126 Pwwp Domain Of Human Bromodomain-Containing Protein 8e-30
2d9e_A121 Solution Structure Of The Bromodomain Of Peregrin L 4e-26
2lq6_A87 Solution Structure Of Brd1 Phd2 Finger Length = 87 5e-26
2ku3_A71 Solution Structure Of Brd1 Phd1 Finger Length = 71 8e-25
2l43_A88 Structural Basis For Histone Code Recognition By Br 5e-23
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 5e-22
3hme_A123 Crystal Structure Of Human Bromodomain Containing 9 8e-13
2i7k_A117 Solution Structure Of The Bromodomain Of Human Brd7 1e-12
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 1e-12
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 2e-10
3dai_A130 Crystal Structure Of The Bromodomain Of The Human A 4e-10
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 4e-10
3lxj_A136 Crystal Structure Of The Bromodomain Of Human Aaa D 5e-10
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 5e-10
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 5e-10
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 5e-10
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 6e-10
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 6e-10
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 2e-08
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 2e-08
2lsp_B128 Solution Structures Of Brd4 Second Bromodomain With 4e-08
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 4e-08
2ouo_A130 Crystal Structure Of The Bromo Domain 2 In Human Br 4e-08
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 4e-08
2i8n_A114 Solution Structure Of The Second Bromodomain Of Brd 4e-08
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 4e-08
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 5e-08
3jvl_A120 Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le 8e-08
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 8e-08
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 9e-08
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 9e-08
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 1e-07
1f68_A103 Nmr Solution Structure Of The Bromodomain From Huma 1e-07
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 1e-07
2e7n_A117 Solution Structure Of The Second Bromodomain From H 2e-07
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 2e-07
3d7c_A112 Crystal Structure Of The Bromodomain Of Human Gcn5, 2e-07
3g0j_A124 Crystal Structure Of The Fifth Bromodomain Of Human 2e-07
2yqd_A120 Solution Structure Of The Fifth Bromodomain From Mo 2e-07
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 4e-07
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 4e-07
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 4e-07
2dkw_A131 Solution Structure Of The Bromodomain Of Human Prot 5e-07
3oni_A114 Crystal Structure Of The Second Bromodomain Of Huma 9e-07
2dvv_A112 Crystal Structure Of The Second Bromodomain Of The 9e-07
2g4a_A116 Solution Structure Of A Bromodomain From Ring3 Prot 1e-06
2grc_A129 1.5 A Structure Of Bromodomain From Human Brg1 Prot 1e-06
2h60_A128 Solution Structure Of Human Brg1 Bromodomain Length 3e-06
3k2j_A130 Crystal Structure Of The 3rd Bromodomain Of Human P 3e-06
3uvd_A124 Crystal Structure Of The Bromodomain Of Human Trans 3e-06
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 3e-06
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 4e-06
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 4e-06
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 4e-06
2dww_A114 Crystal Structure Of Bromodomain-Containing Protein 4e-06
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 5e-06
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 5e-06
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 5e-06
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 6e-06
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 8e-06
3aqa_A128 Crystal Structure Of The Human Brd2 Bd1 Bromodomain 1e-05
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 1e-05
2dat_A123 Solution Structure Of The Bromodomain Of Human SwiS 1e-05
1x0j_A122 Crystal Structure Analysis Of The N-Terminal Bromod 1e-05
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 2e-05
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 2e-05
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 3e-05
3fkm_X166 Plasmodium Falciparum Bromodomain-Containing Protei 3e-05
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 4e-05
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 5e-05
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 9e-05
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 2e-04
2r10_A361 Structure Of An Acetylated Rsc4 Tandem Bromodomain 4e-04
2r0v_A346 Structure Of The Rsc4 Tandem Bromodomain Acetylated 4e-04
3iu5_A116 Crystal Structure Of The First Bromodomain Of Human 4e-04
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 7e-04
>pdb|3PFS|A Chain A, Pwwp Domain Of Human Bromodomain And Phd Finger-Containing Protein 3 Length = 158 Back     alignment and structure 
Iteration: 1

 Score =  149 bits (377), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 68/116 (58%), Positives = 87/116 (75%), Gaps = 5/116 (4%)
Query: 716 FEQLQLVWAKCRGYPWYPALIINPQMPL-GYIHNGVPIPSPPEDVLALANNYT----EPV 770
            E L+LVWAKCRGYP YPALII+P+MP  G +HNGVPIP PP DVL L         E +
Sbjct: 37  LEPLELVWAKCRGYPSYPALIIDPKMPREGLLHNGVPIPVPPLDVLKLGEQKQAEAGEKL 96
Query: 771 YLVLFFDTKRTWQWLPRNKLEPLGITDELDQIKLMESRKPADRKAVKKAYQEALVH 826
           +LVLFFD KRTWQWLPR+K+ PLG+ D +D++K++E RK + RK+V+ AY  A++H
Sbjct: 97  FLVLFFDNKRTWQWLPRDKVLPLGVEDTVDKLKMLEGRKTSIRKSVQVAYDRAMIH 152
>pdb|3L42|A Chain A, Pwwp Domain Of Human Bromodomain And Phd Finger Containing Protein 1 Length = 130 Back     alignment and structure
>pdb|2X35|A Chain A, Molecular Basis Of Histone H3k36me3 Recognition By The Pwwp Domain Of Brpf1. Length = 132 Back     alignment and structure
>pdb|3LYI|A Chain A, Pwwp Domain Of Human Bromodomain-Containing Protein 1 Length = 126 Back     alignment and structure
>pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 Back     alignment and structure
>pdb|2LQ6|A Chain A, Solution Structure Of Brd1 Phd2 Finger Length = 87 Back     alignment and structure
>pdb|2KU3|A Chain A, Solution Structure Of Brd1 Phd1 Finger Length = 71 Back     alignment and structure
>pdb|2L43|A Chain A, Structural Basis For Histone Code Recognition By Brpf2-Phd1 Finger Length = 88 Back     alignment and structure
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure
>pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 Back     alignment and structure
>pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 Back     alignment and structure
>pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 Back     alignment and structure
>pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 Back     alignment and structure
>pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 Back     alignment and structure
>pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 Back     alignment and structure
>pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 Back     alignment and structure
>pdb|2GRC|A Chain A, 1.5 A Structure Of Bromodomain From Human Brg1 Protein, A Central Atpase Of SwiSNF REMODELING COMPLEX Length = 129 Back     alignment and structure
>pdb|2H60|A Chain A, Solution Structure Of Human Brg1 Bromodomain Length = 128 Back     alignment and structure
>pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 Back     alignment and structure
>pdb|3UVD|A Chain A, Crystal Structure Of The Bromodomain Of Human Transcription Activator Brg1 (Smarca4) In Complex With N-Methyl-2-Pyrrolidone Length = 124 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|2DAT|A Chain A, Solution Structure Of The Bromodomain Of Human SwiSNF Related Matrix Associated Actin Dependent Regulator Of Cromatin Subfamily A Member 2 Length = 123 Back     alignment and structure
>pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 Back     alignment and structure
>pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 Back     alignment and structure
>pdb|3IU5|A Chain A, Crystal Structure Of The First Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query830
3pfs_A158 Bromodomain and PHD finger-containing protein 3; s 3e-46
3rcw_A135 Bromodomain-containing protein 1; transcription, s 1e-44
3l42_A130 Peregrin; transcription regulation, histone H3 ace 3e-43
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 5e-42
2d9e_A121 Peregrin; four-helix bundle, transcription activat 6e-42
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 4e-41
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 4e-36
3dai_A130 ATPase family AAA domain-containing protein 2; anc 3e-35
3d7c_A112 General control of amino acid synthesis protein 5; 3e-35
3nxb_A116 CAT eye syndrome critical region protein 2; struct 1e-34
2grc_A129 Probable global transcription activator SNF2L4; br 8e-34
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 3e-32
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-31
3uv4_A158 Second bromodomain of human transcription initiat 2e-30
3aad_A292 Transcription initiation factor TFIID subunit 1; p 3e-30
3aad_A292 Transcription initiation factor TFIID subunit 1; p 2e-25
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 3e-30
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 3e-30
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 7e-30
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 8e-30
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 9e-30
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 1e-26
2dat_A123 Possible global transcription activator SNF2L2; br 1e-29
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-29
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 3e-29
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 3e-29
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 5e-29
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 8e-29
4alg_A154 Bromodomain-containing protein 2; signaling protei 9e-29
3p1f_A119 CREB-binding protein; structural genomics consorti 1e-28
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 3e-28
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 4e-28
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 5e-28
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 5e-28
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 7e-28
3fkm_X166 Signaling protein; bromodomain, malaria, structura 1e-27
2r10_A361 Chromatin structure-remodeling complex protein RSC 2e-27
2r10_A361 Chromatin structure-remodeling complex protein RSC 7e-20
2r0y_A311 Chromatin structure-remodeling complex protein RSC 7e-27
2r0y_A311 Chromatin structure-remodeling complex protein RSC 2e-21
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 1e-26
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 2e-22
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 7e-04
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-19
2yt5_A66 Metal-response element-binding transcription facto 3e-19
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 1e-18
1h3z_A109 Hypothetical 62.8 kDa protein C215.07C; nuclear pr 3e-18
2l89_A108 PWWP domain-containing protein 1; histone binding, 3e-18
2gfu_A134 DNA mismatch repair protein MSH6; PWWP domain, tud 4e-18
2daq_A110 WHSC1L1 protein, isoform long; PWWP domain, struct 6e-16
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 3e-14
1khc_A147 DNA cytosine-5 methyltransferase 3B2; five beta-sh 6e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-13
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 6e-12
3llr_A154 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 5e-11
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 2e-09
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 3e-05
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 5e-09
1x4i_A70 Inhibitor of growth protein 3; structural genomics 3e-08
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 5e-08
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 5e-08
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 8e-08
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 1e-07
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 5e-04
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 1e-07
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 2e-07
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 2e-07
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 3e-07
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 3e-07
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 5e-07
3qby_A94 Hepatoma-derived growth factor-related protein 2; 6e-07
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 6e-07
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 2e-06
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 3e-06
1ri0_A110 Hepatoma-derived growth factor; HDGF, HATH domain, 5e-06
1weu_A91 Inhibitor of growth family, member 4; structural g 5e-06
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 8e-06
2k16_A75 Transcription initiation factor TFIID subunit 3; p 1e-05
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 1e-05
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 1e-05
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 2e-05
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 3e-05
1wem_A76 Death associated transcription factor 1; structura 6e-05
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 2e-04
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 3e-04
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 8e-04
>3pfs_A Bromodomain and PHD finger-containing protein 3; structural genomics, structural genomics consortium, SGC, PW domain, protein binding; 1.90A {Homo sapiens} PDB: 3lyi_A* Length = 158 Back     alignment and structure
 Score =  161 bits (408), Expect = 3e-46
 Identities = 69/143 (48%), Positives = 89/143 (62%), Gaps = 5/143 (3%)

Query: 689 NSSCSECSSSCDSSDSESGSSVSGSHTFEQLQLVWAKCRGYPWYPALIINPQMPL-GYIH 747
                      + S              E L+LVWAKCRGYP YPALII+P+MP  G +H
Sbjct: 10  GRENLYFQGDYNGSGRSLLLPFEDRGDLEPLELVWAKCRGYPSYPALIIDPKMPREGLLH 69

Query: 748 NGVPIPSPPEDVLALANNYT----EPVYLVLFFDTKRTWQWLPRNKLEPLGITDELDQIK 803
           NGVPIP PP DVL L         E ++LVLFFD KRTWQWLPR+K+ PLG+ D +D++K
Sbjct: 70  NGVPIPVPPLDVLKLGEQKQAEAGEKLFLVLFFDNKRTWQWLPRDKVLPLGVEDTVDKLK 129

Query: 804 LMESRKPADRKAVKKAYQEALVH 826
           ++E RK + RK+V+ AY  A++H
Sbjct: 130 MLEGRKTSIRKSVQVAYDRAMIH 152
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>3l42_A Peregrin; transcription regulation, histone H3 acetylation, chromatin modification, structural genomics, structural genomics CONS SGC, activator; 1.30A {Homo sapiens} PDB: 3mo8_A* 2x4w_A* 2x35_A* 2x4x_A* 2x4y_A* Length = 130 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2l89_A PWWP domain-containing protein 1; histone binding, protein binding; NMR {Schizosaccharomyces pombe} Length = 108 Back     alignment and structure
>2gfu_A DNA mismatch repair protein MSH6; PWWP domain, tudor domain, DNA binding, DNA binding protein; HET: DNA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2daq_A WHSC1L1 protein, isoform long; PWWP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.2 Length = 110 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>1khc_A DNA cytosine-5 methyltransferase 3B2; five beta-sheets barrel followed by five-helix bundle; HET: DNA; 1.80A {Mus musculus} SCOP: b.34.9.2 PDB: 3flg_A* 3qkj_A* Length = 147 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>3llr_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase, methylysine binding, STR genomics consortium, SGC, alternative promoter usage; HET: DNA BTB; 2.30A {Homo sapiens} Length = 154 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>3qby_A Hepatoma-derived growth factor-related protein 2; HDGF2, structural genomics consortium, SGC, protein binding; HET: M3L; 1.95A {Homo sapiens} PDB: 3qj6_A* 3eae_A 1n27_A Length = 94 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
>1ri0_A Hepatoma-derived growth factor; HDGF, HATH domain, PWWP domain, heparin-binding, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.9.2 PDB: 2b8a_A 2nlu_A Length = 110 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query830
3l42_A130 Peregrin; transcription regulation, histone H3 ace 100.0
3pfs_A158 Bromodomain and PHD finger-containing protein 3; s 100.0
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.93
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.92
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.92
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.9
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.9
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.89
3d7c_A112 General control of amino acid synthesis protein 5; 99.89
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.89
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.88
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.88
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.88
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.88
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.88
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.88
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.87
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.87
3p1f_A119 CREB-binding protein; structural genomics consorti 99.87
2dat_A123 Possible global transcription activator SNF2L2; br 99.87
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.87
2grc_A129 Probable global transcription activator SNF2L4; br 99.86
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.86
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.86
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.86
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.86
3uv4_A158 Second bromodomain of human transcription initiat 99.86
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.86
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.85
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.85
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.85
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.83
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.83
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.81
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.8
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.79
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.79
1h3z_A109 Hypothetical 62.8 kDa protein C215.07C; nuclear pr 99.79
2l89_A108 PWWP domain-containing protein 1; histone binding, 99.78
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.75
2lq6_A87 Bromodomain-containing protein 1; PHD finger, meta 99.74
2gfu_A134 DNA mismatch repair protein MSH6; PWWP domain, tud 99.74
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.72
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.71
2daq_A110 WHSC1L1 protein, isoform long; PWWP domain, struct 99.68
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.67
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.64
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.61
1khc_A147 DNA cytosine-5 methyltransferase 3B2; five beta-sh 99.54
1ri0_A110 Hepatoma-derived growth factor; HDGF, HATH domain, 99.53
3llr_A154 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 99.52
4fu6_A153 PC4 and SFRS1-interacting protein; structural geno 99.42
3qby_A94 Hepatoma-derived growth factor-related protein 2; 99.4
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.35
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.3
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.22
2yt5_A66 Metal-response element-binding transcription facto 99.06
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.05
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.82
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.72
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.72
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.68
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.66
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.65
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.64
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.62
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.61
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.61
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.6
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.53
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.38
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.35
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.31
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.22
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.22
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.21
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.17
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.14
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 98.1
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.08
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.07
1weu_A91 Inhibitor of growth family, member 4; structural g 98.04
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.0
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 97.98
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 97.92
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 97.83
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.77
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 97.43
1we9_A64 PHD finger family protein; structural genomics, PH 97.24
3o70_A68 PHD finger protein 13; PHF13, structural genomics 97.23
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.07
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.03
1wew_A78 DNA-binding family protein; structural genomics, P 97.01
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 97.0
1wee_A72 PHD finger family protein; structural genomics, PH 96.89
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 96.74
1wem_A76 Death associated transcription factor 1; structura 96.65
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 96.63
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 96.61
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 96.6
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 96.48
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 96.16
1wil_A89 KIAA1045 protein; ring finger domain, structural g 95.22
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 94.03
3pmi_A134 PWWP domain-containing protein MUM1; structural ge 93.6
1wew_A78 DNA-binding family protein; structural genomics, P 93.58
3kv5_D488 JMJC domain-containing histone demethylation prote 93.49
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 93.18
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 93.15
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 92.46
1weu_A91 Inhibitor of growth family, member 4; structural g 91.2
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 90.95
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 90.8
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 90.3
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 89.81
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 89.6
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 89.58
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 89.39
1we9_A64 PHD finger family protein; structural genomics, PH 89.37
1wem_A76 Death associated transcription factor 1; structura 89.22
3qii_A85 PHD finger protein 20; tudor domain, structural ge 88.29
1wee_A72 PHD finger family protein; structural genomics, PH 88.26
1wil_A89 KIAA1045 protein; ring finger domain, structural g 87.91
2yrv_A117 AT-rich interactive domain-containing protein 4A; 87.87
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 87.56
2zet_C153 Melanophilin; complex, GTP-binding protein, GTPase 87.26
2k16_A75 Transcription initiation factor TFIID subunit 3; p 87.2
3o70_A68 PHD finger protein 13; PHF13, structural genomics 86.73
1x4i_A70 Inhibitor of growth protein 3; structural genomics 84.35
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 84.04
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 83.86
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 83.22
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 83.18
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 83.69
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 82.94
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 82.92
4hcz_A58 PHD finger protein 1; protein-peptide complex, tud 82.89
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 82.82
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 82.64
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 82.43
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 82.33
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 82.19
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 82.16
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 81.3
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 81.06
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 80.01
>3l42_A Peregrin; transcription regulation, histone H3 acetylation, chromatin modification, structural genomics, structural genomics CONS SGC, activator; 1.30A {Homo sapiens} PDB: 3mo8_A* 2x4w_A* 2x35_A* 2x4x_A* 2x4y_A* Back     alignment and structure
Probab=100.00  E-value=4.1e-43  Score=326.82  Aligned_cols=116  Identities=59%  Similarity=1.108  Sum_probs=111.6

Q ss_pred             CCCCCccchhhhhccCCCCCceEeeCCCCCC-CcccCCCCCCCCcHHHHhhhcC----CCCCeEEEEEcCCCCCcccccC
Q psy2279         713 SHTFEQLQLVWAKCRGYPWYPALIINPQMPL-GYIHNGVPIPSPPEDVLALANN----YTEPVYLVLFFDTKRTWQWLPR  787 (830)
Q Consensus       713 ~~~~~~~~~v~ak~~g~p~~p~~i~~~~~p~-g~~h~~~~~~~pp~~~~~~~~~----~~~~~~~v~ffd~~~~~~w~~~  787 (830)
                      ...|+|||||||||+|||||||+||||+||+ |++|||||||+||.+||+++++    +++.+|||+|||+++||+||+.
T Consensus         3 ~~~~~~~dlVWAK~~gyP~wPa~Iidp~~p~~g~~~~g~~ip~pP~~Vl~~~~~~~~~~~~~~y~V~FFd~~~t~aWv~~   82 (130)
T 3l42_A            3 DSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQWLPR   82 (130)
T ss_dssp             CSSSCTTCEEEECCTTSCCEEEEEECTTSCTTCEEETTEEECCCCHHHHHHHHHHHHHCSSCEEEEEESSTTCCEEEEEG
T ss_pred             cccCCCCCEEEEecccCCCCCEEEcCCCCccccccccCccCCCChHHHHhhcccccccCCCcEEEEEeCCCCCceEeecc
Confidence            3679999999999999999999999999999 9999999999999999998753    6789999999999999999999


Q ss_pred             CCcccCCCChhhhhhhhcccCChhHHHHHHHHHHHHHhhcC
Q psy2279         788 NKLEPLGITDELDQIKLMESRKPADRKAVKKAYQEALVHKT  828 (830)
Q Consensus       788 ~~~~~l~~~~~~d~~~~~~~~~~~~rk~~~~a~~~a~~~~~  828 (830)
                      ++|+|||+|...|.++|++++|+++||+|+.||++||+|+|
T Consensus        83 ~~i~pl~~d~~~D~~kl~~s~K~~~rKav~~AYe~A~~~~~  123 (130)
T 3l42_A           83 TKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRS  123 (130)
T ss_dssp             GGEEESSSCHHHHHHHHTCCSSHHHHHHHHHHHHHHHHHHH
T ss_pred             cceeecCCchhhHHHhcccCCCHHHHHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999997
>3pfs_A Bromodomain and PHD finger-containing protein 3; structural genomics, structural genomics consortium, SGC, PW domain, protein binding; 1.90A {Homo sapiens} PDB: 3lyi_A* Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2l89_A PWWP domain-containing protein 1; histone binding, protein binding; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2gfu_A DNA mismatch repair protein MSH6; PWWP domain, tudor domain, DNA binding, DNA binding protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2daq_A WHSC1L1 protein, isoform long; PWWP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.2 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>1khc_A DNA cytosine-5 methyltransferase 3B2; five beta-sheets barrel followed by five-helix bundle; HET: DNA; 1.80A {Mus musculus} SCOP: b.34.9.2 PDB: 3flg_A* 3qkj_A* Back     alignment and structure
>1ri0_A Hepatoma-derived growth factor; HDGF, HATH domain, PWWP domain, heparin-binding, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.9.2 PDB: 2b8a_A 2nlu_A Back     alignment and structure
>3llr_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase, methylysine binding, STR genomics consortium, SGC, alternative promoter usage; HET: DNA BTB; 2.30A {Homo sapiens} SCOP: b.34.9.0 Back     alignment and structure
>4fu6_A PC4 and SFRS1-interacting protein; structural genomics consortium, SGC, transcription; 2.10A {Homo sapiens} PDB: 2b8a_A 2nlu_A Back     alignment and structure
>3qby_A Hepatoma-derived growth factor-related protein 2; HDGF2, structural genomics consortium, SGC, protein binding; HET: M3L; 1.95A {Homo sapiens} SCOP: b.34.9.2 PDB: 3qj6_A* 3eae_A 1n27_A Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3pmi_A PWWP domain-containing protein MUM1; structural genomics consortium, SGC, protein binding, nucLeu; HET: UNL; 2.82A {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2yrv_A AT-rich interactive domain-containing protein 4A; ARID domain-containing protein 4A, retinoblastoma-binding protein 1, RBBP-1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>4hcz_A PHD finger protein 1; protein-peptide complex, tudor, histone binding, H3K36ME3, N nucleus, transcription; HET: M3L; 1.85A {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 830
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 2e-25
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 1e-24
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 2e-23
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 1e-22
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 2e-22
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 4e-22
d1h3za_108 b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fi 2e-17
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 2e-14
d2daqa197 b.34.9.2 (A:8-104) Histone-lysine N-methyltransfer 2e-13
d2nlua1100 b.34.9.2 (A:1-100) Hepatoma-derived growth factor, 5e-11
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 5e-10
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 6e-10
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 2e-09
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 2e-09
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 1e-08
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 3e-08
d1khca_137 b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse 9e-08
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 9e-08
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 1e-07
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 7e-07
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 9e-05
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: TAFII250 double bromodomain module
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  100 bits (250), Expect = 2e-25
 Identities = 29/108 (26%), Positives = 47/108 (43%)

Query: 468 PLNSLLLQLIDLIKARDTGDIFLEPVDVIEVPDYADVIKQPMDLTTMTNKVKANQYLSLE 527
            L+S+L  +I+ ++       F  PV+   V DY  +I +PMDL T+   V+   Y S E
Sbjct: 26  TLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSRE 85

Query: 528 DFENDFNLMVENCLTYNEKDTIFYKAGIKMKQVGGALINQAAKTLNDA 575
           +F     L+V+N  TYN       +    M  +    + +    L   
Sbjct: 86  EFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARL 133
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1h3za_ b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 108 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d2daqa1 b.34.9.2 (A:8-104) Histone-lysine N-methyltransferase NSD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2nlua1 b.34.9.2 (A:1-100) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1khca_ b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse (Mus musculus) [TaxId: 10090]} Length = 137 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query830
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.88
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.88
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.87
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.86
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.86
d1h3za_108 Hypothetical protein SPBC215.07c {Fission yeast (S 99.75
d2daqa197 Histone-lysine N-methyltransferase NSD3 {Human (Ho 99.65
d2nlua1100 Hepatoma-derived growth factor, HDGF {Human (Homo 99.58
d1khca_137 DNA methyltransferase DNMT3B {Mouse (Mus musculus) 99.51
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.62
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.52
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.45
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.4
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.09
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 97.96
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 97.85
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 97.56
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.29
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.19
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.01
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 92.53
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 92.21
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 91.33
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 91.23
d1wema_76 Death associated transcription factor 1, Datf1 (DI 86.86
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 86.17
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 86.11
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 85.16
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 83.57
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 82.81
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 82.7
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 81.77
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 81.27
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.89  E-value=2.6e-23  Score=187.48  Aligned_cols=99  Identities=29%  Similarity=0.516  Sum_probs=95.3

Q ss_pred             hhhHHHHHHHHHhhcccCCcccccCCCCCCCCcccccCCCCCHHhHHHHHhcCCCCCHHHHHHHHHHhHHHHhhhCCCCc
Q psy2279         469 LNSLLLQLIDLIKARDTGDIFLEPVDVIEVPDYADVIKQPMDLTTMTNKVKANQYLSLEDFENDFNLMVENCLTYNEKDT  548 (830)
Q Consensus       469 l~~~l~~il~~L~~~d~~~~F~~PV~~~~~PdY~~iIk~PMdL~tI~~kl~~~~Y~s~~eF~~Dv~LI~~Na~~YN~~~s  548 (830)
                      |...|+.+|+.|.+++.+.+|..||+..++|||+++|++||||+||++||+++.|.++++|.+||.|||.||+.||+++|
T Consensus         3 L~~~l~~il~~l~~~~~s~~F~~pv~~~~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~~f~~D~~li~~Na~~yN~~~s   82 (102)
T d3d7ca1           3 LYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDS   82 (102)
T ss_dssp             HHHHHHHHHHHHHHSGGGGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHSCTTS
T ss_pred             HHHHHHHHHHHHHhCCCCCccCCCCChhhCcCHHHHcCCccCHHHHHHHhccCccCCHHHHHHHHHHHHHHHHHHCCCCC
Confidence            56789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q psy2279         549 IFYKAGIKMKQVGGALINQ  567 (830)
Q Consensus       549 ~i~~~A~~L~~~~~~~~~~  567 (830)
                      .++++|.+|++.|.+.+++
T Consensus        83 ~~~~~A~~l~~~f~~~~ke  101 (102)
T d3d7ca1          83 EYCRCASALEKFFYFKLKE  101 (102)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhc
Confidence            9999999999999887764
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h3za_ b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2daqa1 b.34.9.2 (A:8-104) Histone-lysine N-methyltransferase NSD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nlua1 b.34.9.2 (A:1-100) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khca_ b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure