Psyllid ID: psy2339

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MSCDSCGKNRVVPKPSGSVSPGSLGPLPEGWDMATTAEGETYFINHTTRTTSWFDPRIPKPSGSVSPGSLGPLPEGWDMATTAEGETYFINHTTRTTSWFDPRIPRSHHGINPWKNKKIKFIPMV
cccccccccccccccccccccccccccccccEEEEcccccEEEEEcccccEEccccccccccccccccccccccccccEEEcccccEEEEEcccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccEEEEcccccEEEEEccccccEcccccccccccccccccccccccccEEEEcccccEEEEEccccEEEcccccccHHHHcccHHHHHHccEcccc
mscdscgknrvvpkpsgsvspgslgplpegwdmattaeGETYFInhttrttswfdpripkpsgsvspgslgplpegwdmattaeGETYFINhttrttswfdpriprshhginpwknkkikfipmv
mscdscgknrvvpkpsgsvspgslgplpEGWDMATTAEGETYFINHTtrttswfdpripKPSGSVSPGSLGPLPEGWDMATTAEGETYFINHTtrttswfdpriprshhginpwknkkikfipmv
MSCDSCGKNRvvpkpsgsvspgslgplpEGWDMATTAEGETYFINHTTRTTSWFDPRIPKpsgsvspgslgplpegWDMATTAEGETYFINHTTRTTSWFDPRIPRSHHGINPWKNKKIKFIPMV
******************************WDMATTAEGETYFINHTTRTTSWFD*********************WDMATTAEGETYFINHTTRTTSWFDPRIPRSHHGINPWKNKKIKF****
*****************************GWDMATTAEGETYFINHTTRTTSWFDPR***************LPEGWDMATTAEGETYFINHTTRTTSWFDPR***************IKFIPMV
***********VPKPSGSVSPGSLGPLPEGWDMATTAEGETYFINHTTRTTSWFDPRIPKPSGSVSPGSLGPLPEGWDMATTAEGETYFINHTTRTTSWFDPRIPRSHHGINPWKNKKIKFIPMV
************************GPLPEGWDMATTAEGETYFINHTTRTTSWFDPRIP*********SLGPLPEGWDMATTAEGETYFINHTTRTTSWFDPRIPRSHHGINPWKNKKIKFIPMV
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSCDSCGKNRVVPKPSGSVSPGSLGPLPEGWDMATTAEGETYFINHTTRTTSWFDPRIPKPSGSVSPGSLGPLPEGWDMATTAEGETYFINHTTRTTSWFDPRIPRSHHGINPWKNKKIKFIPMV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query125 2.2.26 [Sep-21-2011]
P46938 488 Yorkie homolog OS=Mus mus yes N/A 0.632 0.161 0.478 1e-20
Q2EJA0 469 Yorkie homolog OS=Rattus no N/A 0.632 0.168 0.467 1e-19
Q2TAS2 751 E3 ubiquitin-protein liga N/A N/A 0.352 0.058 0.414 2e-19
Q9CUN6 731 E3 ubiquitin-protein liga no N/A 0.736 0.125 0.434 2e-19
Q9PUN2 731 E3 ubiquitin-protein liga N/A N/A 0.664 0.113 0.465 6e-19
P46937 504 Yorkie homolog OS=Homo sa no N/A 0.632 0.156 0.445 2e-18
P39940 809 E3 ubiquitin-protein liga yes N/A 0.672 0.103 0.446 6e-18
Q9HAU4 748 E3 ubiquitin-protein liga no N/A 0.264 0.044 0.421 7e-18
A9JRZ0 765 E3 ubiquitin-protein liga no N/A 0.72 0.117 0.428 9e-18
A2A5Z6 748 E3 ubiquitin-protein liga no N/A 0.264 0.044 0.421 9e-18
>sp|P46938|YAP1_MOUSE Yorkie homolog OS=Mus musculus GN=Yap1 PE=1 SV=2 Back     alignment and function desciption
 Score = 98.6 bits (244), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 44/92 (47%), Positives = 59/92 (64%), Gaps = 13/92 (14%)

Query: 26  PLPEGWDMATTAEGETYFINHTTRTTSWFDPR--------IPKPSGSVSPGSL-----GP 72
           PLP GW+MA T+ G+ YF+NH  +TT+W DPR        +P P+    P +L     GP
Sbjct: 157 PLPAGWEMAKTSSGQRYFLNHNDQTTTWQDPRKAMLSQLNVPAPASPAVPQTLMNSASGP 216

Query: 73  LPEGWDMATTAEGETYFINHTTRTTSWFDPRI 104
           LP+GW+ A T +GE Y+INH  +TTSW DPR+
Sbjct: 217 LPDGWEQAMTQDGEVYYINHKNKTTSWLDPRL 248
Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction.
Mus musculus (taxid: 10090)
>sp|Q2EJA0|YAP1_RAT Yorkie homolog OS=Rattus norvegicus GN=Yap1 PE=2 SV=1 Back     alignment and function description
>sp|Q2TAS2|SMUF2_XENLA E3 ubiquitin-protein ligase SMURF2 OS=Xenopus laevis GN=smurf2 PE=2 SV=1 Back     alignment and function description
>sp|Q9CUN6|SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus GN=Smurf1 PE=2 SV=2 Back     alignment and function description
>sp|Q9PUN2|SMUF1_XENLA E3 ubiquitin-protein ligase SMURF1 OS=Xenopus laevis GN=smurf1 PE=2 SV=1 Back     alignment and function description
>sp|P46937|YAP1_HUMAN Yorkie homolog OS=Homo sapiens GN=YAP1 PE=1 SV=2 Back     alignment and function description
>sp|P39940|RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSP5 PE=1 SV=1 Back     alignment and function description
>sp|Q9HAU4|SMUF2_HUMAN E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens GN=SMURF2 PE=1 SV=1 Back     alignment and function description
>sp|A9JRZ0|SMUF2_DANRE E3 ubiquitin-protein ligase SMURF2 OS=Danio rerio GN=smurf2 PE=2 SV=1 Back     alignment and function description
>sp|A2A5Z6|SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus GN=Smurf2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
384483309 775 E3 ubiquitin-protein ligase RSP5 [Rhizop 0.784 0.126 0.472 8e-23
384493121 765 hypothetical protein RO3G_08317 [Rhizopu 0.664 0.108 0.510 9e-23
383847120 445 PREDICTED: yorkie homolog [Megachile rot 0.656 0.184 0.567 1e-21
328786399 471 PREDICTED: yorkie homolog [Apis mellifer 0.656 0.174 0.577 3e-21
350421069 467 PREDICTED: yorkie homolog [Bombus impati 0.656 0.175 0.577 4e-21
340719760 475 PREDICTED: yorkie homolog [Bombus terres 0.656 0.172 0.577 4e-21
384486651 617 E3 ubiquitin-protein ligase pub1 [Rhizop 0.696 0.141 0.525 8e-21
182510216 437 YAP65-like protein [Bombyx mori] gi|1709 0.72 0.205 0.44 1e-20
384497973 626 E3 ubiquitin-protein ligase pub1 [Rhizop 0.76 0.151 0.485 1e-20
242025376 491 65 kDa Yes-associated protein, putative 0.712 0.181 0.436 2e-20
>gi|384483309|gb|EIE75489.1| E3 ubiquitin-protein ligase RSP5 [Rhizopus delemar RA 99-880] Back     alignment and taxonomy information
 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 52/110 (47%), Positives = 70/110 (63%), Gaps = 12/110 (10%)

Query: 9   NRVVPKPSGSVSPGSLGPLPEGWDMATTAEGETYFINHTTRTTSWFDPRIPKPSGSVSPG 68
           ++VV   +   + GS GPLP GW+M TTAEG  YF++H TRTT+W DPR  +   ++ PG
Sbjct: 281 SQVVGVQNNMTTAGS-GPLPPGWEMRTTAEGRPYFVDHNTRTTTWVDPRRQQYINTIGPG 339

Query: 69  S-----------LGPLPEGWDMATTAEGETYFINHTTRTTSWFDPRIPRS 107
           S           LGPLP GW+M  T+ G  YF++H T+TT+W DPR+P S
Sbjct: 340 SNLQVQVQPVSQLGPLPSGWEMRLTSTGRVYFVDHNTKTTTWDDPRLPSS 389

Source: Rhizopus delemar RA 99-880

Species: Rhizopus delemar

Genus: Rhizopus

Family: Rhizopodaceae

Order: Mucorales

Class:

Phylum:

Superkingdom: Eukaryota
>gi|384493121|gb|EIE83612.1| hypothetical protein RO3G_08317 [Rhizopus delemar RA 99-880] Back     alignment and taxonomy information
>gi|383847120|ref|XP_003699203.1| PREDICTED: yorkie homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|328786399|ref|XP_391844.3| PREDICTED: yorkie homolog [Apis mellifera] gi|380027224|ref|XP_003697329.1| PREDICTED: yorkie homolog [Apis florea] Back     alignment and taxonomy information
>gi|350421069|ref|XP_003492722.1| PREDICTED: yorkie homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|340719760|ref|XP_003398315.1| PREDICTED: yorkie homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|384486651|gb|EIE78831.1| E3 ubiquitin-protein ligase pub1 [Rhizopus delemar RA 99-880] Back     alignment and taxonomy information
>gi|182510216|ref|NP_001116819.1| YAP65-like protein [Bombyx mori] gi|170963367|gb|ACB41089.1| YAP65-like protein [Bombyx mori] Back     alignment and taxonomy information
>gi|384497973|gb|EIE88464.1| E3 ubiquitin-protein ligase pub1 [Rhizopus delemar RA 99-880] Back     alignment and taxonomy information
>gi|242025376|ref|XP_002433100.1| 65 kDa Yes-associated protein, putative [Pediculus humanus corporis] gi|212518641|gb|EEB20362.1| 65 kDa Yes-associated protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
FB|FBgn0034970418 yki "yorkie" [Drosophila melan 0.24 0.071 0.6 1e-05
RGD|1306035 469 Yap1 "yes-associated protein 1 0.616 0.164 0.384 1.5e-12
ZFIN|ZDB-GENE-030131-9710 442 yap1 "Yes-associated protein 1 0.616 0.174 0.391 1.7e-12
MGI|MGI:103262 488 Yap1 "yes-associated protein 1 0.616 0.157 0.384 2.6e-12
UNIPROTKB|Q9PUN2 731 smurf1 "E3 ubiquitin-protein l 0.648 0.110 0.369 4e-12
UNIPROTKB|B0XQ72 813 hulA "Probable E3 ubiquitin-pr 0.688 0.105 0.336 4.1e-12
UNIPROTKB|Q4WTF3 813 hulA "Probable E3 ubiquitin-pr 0.688 0.105 0.336 4.1e-12
UNIPROTKB|A1CQG2 815 hulA "Probable E3 ubiquitin-pr 0.688 0.105 0.336 4.2e-12
UNIPROTKB|A1D3C5 816 hulA "Probable E3 ubiquitin-pr 0.688 0.105 0.336 4.2e-12
ASPGD|ASPL0000058564 821 hulA [Emericella nidulans (tax 0.688 0.104 0.336 4.2e-12
FB|FBgn0034970 yki "yorkie" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 111 (44.1 bits), Expect = 1.0e-05, P = 1.0e-05
 Identities = 18/30 (60%), Positives = 22/30 (73%)

Query:    29 EGWDMATTAEGETYFINHTTRTTSWFDPRI 58
             +GW+ A T  G+ YFINH  RTTSW DPR+
Sbjct:   337 DGWEQAVTESGDLYFINHIDRTTSWNDPRM 366
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0043066 "negative regulation of apoptotic process" evidence=IMP
GO:0008283 "cell proliferation" evidence=IMP
GO:0003713 "transcription coactivator activity" evidence=IDA;NAS
GO:0007468 "regulation of rhodopsin gene expression" evidence=NAS
GO:0002011 "morphogenesis of an epithelial sheet" evidence=IMP
GO:0040008 "regulation of growth" evidence=IMP
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0008134 "transcription factor binding" evidence=IPI
GO:0005515 "protein binding" evidence=IPI
GO:0035212 "cell competition in a multicellular organism" evidence=IMP
GO:0072089 "stem cell proliferation" evidence=IDA
GO:0045927 "positive regulation of growth" evidence=IMP
GO:0060252 "positive regulation of glial cell proliferation" evidence=IMP
RGD|1306035 Yap1 "yes-associated protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9710 yap1 "Yes-associated protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:103262 Yap1 "yes-associated protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9PUN2 smurf1 "E3 ubiquitin-protein ligase SMURF1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|B0XQ72 hulA "Probable E3 ubiquitin-protein ligase hulA" [Aspergillus fumigatus A1163 (taxid:451804)] Back     alignment and assigned GO terms
UNIPROTKB|Q4WTF3 hulA "Probable E3 ubiquitin-protein ligase hulA" [Aspergillus fumigatus Af293 (taxid:330879)] Back     alignment and assigned GO terms
UNIPROTKB|A1CQG2 hulA "Probable E3 ubiquitin-protein ligase hulA" [Aspergillus clavatus NRRL 1 (taxid:344612)] Back     alignment and assigned GO terms
UNIPROTKB|A1D3C5 hulA "Probable E3 ubiquitin-protein ligase hulA" [Neosartorya fischeri NRRL 181 (taxid:331117)] Back     alignment and assigned GO terms
ASPGD|ASPL0000058564 hulA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
smart0045633 smart00456, WW, Domain with 2 conserved Trp (W) re 5e-08
smart0045633 smart00456, WW, Domain with 2 conserved Trp (W) re 5e-08
cd0020131 cd00201, WW, Two conserved tryptophans domain; als 9e-08
cd0020131 cd00201, WW, Two conserved tryptophans domain; als 9e-08
pfam0039730 pfam00397, WW, WW domain 2e-07
pfam0039730 pfam00397, WW, WW domain 2e-07
COG5104 590 COG5104, PRP40, Splicing factor [RNA processing an 9e-07
COG5021 872 COG5021, HUL4, Ubiquitin-protein ligase [Posttrans 6e-06
>gnl|CDD|197736 smart00456, WW, Domain with 2 conserved Trp (W) residues Back     alignment and domain information 
 Score = 45.3 bits (108), Expect = 5e-08
 Identities = 14/33 (42%), Positives = 18/33 (54%)

Query: 26 PLPEGWDMATTAEGETYFINHTTRTTSWFDPRI 58
          PLP GW+     +G  Y+ NH T+ T W  PR 
Sbjct: 1  PLPPGWEERKDPDGRPYYYNHETKETQWEKPRE 33

Also known as the WWP or rsp5 domain. Binds proline-rich polypeptides. Length = 33
>gnl|CDD|197736 smart00456, WW, Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>gnl|CDD|238122 cd00201, WW, Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>gnl|CDD|238122 cd00201, WW, Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>gnl|CDD|215899 pfam00397, WW, WW domain Back     alignment and domain information
>gnl|CDD|215899 pfam00397, WW, WW domain Back     alignment and domain information
>gnl|CDD|227435 COG5104, PRP40, Splicing factor [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|227354 COG5021, HUL4, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 125
KOG1891|consensus271 99.7
KOG3209|consensus 984 99.44
PF0039731 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp 99.35
smart0045632 WW Domain with 2 conserved Trp (W) residues. Also 99.27
PF0039731 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp 99.25
cd0020131 WW Two conserved tryptophans domain; also known as 99.16
smart0045632 WW Domain with 2 conserved Trp (W) residues. Also 99.15
COG5104 590 PRP40 Splicing factor [RNA processing and modifica 99.08
cd0020131 WW Two conserved tryptophans domain; also known as 99.01
KOG3209|consensus 984 98.95
KOG0155|consensus 617 98.55
KOG3259|consensus 163 98.39
KOG1891|consensus 271 98.35
KOG3259|consensus163 98.35
KOG0940|consensus 358 98.35
COG5104 590 PRP40 Splicing factor [RNA processing and modifica 96.86
COG5021 872 HUL4 Ubiquitin-protein ligase [Posttranslational m 94.07
KOG3552|consensus 1298 93.77
KOG4286|consensus 966 93.5
KOG0940|consensus 358 93.43
KOG4334|consensus 650 92.57
KOG4286|consensus 966 91.08
KOG0155|consensus 617 90.95
KOG4334|consensus 650 89.84
KOG3552|consensus 1298 89.53
COG5021 872 HUL4 Ubiquitin-protein ligase [Posttranslational m 83.81
smart0039177 MBD Methyl-CpG binding domain. Methyl-CpG binding 81.88
>KOG1891|consensus Back     alignment and domain information 
Probab=99.70  E-value=2.1e-17  Score=122.35  Aligned_cols=73  Identities=36%  Similarity=0.720  Sum_probs=67.4

Q ss_pred             CCCCCCCCCcEEEECCCCCeEEeeCCCCceeccCCCCCCCCCCCCCCCCCCCCCCCeEEEcCCCceEEeeCCCCeeeCCC
Q psy2339          22 GSLGPLPEGWDMATTAEGETYFINHTTRTTSWFDPRIPKPSGSVSPGSLGPLPEGWDMATTAEGETYFINHTTRTTSWFD  101 (125)
Q Consensus        22 ~~~~pLP~gWe~~~~~~Gr~Yy~n~~T~~TtW~~P~~~~~~~~~~~~~~~~LP~gWe~~~d~~G~~yY~nh~t~~T~w~~  101 (125)
                      .+..|||+||...++..||.|||+|++++|.|.+|...           ..||+||+.++++.-.+||+|+.+|++|+++
T Consensus        89 sedlPLPpgWav~~T~~grkYYIDHn~~tTHW~HPler-----------EgLppGW~rv~s~e~GtyY~~~~~k~tQy~H  157 (271)
T KOG1891|consen   89 SEDLPLPPGWAVEFTTEGRKYYIDHNNRTTHWVHPLER-----------EGLPPGWKRVFSPEKGTYYYHEEMKRTQYEH  157 (271)
T ss_pred             cccCCCCCCcceeeEecCceeEeecCCCcccccChhhh-----------ccCCcchhhccccccceeeeecccchhhhcC
Confidence            34478999999999999999999999999999999775           3599999999999999999999999999999


Q ss_pred             CCCC
Q psy2339         102 PRIP  105 (125)
Q Consensus       102 Pr~~  105 (125)
                      |.+.
T Consensus       158 Pc~~  161 (271)
T KOG1891|consen  158 PCIS  161 (271)
T ss_pred             CCCC
Confidence            9985

>KOG3209|consensus Back     alignment and domain information
>PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet Back     alignment and domain information
>smart00456 WW Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet Back     alignment and domain information
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>smart00456 WW Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>COG5104 PRP40 Splicing factor [RNA processing and modification] Back     alignment and domain information
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG0155|consensus Back     alignment and domain information
>KOG3259|consensus Back     alignment and domain information
>KOG1891|consensus Back     alignment and domain information
>KOG3259|consensus Back     alignment and domain information
>KOG0940|consensus Back     alignment and domain information
>COG5104 PRP40 Splicing factor [RNA processing and modification] Back     alignment and domain information
>COG5021 HUL4 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>KOG4286|consensus Back     alignment and domain information
>KOG0940|consensus Back     alignment and domain information
>KOG4334|consensus Back     alignment and domain information
>KOG4286|consensus Back     alignment and domain information
>KOG0155|consensus Back     alignment and domain information
>KOG4334|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>COG5021 HUL4 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00391 MBD Methyl-CpG binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
2kxq_A90 Solution Structure Of Smurf2 Ww2 And Ww3 Bound To S 7e-11
1tk7_A88 Nmr Structure Of Ww Domains (Ww3-4) From Suppressor 2e-08
2l4j_A46 Yap Ww2 Length = 46 6e-07
2l4j_A46 Yap Ww2 Length = 46 1e-05
2ysd_A57 Solution Structure Of The First Ww Domain From The 4e-06
2ysd_A57 Solution Structure Of The First Ww Domain From The 9e-06
2law_A38 Structure Of The Second Ww Domain From Human Yap In 4e-06
2law_A38 Structure Of The Second Ww Domain From Human Yap In 3e-05
2ltv_A36 Yap Ww2 In Complex With A Smad7 Derived Peptide Len 4e-06
2ltv_A36 Yap Ww2 In Complex With A Smad7 Derived Peptide Len 3e-05
3olm_A 429 Structure And Function Of A Ubiquitin Binding Site 2e-05
3olm_A 429 Structure And Function Of A Ubiquitin Binding Site 3e-05
2lax_A40 Structure Of First Ww Domain Of Human Yap In Comple 7e-05
2lax_A40 Structure Of First Ww Domain Of Human Yap In Comple 3e-04
2lay_A36 Structure Of The First Ww Domain Of Human Yap In Co 7e-05
2lay_A36 Structure Of The First Ww Domain Of Human Yap In Co 4e-04
1k9q_A40 Yap65 Ww Domain Complexed To N-(N-Octyl)-Gpppy-Nh2 7e-05
1k9q_A40 Yap65 Ww Domain Complexed To N-(N-Octyl)-Gpppy-Nh2 4e-04
1k5r_A41 Yap65 Ww Domain S24-Amino-Ethylsulfanyl-Acetic Acid 9e-05
1k5r_A41 Yap65 Ww Domain S24-Amino-Ethylsulfanyl-Acetic Acid 5e-04
3l4h_A109 Helical Box Domain And Second Ww Domain Of The Huma 1e-04
3l4h_A109 Helical Box Domain And Second Ww Domain Of The Huma 7e-04
1jmq_A46 Yap65 (L30k Mutant) Ww Domain In Complex With Gtppp 2e-04
1o6w_A75 Solution Structure Of The Prp40 Ww Domain Pair Of T 3e-04
2ysg_A40 Solution Structure Of The Ww Domain From The Human 5e-04
2jo9_A37 Mouse Itch 3rd Ww Domain Complex With The Epstein-B 9e-04
>pdb|2KXQ|A Chain A, Solution Structure Of Smurf2 Ww2 And Ww3 Bound To Smad7 Py Motif Containing Peptide Length = 90 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%)
Query: 29  EGWDMATTAEGETYFINHTTRTTSWFDPRIPKXXXXXXXXXXXXXXXXWDMATTAEGETY 88
           EG++  TT +G+ YF++  T  ++W DPR+P+                W++  TA G  Y
Sbjct: 12  EGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGWEIRNTATGRVY 71
Query: 89  FINHTTRTTSWFDPRI 104
           F++H  RTT + DPR+
Sbjct: 72  FVDHNNRTTQFTDPRL 87
>pdb|1TK7|A Chain A, Nmr Structure Of Ww Domains (Ww3-4) From Suppressor Of Deltex Length = 88 Back     alignment and structure
>pdb|2L4J|A Chain A, Yap Ww2 Length = 46 Back     alignment and structure
>pdb|2L4J|A Chain A, Yap Ww2 Length = 46 Back     alignment and structure
>pdb|2YSD|A Chain A, Solution Structure Of The First Ww Domain From The Human Membrane-Associated Guanylate Kinase, Ww And Pdz Domain- Containing Protein 1. Magi-1 Length = 57 Back     alignment and structure
>pdb|2YSD|A Chain A, Solution Structure Of The First Ww Domain From The Human Membrane-Associated Guanylate Kinase, Ww And Pdz Domain- Containing Protein 1. Magi-1 Length = 57 Back     alignment and structure
>pdb|2LAW|A Chain A, Structure Of The Second Ww Domain From Human Yap In Complex With A Human Smad1 Derived Peptide Length = 38 Back     alignment and structure
>pdb|2LAW|A Chain A, Structure Of The Second Ww Domain From Human Yap In Complex With A Human Smad1 Derived Peptide Length = 38 Back     alignment and structure
>pdb|2LTV|A Chain A, Yap Ww2 In Complex With A Smad7 Derived Peptide Length = 36 Back     alignment and structure
>pdb|2LTV|A Chain A, Yap Ww2 In Complex With A Smad7 Derived Peptide Length = 36 Back     alignment and structure
>pdb|3OLM|A Chain A, Structure And Function Of A Ubiquitin Binding Site Within The Catalytic Domain Of A Hect Ubiquitin Ligase Length = 429 Back     alignment and structure
>pdb|3OLM|A Chain A, Structure And Function Of A Ubiquitin Binding Site Within The Catalytic Domain Of A Hect Ubiquitin Ligase Length = 429 Back     alignment and structure
>pdb|2LAX|A Chain A, Structure Of First Ww Domain Of Human Yap In Complex With A Human Smad1 Doubly-Phosphorilated Derived Peptide Length = 40 Back     alignment and structure
>pdb|2LAX|A Chain A, Structure Of First Ww Domain Of Human Yap In Complex With A Human Smad1 Doubly-Phosphorilated Derived Peptide Length = 40 Back     alignment and structure
>pdb|2LAY|A Chain A, Structure Of The First Ww Domain Of Human Yap In Complex With A Phosphorylated Human Smad1 Derived Peptide Length = 36 Back     alignment and structure
>pdb|2LAY|A Chain A, Structure Of The First Ww Domain Of Human Yap In Complex With A Phosphorylated Human Smad1 Derived Peptide Length = 36 Back     alignment and structure
>pdb|1K9Q|A Chain A, Yap65 Ww Domain Complexed To N-(N-Octyl)-Gpppy-Nh2 Length = 40 Back     alignment and structure
>pdb|1K9Q|A Chain A, Yap65 Ww Domain Complexed To N-(N-Octyl)-Gpppy-Nh2 Length = 40 Back     alignment and structure
>pdb|1K5R|A Chain A, Yap65 Ww Domain S24-Amino-Ethylsulfanyl-Acetic Acid Mutant Length = 41 Back     alignment and structure
>pdb|1K5R|A Chain A, Yap65 Ww Domain S24-Amino-Ethylsulfanyl-Acetic Acid Mutant Length = 41 Back     alignment and structure
>pdb|3L4H|A Chain A, Helical Box Domain And Second Ww Domain Of The Human E3 Ubiq Protein Ligase Hecw1 Length = 109 Back     alignment and structure
>pdb|3L4H|A Chain A, Helical Box Domain And Second Ww Domain Of The Human E3 Ubiq Protein Ligase Hecw1 Length = 109 Back     alignment and structure
>pdb|1JMQ|A Chain A, Yap65 (L30k Mutant) Ww Domain In Complex With Gtppppytvg Peptide Length = 46 Back     alignment and structure
>pdb|1O6W|A Chain A, Solution Structure Of The Prp40 Ww Domain Pair Of The Yeast Splicing Factor Prp40 Length = 75 Back     alignment and structure
>pdb|2YSG|A Chain A, Solution Structure Of The Ww Domain From The Human Syntaxin- Binding Protein 4 Length = 40 Back     alignment and structure
>pdb|2JO9|A Chain A, Mouse Itch 3rd Ww Domain Complex With The Epstein-Barr Virus Latent Membrane Protein 2a Derived Peptide Eeppppyed Length = 37 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 1e-32
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 2e-12
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 2e-29
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 6e-12
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 3e-11
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 3e-20
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 6e-10
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 5e-06
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 7e-17
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 5e-07
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 2e-05
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 1e-16
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 3e-16
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 1e-16
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 1e-15
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 2e-16
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 3e-16
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 2e-16
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 7e-16
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 2e-16
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 8e-15
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 3e-16
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 8e-16
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 3e-16
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 5e-16
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 3e-16
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 3e-16
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 3e-16
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 1e-15
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} Leng 4e-16
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} Leng 4e-16
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 1e-15
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 1e-15
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 1e-15
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 2e-15
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 4e-15
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 4e-14
1ymz_A43 CC45; artificial protein, computational design, un 1e-14
1ymz_A43 CC45; artificial protein, computational design, un 1e-14
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 2e-14
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 2e-14
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 2e-14
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 2e-14
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 2e-14
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 2e-14
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 4e-14
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 4e-14
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 6e-14
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 1e-13
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 1e-13
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 1e-13
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 2e-13
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 4e-13
2jxw_A75 WW domain-binding protein 4; WW domain containing 3e-13
2jxw_A75 WW domain-binding protein 4; WW domain containing 3e-04
2jxw_A75 WW domain-binding protein 4; WW domain containing 5e-04
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 2e-12
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 6e-12
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 1e-10
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 1e-10
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 2e-10
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 2e-10
3olm_A 429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 2e-08
3olm_A 429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 5e-08
1eg3_A 261 Dystrophin; EF-hand like domain, WW domain, struct 2e-08
1eg3_A 261 Dystrophin; EF-hand like domain, WW domain, struct 6e-08
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 6e-08
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 1e-07
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90 Back     alignment and structure
 Score =  109 bits (273), Expect = 1e-32
 Identities = 36/87 (41%), Positives = 56/87 (64%)

Query: 21  PGSLGPLPEGWDMATTAEGETYFINHTTRTTSWFDPRIPKPSGSVSPGSLGPLPEGWDMA 80
            GS   LPEG++  TT +G+ YF++  T  ++W DPR+P+   +++   LGPLP GW++ 
Sbjct: 4   GGSPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGWEIR 63

Query: 81  TTAEGETYFINHTTRTTSWFDPRIPRS 107
            TA G  YF++H  RTT + DPR+  +
Sbjct: 64  NTATGRVYFVDHNNRTTQFTDPRLSAN 90
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90 Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88 Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88 Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88 Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Length = 75 Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Length = 75 Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Length = 75 Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Length = 50 Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Length = 50 Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Length = 46 Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Length = 46 Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Length = 42 Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Length = 42 Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Length = 49 Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Length = 49 Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Length = 109 Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Length = 109 Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Length = 53 Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Length = 53 Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Length = 46 Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Length = 46 Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Length = 39 Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Length = 39 Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 57 Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 57 Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Length = 41 Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Length = 41 Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Length = 38 Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Length = 38 Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Length = 46 Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Length = 46 Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Length = 49 Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Length = 49 Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Length = 43 Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Length = 43 Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Length = 37 Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Length = 37 Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Length = 36 Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Length = 36 Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Length = 36 Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Length = 36 Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Length = 54 Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Length = 54 Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Length = 49 Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Length = 49 Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 60 Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 60 Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Length = 429 Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Length = 429 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Length = 261 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Length = 261 Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 49 Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 49 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 99.96
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 99.96
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 99.87
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 99.87
2jxw_A75 WW domain-binding protein 4; WW domain containing 99.85
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 99.75
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 99.72
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 99.64
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 99.63
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 99.63
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 99.61
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 99.61
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 99.61
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 99.61
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 99.61
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 99.61
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 99.6
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} 99.6
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 99.59
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 99.59
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 99.59
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 99.58
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 99.58
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 99.58
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 99.57
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 99.57
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 99.57
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 99.56
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 99.55
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 99.55
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 99.55
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 99.55
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 99.55
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 99.55
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 99.54
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 99.53
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 99.53
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 99.53
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 99.52
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} 99.51
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 99.5
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 99.5
1ymz_A43 CC45; artificial protein, computational design, un 99.5
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 99.5
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 99.49
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 99.48
2ho2_A38 Fe65 protein, amyloid beta A4 protein-binding fami 99.48
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 99.47
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 99.46
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 99.46
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 99.43
1ymz_A43 CC45; artificial protein, computational design, un 99.43
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 99.43
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 99.41
2ysc_A39 Amyloid beta A4 precursor protein-binding family B 99.38
2ho2_A38 Fe65 protein, amyloid beta A4 protein-binding fami 99.36
2jv4_A54 Peptidyl-prolyl CIS/trans isomerase; ppiase domain 99.33
2ysc_A39 Amyloid beta A4 precursor protein-binding family B 99.32
2jv4_A54 Peptidyl-prolyl CIS/trans isomerase; ppiase domain 99.32
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 99.3
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 99.29
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 99.29
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 99.28
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 99.24
2jx8_A52 Hpcif1, phosphorylated CTD-interacting factor 1; p 99.19
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 99.16
3olm_A 429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 99.06
2ysi_A40 Transcription elongation regulator 1; Ca150, FBP28 99.06
1eg3_A 261 Dystrophin; EF-hand like domain, WW domain, struct 99.05
2jx8_A52 Hpcif1, phosphorylated CTD-interacting factor 1; p 99.04
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 99.02
2ysi_A40 Transcription elongation regulator 1; Ca150, FBP28 99.01
1ywi_A41 Formin-binding protein 3; WW domain, class II, pro 98.98
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 98.98
3tc5_A 166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 98.97
1eg3_A 261 Dystrophin; EF-hand like domain, WW domain, struct 98.97
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 98.96
1e0l_A37 Formin binding protein; SH3 domain, WW domain, FBP 98.95
3olm_A 429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 98.94
1e0l_A37 Formin binding protein; SH3 domain, WW domain, FBP 98.91
1ywi_A41 Formin-binding protein 3; WW domain, class II, pro 98.91
2jxw_A75 WW domain-binding protein 4; WW domain containing 98.82
1e0n_A27 Hypothetical protein; YJQ8WW domain, WW domain, sa 98.78
1e0n_A27 Hypothetical protein; YJQ8WW domain, WW domain, sa 98.67
2dk7_A73 Transcription elongation regulator 1; structural g 98.32
2dk7_A73 Transcription elongation regulator 1; structural g 98.3
2dk1_A50 WW domain-binding protein 4; WBP-4, formin- bindin 98.27
2dk1_A50 WW domain-binding protein 4; WBP-4, formin- bindin 98.21
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 97.54
1yw5_A 177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 97.38
3le4_A79 Microprocessor complex subunit DGCR8; WW motif, di 96.62
3le4_A79 Microprocessor complex subunit DGCR8; WW motif, di 96.1
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Back     alignment and structure
Probab=99.96  E-value=3.6e-29  Score=162.57  Aligned_cols=82  Identities=41%  Similarity=0.938  Sum_probs=70.5

Q ss_pred             CCCCCCcEEEECCCCCeEEeeCCCCceeccCCCCCCCCCCCCCCCCCCCCCCCeEEEcCCCceEEeeCCCCeeeCCCCCC
Q psy2339          25 GPLPEGWDMATTAEGETYFINHTTRTTSWFDPRIPKPSGSVSPGSLGPLPEGWDMATTAEGETYFINHTTRTTSWFDPRI  104 (125)
Q Consensus        25 ~pLP~gWe~~~~~~Gr~Yy~n~~T~~TtW~~P~~~~~~~~~~~~~~~~LP~gWe~~~d~~G~~yY~nh~t~~T~w~~Pr~  104 (125)
                      .+||+||+++++.+||+||+||+|++|+|++|+..............+||.|||+++|.+|++|||||.|++|+|++||+
T Consensus         8 ~~LP~gWe~~~~~~Gr~YY~n~~t~~t~W~~P~~~~~~~~~~~~~~~~LP~gWe~~~~~~G~~Yy~n~~t~~t~w~~Pr~   87 (90)
T 2kxq_A            8 PDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRL   87 (90)
T ss_dssp             CSCCSSCEEEEETTTEEEEEETTTTEEESSCSSSCSSSCSCCGGGTCCCCSSCCEEECTTSCEEEEETTTTEEESSCTTT
T ss_pred             CCCCCCcEEEECCCCCEEEEECCCCeEeeecccccccccccCcccccccCCCceEEECCCCCEEEEECCCCcEecCCCCc
Confidence            56999999999999999999999999999999876432211122345899999999999999999999999999999998


Q ss_pred             CC
Q psy2339         105 PR  106 (125)
Q Consensus       105 ~~  106 (125)
                      +.
T Consensus        88 ~~   89 (90)
T 2kxq_A           88 SA   89 (90)
T ss_dssp             SC
T ss_pred             CC
Confidence            63
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Back     alignment and structure
>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A Back     alignment and structure
>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Back     alignment and structure
>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A Back     alignment and structure
>1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1e0n_A Hypothetical protein; YJQ8WW domain, WW domain, saccharomyces cerevisae, YJQ8 protein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 Back     alignment and structure
>1e0n_A Hypothetical protein; YJQ8WW domain, WW domain, saccharomyces cerevisae, YJQ8 protein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 Back     alignment and structure
>2dk7_A Transcription elongation regulator 1; structural genomics, WW domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dk7_A Transcription elongation regulator 1; structural genomics, WW domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dk1_A WW domain-binding protein 4; WBP-4, formin- binding protein 21, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2dk1_A WW domain-binding protein 4; WBP-4, formin- binding protein 21, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>3le4_A Microprocessor complex subunit DGCR8; WW motif, dimerization, 3D domain swapping, heme binding, MI processing, heme, iron, metal-binding, nucleus; 1.70A {Homo sapiens} Back     alignment and structure
>3le4_A Microprocessor complex subunit DGCR8; WW motif, dimerization, 3D domain swapping, heme binding, MI processing, heme, iron, metal-binding, nucleus; 1.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 125
d1i5hw_50 b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain 5e-15
d1i5hw_50 b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain 3e-14
d1tk7a145 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) 1e-14
d1tk7a145 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) 1e-14
d1jmqa_46 b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens 6e-14
d1jmqa_46 b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens 5e-13
d2jmfa133 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII 1e-13
d2jmfa133 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII 1e-13
d1pina134 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Ho 9e-08
d1pina134 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Ho 9e-08
d2rm0w137 b.72.1.1 (W:1-37) Formin binding protein FBP28 dom 4e-05
d2rm0w137 b.72.1.1 (W:1-37) Formin binding protein FBP28 dom 4e-05
d1o6wa246 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's 5e-05
d1o6wa246 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's 5e-05
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 50 Back     information, alignment and structure

class: All beta proteins
fold: WW domain-like
superfamily: WW domain
family: WW domain
domain: Ubiquitin ligase NEDD4 WWIII domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 62.1 bits (151), Expect = 5e-15
 Identities = 19/48 (39%), Positives = 26/48 (54%)

Query: 17 GSVSPGSLGPLPEGWDMATTAEGETYFINHTTRTTSWFDPRIPKPSGS 64
            V    LGPLP GW+  T  +G  +FINH  + T W DPR+   + +
Sbjct: 2  SPVDSNDLGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRMQNVAIT 49
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 50 Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 45 Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 45 Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 33 Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 33 Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 46 Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 46 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
d2jmfa133 Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr 99.73
d2jmfa133 Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr 99.69
d1tk7a145 Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso 99.68
d1i5hw_50 Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n 99.65
d1tk7a145 Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso 99.63
d1i5hw_50 Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n 99.61
d1jmqa_46 Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 99.6
d1jmqa_46 Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 99.54
d1pina134 Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId 99.44
d1pina134 Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId 99.39
d2rm0w137 Formin binding protein FBP28 domain {Domestic mous 99.15
d2rm0w137 Formin binding protein FBP28 domain {Domestic mous 99.11
d1o6wa246 Splicing factor prp40 {Baker's yeast (Saccharomyce 99.08
d1o6wa129 Splicing factor prp40 {Baker's yeast (Saccharomyce 99.05
d1ywia128 Huntingtin-interacting protein HYPA/FBP11 {Human ( 99.02
d1o6wa129 Splicing factor prp40 {Baker's yeast (Saccharomyce 99.02
d1ywia128 Huntingtin-interacting protein HYPA/FBP11 {Human ( 98.98
d1o6wa246 Splicing factor prp40 {Baker's yeast (Saccharomyce 98.94
d2ho2a133 Amyloid beta A4 precursor protein-binding family B 98.81
d2dk1a138 WW domain-binding protein 4, WBP4 {Human (Homo sap 98.73
d2dk1a138 WW domain-binding protein 4, WBP4 {Human (Homo sap 98.71
d2ho2a133 Amyloid beta A4 precursor protein-binding family B 98.69
d1eg3a338 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1eg3a338 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 97.75
d2ysca126 Amyloid beta A4 precursor protein-binding family B 96.9
d2ysca126 Amyloid beta A4 precursor protein-binding family B 96.76
d1e0na_27 Hypothetical protein Yjq8 (Set2p) {Baker's yeast ( 95.3
d1e0na_27 Hypothetical protein Yjq8 (Set2p) {Baker's yeast ( 92.59
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All beta proteins
fold: WW domain-like
superfamily: WW domain
family: WW domain
domain: Ubiquitin ligase NEDD4 WWIII domain
species: fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.73  E-value=1.6e-18  Score=90.94  Aligned_cols=33  Identities=55%  Similarity=1.163  Sum_probs=31.9

Q ss_pred             CCCCCCCeEEEcCCCceEEeeCCCCeeeCCCCC
Q psy2339          71 GPLPEGWDMATTAEGETYFINHTTRTTSWFDPR  103 (125)
Q Consensus        71 ~~LP~gWe~~~d~~G~~yY~nh~t~~T~w~~Pr  103 (125)
                      ++||.|||+++|.+|++|||||.|++|+|++||
T Consensus         1 GpLP~GWe~~~d~~G~~Yyinh~t~~T~w~~PR   33 (33)
T d2jmfa1           1 GPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPR   33 (33)
T ss_dssp             SCCCTTEEEEECTTSCEEEEETTTCCEESSCCC
T ss_pred             CccCCCeeEEECCCCCEEEEECCCCcEecCCCC
Confidence            479999999999999999999999999999998
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg3a3 b.72.1.1 (A:47-84) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg3a3 b.72.1.1 (A:47-84) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ysca1 b.72.1.1 (A:8-33) Amyloid beta A4 precursor protein-binding family B member 3, APBB3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ysca1 b.72.1.1 (A:8-33) Amyloid beta A4 precursor protein-binding family B member 3, APBB3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0na_ b.72.1.1 (A:) Hypothetical protein Yjq8 (Set2p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e0na_ b.72.1.1 (A:) Hypothetical protein Yjq8 (Set2p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure